WorldWideScience

Sample records for generation all-sky vhe

  1. Next generation x-ray all-sky monitor

    International Nuclear Information System (INIS)

    Priedhorsky, W. C.; Peele, A. G.; Nugent, K. A.

    1997-01-01

    We set forth a conceptual design for x-ray all-sky monitor based on lobster-eye wide-field telescopes. This instrument, suitable for a small satellite, would monitor the flux of objects as faint as 2x10 -15 W/m 2 (0.5-2.4 keV) on a daily basis with a signal-to-noise of 5. Sources would be located to 1-2 arc-minutes. Detailed simulations show that crosstalk from the cruciform lobster images would not significantly compromise performance. At this sensitivity limit, we could monitor not just x-ray binaries but fainter classes of x-ray sources. Hundreds of active galactic nuclei, coronal sources, and cataclysmic variables could be tracked on a daily basis. Large numbers of fast transients should be visible, including gamma-ray bursts and the soft x-ray breakout of nearby type II supernovae. Long-term x-ray measurements will advance our understanding of the geometries and perhaps masses of AGN, and coronal energy sources in stars

  2. The "All Sky Camera Network"

    Science.gov (United States)

    Caldwell, Andy

    2005-01-01

    In 2001, the "All Sky Camera Network" came to life as an outreach program to connect the Denver Museum of Nature and Science (DMNS) exhibit "Space Odyssey" with Colorado schools. The network is comprised of cameras placed strategically at schools throughout Colorado to capture fireballs--rare events that produce meteorites.…

  3. The SPHEREx All-Sky Spectral Survey

    Science.gov (United States)

    Bock, James; SPHEREx Science Team

    2018-01-01

    SPHEREx, a mission in NASA's Medium Explorer (MIDEX) program that was selected for Phase A in August 2017, is an all-sky survey satellite designed to address all three science goals in NASA's astrophysics division, with a single instrument, a wide-field spectral imager. SPHEREx will probe the physics of inflation by measuring non-Gaussianity by studying large-scale structure, surveying a large cosmological volume at low redshifts, complementing high-z surveys optimized to constrain dark energy. The origin of water and biogenic molecules will be investigated in all phases of planetary system formation - from molecular clouds to young stellar systems with protoplanetary disks - by measuring ice absorption spectra. We will chart the origin and history of galaxy formation through a deep survey mapping large-scale spatial power in two deep fields located near the ecliptic poles. Following in the tradition of all-sky missions such as IRAS, COBE and WISE, SPHEREx will be the first all-sky near-infrared spectral survey. SPHEREx will create spectra (0.75 – 4.2 um at R = 41; and 4.2 – 5 um at R = 135) with high sensitivity making background-limited observations using a passively-cooled telescope with a wide field-of-view for large mapping speed. During its two-year mission, SPHEREx will produce four complete all-sky maps that will serve as a rich archive for the astronomy community. With over a billion detected galaxies, hundreds of millions of high-quality stellar and galactic spectra, and over a million ice absorption spectra, the archive will enable diverse scientific investigations including studies of young stellar systems, brown dwarfs, high-redshift quasars, galaxy clusters, the interstellar medium, asteroids and comets. All aspects of the instrument and spacecraft have high heritage. SPHEREx requires no new technologies and carries large technical and resource margins on every aspect of the design. SPHEREx is a partnership between Caltech and JPL, following the

  4. The all-sky 408 MHz survey

    International Nuclear Information System (INIS)

    Haslam, C.G.T.; Salter, C.J.; Stoffel, H.

    1981-01-01

    A brief outline of the results of this survey is presented. The 408 MHz All-sky Survey has been made from four radio continuum surveys observed between 1965 and 1978, using the Jodrell Bank MKI telescope (Haslam et al., 1970), the Effelsberg 100 metre telescope (Haslam et al., 1974) and the Parkes 64 metre telescope (Haslam et al., 1975). A detailed description of the survey data reduction and calibration methods, with preliminary astronomical results will soon be published (Haslam et al., 1980a) and a second paper will give an atlas of maps at the full survey resolution of 51' arc between half power points (Haslam et al., 1980b). A map, smoothed to a gaussian beam with resolution between half power poitns of 3 0 , is presented. (Auth.)

  5. The SPHEREx All-Sky Spectroscopic Survey

    Science.gov (United States)

    Unwin, Stephen C.; SPHEREx Science Team, SPHEREx Project Team

    2016-06-01

    SPHEREx is a mission to conduct an optical-near-IR survey of the entire sky with a spectrum at every pixel location. It was selected by NASA for a Phase A study in its Small Explorer Program; if selected, development would begin in 2016, and the observatory would start a 2-year prime mission in 2020. An all-sky spectroscopic survey can be used to tackle a wide range of science questions. The SPHEREx science team is focusing on three: (1) Probing the physics of inflation through measuring non-Gaussianity from the study of large-scale structure; (2) Studying the origin of water and biogenic molecules in a wide range of physical and chemical environments via ice absorption spectra; (3) Charting the history of star formation in the universe through intensity mapping of the large-scale spatial power. The instrument is a small wide-field telescope operating in the range of 0.75 - 4.8 µm at a spectral resolution of 41.5 in the optical and 150 at the long-wavelength end. It observes in a sun-sync low-earth orbit, covering the sky like WISE and COBE. SPHEREx is a simple instrument that requires no new technology. The Phase A design has substantial technical and resource margins and can be built with low risk. It is a partnership between Caltech and JPL, with Ball Aerospace and the Korea Astronomy and Space Science Institute as major partners. This research was carried out at the Jet Propulsion Laboratory, California Institute of Technology, under a contract with the National Aeronautics and Space Administration.

  6. Second ROSAT all-sky survey (2RXS) source catalogue

    Science.gov (United States)

    Boller, Th.; Freyberg, M. J.; Trümper, J.; Haberl, F.; Voges, W.; Nandra, K.

    2016-04-01

    Aims: We present the second ROSAT all-sky survey source catalogue, hereafter referred to as the 2RXS catalogue. This is the second publicly released ROSAT catalogue of point-like sources obtained from the ROSAT all-sky survey (RASS) observations performed with the position-sensitive proportional counter (PSPC) between June 1990 and August 1991, and is an extended and revised version of the bright and faint source catalogues. Methods: We used the latest version of the RASS processing to produce overlapping X-ray images of 6.4° × 6.4° sky regions. To create a source catalogue, a likelihood-based detection algorithm was applied to these, which accounts for the variable point-spread function (PSF) across the PSPC field of view. Improvements in the background determination compared to 1RXS were also implemented. X-ray control images showing the source and background extraction regions were generated, which were visually inspected. Simulations were performed to assess the spurious source content of the 2RXS catalogue. X-ray spectra and light curves were extracted for the 2RXS sources, with spectral and variability parameters derived from these products. Results: We obtained about 135 000 X-ray detections in the 0.1-2.4 keV energy band down to a likelihood threshold of 6.5, as adopted in the 1RXS faint source catalogue. Our simulations show that the expected spurious content of the catalogue is a strong function of detection likelihood, and the full catalogue is expected to contain about 30% spurious detections. A more conservative likelihood threshold of 9, on the other hand, yields about 71 000 detections with a 5% spurious fraction. We recommend thresholds appropriate to the scientific application. X-ray images and overlaid X-ray contour lines provide an additional user product to evaluate the detections visually, and we performed our own visual inspections to flag uncertain detections. Intra-day variability in the X-ray light curves was quantified based on the

  7. An All-Sky Portable (ASP) Optical Catalogue

    Science.gov (United States)

    Flesch, Eric Wim

    2017-06-01

    This optical catalogue combines the all-sky USNO-B1.0/A1.0 and most-sky APM catalogues, plus overlays of SDSS optical data, into a single all-sky map presented in a sparse binary format that is easily downloaded at 9 Gb zipped. Total count is 1 163 237 190 sources and each has J2000 astrometry, red and blue magnitudes with PSFs and variability indicator, and flags for proper motion, epoch, and source survey and catalogue for each of the photometry and astrometry. The catalogue is available on http://quasars.org/asp.html, and additional data for this paper is available at http://dx.doi.org/10.4225/50/5807fbc12595f.

  8. The WATCH All-Sky Monitor for the Granat Project

    DEFF Research Database (Denmark)

    Brandt, Søren; Lund, Niels; Rao, A. R.

    1990-01-01

    The Watch X-ray all-sky monitor, which is designed to localize strong X-ray sources and follow their development, is examined, focusing on the addition of four Watch units to the Granat satellite project. The components of the Watch instrument are described and the capabilities and potential...... scientific returns of the Granat project are discussed. The applications of the Watch monitor are given, including the study of time variations of known sources and the detection and localization of new, transient sources....

  9. 2MASS - The 2 Micron All Sky Survey

    Science.gov (United States)

    Kleinmann, S. G.

    1992-01-01

    This paper describes a new sky survey to be carried out in three wavebands, J(1.25 m), H(1.65 m), and K(2.2 m). The limiting sensitivity of the survey, 10 sigma detection of point sources with K not greater than 14 mag, coupled with its all-sky coverage, were selected primarily to support studies of the large-scale structure of the Milky Way and the Local Universe. The survey requires construction of a pair of observing facilities, one each for the Northern and Southern Hemispheres. Operations are scheduled to begin in 1995. The data will begin becoming publicly available soon thereafter.

  10. The Einstein All-Sky IPC slew survey

    Science.gov (United States)

    Elvis, Martin; Plummer, David; Fabbiano, G.

    1989-01-01

    The construction of the Einstein All-Sky Imaging Proportional Counter (IPC) slew survey is considered. It contains approximately 1000 sources between 10(exp -12) and 10(exp -10) erg/sq cm/s with a concentration toward the ecliptic poles and away from the galactic plane. Several sizable samples of bright soft X-ray selected objects for follow-up ROSAT and ASTRO-D observations and statistical study are presented. The survey source list is expected to be available by late 1989. Both paper and remote access online data base versions are to be available. An identification program is considered.

  11. Reflective all-sky thermal infrared cloud imager.

    Science.gov (United States)

    Redman, Brian J; Shaw, Joseph A; Nugent, Paul W; Clark, R Trevor; Piazzolla, Sabino

    2018-04-30

    A reflective all-sky imaging system has been built using a long-wave infrared microbolometer camera and a reflective metal sphere. This compact system was developed for measuring spatial and temporal patterns of clouds and their optical depth in support of applications including Earth-space optical communications. The camera is mounted to the side of the reflective sphere to leave the zenith sky unobstructed. The resulting geometric distortion is removed through an angular map derived from a combination of checkerboard-target imaging, geometric ray tracing, and sun-location-based alignment. A tape of high-emissivity material on the side of the reflector acts as a reference that is used to estimate and remove thermal emission from the metal sphere. Once a bias that is under continuing study was removed, sky radiance measurements from the all-sky imager in the 8-14 μm wavelength range agreed to within 0.91 W/(m 2 sr) of measurements from a previously calibrated, lens-based infrared cloud imager over its 110° field of view.

  12. Detecting TLEs using a massive all-sky camera network

    Science.gov (United States)

    Garnung, M. B.; Celestin, S. J.

    2017-12-01

    Transient Luminous Events (TLEs) are large-scale optical events occurring in the upper-atmosphere from the top of thunderclouds up to the ionosphere. TLEs may have important effects in local, regional, and global scales, and many features of TLEs are not fully understood yet [e.g, Pasko, JGR, 115, A00E35, 2010]. Moreover, meteor events have been suggested to play a role in sprite initiation by producing ionospheric irregularities [e.g, Qin et al., Nat. Commun., 5, 3740, 2014]. The French Fireball Recovery and InterPlanetary Observation Network (FRIPON, https://www.fripon.org/?lang=en), is a national all-sky 30 fps camera network designed to continuously detect meteor events. We seek to make use of this network to observe TLEs over unprecedented space and time scales ( 1000×1000 km with continuous acquisition). To do so, we had to significantly modify FRIPON's triggering software Freeture (https://github.com/fripon/freeture) while leaving the meteor detection capability uncompromised. FRIPON has a great potential in the study of TLEs. Not only could it produce new results about spatial and time distributions of TLEs over a very large area, it could also be used to validate and complement observations from future space missions such as ASIM (ESA) and TARANIS (CNES). In this work, we present an original image processing algorithm that can detect sprites using all-sky cameras while strongly limiting the frequency of false positives and our ongoing work on sprite triangulation using the FRIPON network.

  13. The Sondrestrom Research Facility All-sky Imagers

    Science.gov (United States)

    Kendall, E. A.; Grill, M.; Gudmundsson, E.; Stromme, A.

    2010-12-01

    The Sondrestrom Upper Atmospheric Research Facility is located near Kangerlussuaq, Greenland, just north of the Arctic Circle and 100 km inland from the west coast of Greenland. The facility is operated by SRI International in Menlo Park, California, under the auspices of the U.S. National Science Foundation. Operating in Greenland since 1983, the Sondrestrom facility is host to more than 20 instruments, the majority of which provide unique and complementary information about the arctic upper atmosphere. Together these instruments advance our knowledge of upper atmospheric physics and determine how the tenuous neutral gas interacts with the charged space plasma environment. The suite of instrumentation supports many disciplines of research - from plate tectonics to auroral physics and space weather. The Sondrestrom facility has recently acquired two new all-sky imagers. In this paper, we present images from both new imagers, placing them in context with other instruments at the site and detailing to the community how to gain access to this new data set. The first new camera replaces the intensified auroral system which has been on site for nearly three decades. This new all-sky imager (ASI), designed and assembled by Keo Scientific Ltd., employs a medium format 180° fisheye lens coupled to a set of five 3-inch narrowband interference filters. The current filter suite allows operation at the following wavelengths: 750 nm, 557.7 nm, 777.4 nm, 630.0 nm, and 732/3 nm. Monochromatic images from the ASI are acquired at a specific filter and integration time as determined by a unique configuration file. Integrations as short as 0.5 sec can be commanded for exceptionally bright features. Preview images are posted to the internet in near real-time, with final images posted weeks later. While images are continuously collected in a "patrol mode," users can request special collection sequences for targeted experiments. The second new imager installed at the Sondrestrom

  14. Gaia , an all sky astrometric and photometric survey

    International Nuclear Information System (INIS)

    Carrasco, J.M.

    2017-01-01

    Gaia space mission includes a low resolution spectroscopic instrument to classify and parametrize the observed sources. Gaia is a full-sky unbiased survey down to about 20th magnitude. The scanning law yields a rather uniform coverage of the sky over the full mission. The data reduction is a global one over the full mission. Both sky coverage and data reduction strategy ensure an unprecedented all-sky homogeneous spectrophotometric survey. Certainly, that survey is of interest for future on-ground and space projects (LSST, PLATO, EUCLID, ...). This work addresses the exploitation of the Gaia spectrophotometry as standard photometry reference through the discussion of the sky coverage, the spectrophotometric precision and the expected uncertainties of the synthetic photometry derived from the low resolution Gaia spectra and photometry.

  15. Using All-Sky Imaging to Improve Telescope Scheduling (Abstract)

    Science.gov (United States)

    Cole, G. M.

    2017-12-01

    (Abstract only) Automated scheduling makes it possible for a small telescope to observe a large number of targets in a single night. But when used in areas which have less-than-perfect sky conditions such automation can lead to large numbers of observations of clouds and haze. This paper describes the development of a "sky-aware" telescope automation system that integrates the data flow from an SBIG AllSky340c camera with an enhanced dispatch scheduler to make optimum use of the available observing conditions for two highly instrumented backyard telescopes. Using the minute-by-minute time series image stream and a self-maintained reference database, the software maintains a file of sky brightness, transparency, stability, and forecasted visibility at several hundred grid positions. The scheduling software uses this information in real time to exclude targets obscured by clouds and select the best observing task, taking into account the requirements and limits of each instrument.

  16. Automated Meteor Detection by All-Sky Digital Camera Systems

    Science.gov (United States)

    Suk, Tomáš; Šimberová, Stanislava

    2017-12-01

    We have developed a set of methods to detect meteor light traces captured by all-sky CCD cameras. Operating at small automatic observatories (stations), these cameras create a network spread over a large territory. Image data coming from these stations are merged in one central node. Since a vast amount of data is collected by the stations in a single night, robotic storage and analysis are essential to processing. The proposed methodology is adapted to data from a network of automatic stations equipped with digital fish-eye cameras and includes data capturing, preparation, pre-processing, analysis, and finally recognition of objects in time sequences. In our experiments we utilized real observed data from two stations.

  17. All-sky photogrammetry techniques to georeference a cloud field

    Science.gov (United States)

    Crispel, Pierre; Roberts, Gregory

    2018-01-01

    In this study, we present a novel method of identifying and geolocalizing cloud field elements from a portable all-sky camera stereo network based on the ground and oriented towards zenith. The methodology is mainly based on stereophotogrammetry which is a 3-D reconstruction technique based on triangulation from corresponding stereo pixels in rectified images. In cases where clouds are horizontally separated, identifying individual positions is performed with segmentation techniques based on hue filtering and contour detection algorithms. Macroscopic cloud field characteristics such as cloud layer base heights and velocity fields are also deduced. In addition, the methodology is fitted to the context of measurement campaigns which impose simplicity of implementation, auto-calibration, and portability. Camera internal geometry models are achieved a priori in the laboratory and validated to ensure a certain accuracy in the peripheral parts of the all-sky image. Then, stereophotogrammetry with dense 3-D reconstruction is applied with cameras spaced 150 m apart for two validation cases. The first validation case is carried out with cumulus clouds having a cloud base height at 1500 m a.g.l. The second validation case is carried out with two cloud layers: a cumulus fractus layer with a base height at 1000 m a.g.l. and an altocumulus stratiformis layer with a base height of 2300 m a.g.l. Velocity fields at cloud base are computed by tracking image rectangular patterns through successive shots. The height uncertainty is estimated by comparison with a Vaisala CL31 ceilometer located on the site. The uncertainty on the horizontal coordinates and on the velocity field are theoretically quantified by using the experimental uncertainties of the cloud base height and camera orientation. In the first cumulus case, segmentation of the image is performed to identify individuals clouds in the cloud field and determine the horizontal positions of the cloud centers.

  18. Digital all-sky polarization imaging of partly cloudy skies.

    Science.gov (United States)

    Pust, Nathan J; Shaw, Joseph A

    2008-12-01

    Clouds reduce the degree of linear polarization (DOLP) of skylight relative to that of a clear sky. Even thin subvisual clouds in the "twilight zone" between clouds and aerosols produce a drop in skylight DOLP long before clouds become visible in the sky. In contrast, the angle of polarization (AOP) of light scattered by a cloud in a partly cloudy sky remains the same as in the clear sky for most cases. In unique instances, though, select clouds display AOP signatures that are oriented 90 degrees from the clear-sky AOP. For these clouds, scattered light oriented parallel to the scattering plane dominates the perpendicularly polarized Rayleigh-scattered light between the instrument and the cloud. For liquid clouds, this effect may assist cloud particle size identification because it occurs only over a relatively limited range of particle radii that will scatter parallel polarized light. Images are shown from a digital all-sky-polarization imager to illustrate these effects. Images are also shown that provide validation of previously published theories for weak (approximately 2%) polarization parallel to the scattering plane for a 22 degrees halo.

  19. Dusty WDs in the WISE all sky survey ∩ SDSS

    Energy Technology Data Exchange (ETDEWEB)

    Barber, Sara D.; Kilic, Mukremin; Gianninas, A. [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W. Brooks St., Norman, OK 73019 (United States); Brown, Warren R., E-mail: barber@nhn.ou.edu [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States)

    2014-05-10

    A recent cross-correlation between the Sloan Digital Sky Survey (SDSS) Data Release 7 White Dwarf Catalog with the Wide-Field Infrared Survey Explorer (WISE) all-sky photometry at 3.4, 4.6, 12, and 22 μm performed by Debes et al. resulted in the discovery of 52 candidate dusty white dwarfs (WDs). However, the 6'' WISE beam allows for the possibility that many of the excesses exhibited by these WDs may be due to contamination from a nearby source. We present MMT+SAO Wide-Field InfraRed Camera J- and H-band imaging observations (0.''5-1.''5 point spread function) of 16 of these candidate dusty WDs and confirm that four have spectral energy distributions (SEDs) consistent with a dusty disk and are not accompanied by a nearby source contaminant. The remaining 12 WDs have contaminated WISE photometry and SEDs inconsistent with a dusty disk when the contaminating sources are not included in the photometry measurements. We find the frequency of disks around single WDs in the WISE ∩ SDSS sample to be 2.6%-4.1%. One of the four new dusty WDs has a mass of 1.04 M {sub ☉} (progenitor mass 5.4 M {sub ☉}) and its discovery offers the first confirmation that massive WDs (and their massive progenitor stars) host planetary systems.

  20. Current Status of The Low Frequency All Sky Monitor

    Science.gov (United States)

    Dartez, Louis; Creighton, Teviet; Jenet, Fredrick; Dolch, Timothy; Boehler, Keith; Bres, Luis; Cole, Brent; Luo, Jing; Miller, Rossina; Murray, James; Reyes, Alex; Rivera, Jesse

    2018-01-01

    The Low Frequency All Sky Monitor (LoFASM) is a distributed array of cross-dipole antennas that are sensitive to radio frequencies from 10 to 88 MHz. LoFASM consists of antennas and front end electronics that were originally developed for the Long Wavelength Array by the U.S. Naval Research Lab, the University of New Mexico, Virginia Tech, and the Jet Propulsion Laboratory. LoFASM, funded by the U.S. Department of Defense, will initially consist of 4 stations, each consisting of 12 dual- polarization dipole antenna stands. The primary science goals of LoFASM will be the detection and study of low-frequency radio transients, a high priority science goal as deemed by the National Research Council’s ASTRO2010 decadal survey. The data acquisition system for the LoFASM antenna array uses Field Programmable Gate Array (FPGA) technology to implement a real time full Stokes spectrometer and data recorder. This poster presents an overview of the LoFASM Radio Telescope as well as the status of data analysis of initial commissioning observations.

  1. A prototype for the PASS Permanent All Sky Survey

    Science.gov (United States)

    Deeg, H. J.; Alonso, R.; Belmonte, J. A.; Horne, K.; Alsubai, K.; Collier Cameron, A.; Doyle, L. R.

    2004-10-01

    A prototype system for the Permanent All Sky Survey (PASS) project is presented. PASS is a continuous photometric survey of the entire celestial sphere with a high temporal resolution. Its major objectives are the detection of all giant-planet transits (with periods up to some weeks) across stars up to mag 10.5, and to deliver continuously photometry that is useful for the study of any variable stars. The prototype is based on CCD cameras with short focal length optics on a fixed mount. A small dome to house it at Teide Observatory, Tenerife, is currently being constructed. A placement at the antarctic Dome C is also being considered. The prototype will be used for a feasibility study of PASS, to define the best observing strategies, and to perform a detailed characterization of the capabilities and scope of the survey. Afterwards, a first partial sky surveying will be started with it. That first survey may be able to detect transiting planets during its first few hundred hours of operation. It will also deliver a data set around which software modules dealing with the various scientific objectives of PASS will be developed. The PASS project is still in its early phase and teams interested in specific scientific objectives, in providing technical expertise, or in participating with own observations are invited to collaborate.

  2. All-Sky Interferometry with Spherical Harmonic Transit Telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Shaw, J.Richard [Canadian Inst. Theor. Astrophys.; Sigurdson, Kris [British Columbia U.; Pen, Ue-Li [Canadian Inst. Theor. Astrophys.; Stebbins, Albert [Fermilab; Sitwell, Michael [British Columbia U.

    2013-02-01

    In this paper we describe the spherical harmonic transit telescope, a novel formalism for the analysis of transit radio telescopes. This all-sky approach bypasses the curved sky complications of traditional interferometry and so is particularly well suited to the analysis of wide-field radio interferometers. It enables compact and computationally efficient representations of the data and its statistics that allow new ways of approaching important problems like map-making and foreground removal. In particular, we show how it enables the use of the Karhunen-Loeve transform as a highly effective foreground filter, suppressing realistic foreground residuals for our fiducial example by at least a factor twenty below the 21cm signal even in highly contaminated regions of the sky. This is despite the presence of the angle-frequency mode mixing inherent in real-world instruments with frequency-dependent beams. We show, using Fisher forecasting, that foreground cleaning has little effect on power spectrum constraints compared to hypothetical foreground-free measurements. Beyond providing a natural real-world data analysis framework for 21cm telescopes now under construction and future experiments, this formalism allows accurate power spectrum forecasts to be made that include the interplay of design constraints and realistic experimental systematics with twenty-first century 21cm science.

  3. Gaia, an all-sky survey for standard photometry

    Science.gov (United States)

    Carrasco, J. M.; Weiler, M.; Jordi, C.; Fabricius, C.

    2017-03-01

    Gaia ESA's space mission (launched in 2013) includes two low resolution spectroscopic instruments (one in the blue, BP, and another in the red, RP, wavelength domains) to classify and derive the astrophysical parameters of the observed sources. As it is well known, Gaia is a full-sky unbiased survey down to about 20th magnitude. The scanning law yields a rather uniform coverage of the sky over the full extent (a minimum of 5 years) of the mission. Gaia data reduction is a global one over the full mission. Both sky coverage and data reduction strategy ensure an unprecedented all-sky homogeneous spectrophotometric survey. Certainly, that survey is of interest for current and future on-ground and space projects, like LSST, PLATO, EUCLID and J-PAS/J-PLUS among others. These projects will benefit from the large amount (more than one billion) and wide variety of objects observed by Gaia with good quality spectrophotometry. Synthetic photometry derived from Gaia spectrophotometry for any passband can be used to expand the set of standard sources for these new instruments to come. In the current Gaia data release scenario, BP/RP spectrophotometric data will be available in the third release (in 2018, TBC). Current preliminary results allow us to estimate the precision of synthetic photometry derived from the Gaia data. This already allows the preparation of the on-going and future surveys and space missions. We discuss here the exploitation of the Gaia spectrophotometry as standard reference due to its full-sky coverage and its expected photometric uncertainties derived from the low resolution Gaia spectra.

  4. Assimilating All-Sky Himawari-8 Satellite Infrared Radiances: A Case of Typhoon Soudelor (2015)

    OpenAIRE

    Honda, Takumi; Miyoshi, Takemasa; Lien, Guo-Yuan; Nishizawa, Seiya; Yoshida, Ryuji; Adachi, Sachiho A.; Terasaki, Koji; Okamoto, Kozo; Tomita, Hirofumi; Bessho, Kotaro

    2018-01-01

    Japan’s new geostationary satellite Himawari-8, the first of a series of the third-generation geostationary meteorological satellites includingGOES-16, has been operational since July 2015. Himawari-8 produces highresolution observations with 16 frequency bands every 10 min for full disk, and every 2.5 min for local regions. This study aims to assimilate all-sky every-10-min infrared (IR) radiances from Himawari-8 with a regional numerical weather prediction model and to investigate its impac...

  5. IS THE TWO MICRON ALL SKY SURVEY CLUSTERING DIPOLE CONVERGENT?

    International Nuclear Information System (INIS)

    Bilicki, Maciej; Chodorowski, Michal; Jarrett, Thomas; Mamon, Gary A.

    2011-01-01

    There is a long-standing controversy about the convergence of the dipole moment of the galaxy angular distribution (the so-called clustering dipole). Is the dipole convergent at all, and if so, what is the scale of the convergence? We study the growth of the clustering dipole of galaxies as a function of the limiting flux of the sample from the Two Micron All Sky Survey (2MASS). Contrary to some earlier claims, we find that the dipole does not converge before the completeness limit of the 2MASS Extended Source Catalog, i.e., up to 13.5 mag in the near-infrared K s band (equivalent to an effective distance of 300 Mpc h -1 ). We compare the observed growth of the dipole with the theoretically expected, conditional one (i.e., given the velocity of the Local Group relative to the cosmic microwave background), for the ΛCDM power spectrum and cosmological parameters constrained by the Wilkinson Microwave Anisotropy Probe. The observed growth turns out to be within 1σ confidence level of its theoretical counterpart once the proper observational window of the 2MASS flux-limited catalog is included. For a contrast, if the adopted window is a top hat, then the predicted dipole grows significantly faster and converges (within the errors) to its final value for a distance of about 300 Mpc h -1 . By comparing the observational windows, we show that for a given flux limit and a corresponding distance limit, the 2MASS flux-weighted window passes less large-scale signal than the top-hat one. We conclude that the growth of the 2MASS dipole for effective distances greater than 200 Mpc h -1 is only apparent. On the other hand, for a distance of 80 Mpc h -1 (mean depth of the 2MASS Redshift Survey) and the ΛCDM power spectrum, the true dipole is expected to reach only ∼80% of its final value. Eventually, since for the window function of 2MASS the predicted growth is consistent with the observed one, we can compare the two to evaluate β ≡ Ω m 0.55 /b. The result is β = 0.38

  6. LoFASM: A Low Frequency All Sky Monitor for Radio Transients and Student Training

    Science.gov (United States)

    2015-09-02

    SECURITY CLASSIFICATION OF: The Low-Frequency All- Sky Monitor (LoFASM) is an innovative new radio astronomy observatory. Designed and built by...Feb-2015 Approved for Public Release; Distribution Unlimited Final Report: LoFASM: A Low Frequency All Sky Monitor for Radio Transients and Student...reviewed journals: Number of Papers published in non peer-reviewed journals: Final Report: LoFASM: A Low Frequency All Sky Monitor for Radio Transients and

  7. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  8. The California All-sky Meteor Surveillance (CAMS) System

    Science.gov (United States)

    Gural, P. S.

    2011-01-01

    A unique next generation multi-camera, multi-site video meteor system is being developed and deployed in California to provide high accuracy orbits of simultaneously captured meteors. Included herein is a description of the goals, concept of operations, hardware, and software development progress. An appendix contains a meteor camera performance trade study made for video systems circa 2010.

  9. Planck intermediate results XXIX. All-sky dust modelling with Planck, IRAS, and WISE observations

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Alves, M. I. R.

    2016-01-01

    We present all-sky modelling of the high resolution Planck, IRAS, andWISE infrared (IR) observations using the physical dust model presented by Draine & Li in 2007 (DL, ApJ, 657, 810). We study the performance and results of this model, and discuss implications for future dust modelling....... The present work extends the DL dust modelling carried out on nearby galaxies using Herschel and Spitzer data to Galactic dust emission. We employ the DL dust model to generate maps of the dust mass surface density Sigma(Md), the dust optical extinction A(V), and the starlight intensity heating the bulk...... of the dust, parametrized by U-min. The DL model reproduces the observed spectral energy distribution (SED) satisfactorily over most of the sky, with small deviations in the inner Galactic disk and in low ecliptic latitude areas, presumably due to zodiacal light contamination. In the Andromeda galaxy (M31...

  10. Planck 2013 results. XI. All-sky model of thermal dust emission

    DEFF Research Database (Denmark)

    Abergel, A.; Ade, P. A. R.; Aghanim, N.

    2014-01-01

    This paper presents an all-sky model of dust emission from the Planck 353, 545, and 857 GHz, and IRAS 100 mu m data. Using a modified blackbody fit to the data we present all-sky maps of the dust optical depth, temperature, and spectral index over the 353-3000 GHz range. This model is a good repr...

  11. Comparison of auroral ovals from all-sky camera studies and from satellite photographs

    International Nuclear Information System (INIS)

    Bond, F.R.; Akasofu, S.I.

    1979-01-01

    A comparison is made of the statistical auroral ovals determined by all-sky camera photographs with DMSP photographs for different degrees of geomagnetic activity. It is shown that the agreement between them is excellent. (author)

  12. All-sky radiance simulation of Megha-Tropiques SAPHIR microwave ...

    Indian Academy of Sciences (India)

    used as input to the RTTOV model to simulate cloud-affected SAPHIR radiances. ... All-sky radiance simulation; Megha tropiques; microwave SAPHIR sensor; radiative transfer; data ... versions of these non-linear processes (Ohring and.

  13. Weather and atmosphere observation with the ATOM all-sky camera

    Directory of Open Access Journals (Sweden)

    Jankowsky Felix

    2015-01-01

    Full Text Available The Automatic Telescope for Optical Monitoring (ATOM for H.E.S.S. is an 75 cm optical telescope which operates fully automated. As there is no observer present during observation, an auxiliary all-sky camera serves as weather monitoring system. This device takes an all-sky image of the whole sky every three minutes. The gathered data then undergoes live-analysis by performing astrometric comparison with a theoretical night sky model, interpreting the absence of stars as cloud coverage. The sky monitor also serves as tool for a meteorological analysis of the observation site of the the upcoming Cherenkov Telescope Array. This overview covers design and benefits of the all-sky camera and additionally gives an introduction into current efforts to integrate the device into the atmosphere analysis programme of H.E.S.S.

  14. Review of all-sky camera data for the period Sep. 1 to Dec. 1, 1976

    International Nuclear Information System (INIS)

    1978-02-01

    The auroral and cloud conditions are presented in the form of a numerical code, in coordinate tables, the coordinates representing the date and universal time respectively. The compilation is intended to be a guide to available all-sky camera films, copies of which are supplied at self-cost prices by the Auroral Observatory. (JIW)

  15. Coherently combining data between detectors for all-sky semi-coherent continuous gravitational wave searches

    International Nuclear Information System (INIS)

    Goetz, E; Riles, K

    2016-01-01

    We present a method for coherently combining short data segments from gravitational-wave detectors to improve the sensitivity of semi-coherent searches for continuous gravitational waves. All-sky searches for continuous gravitational waves from unknown sources are computationally limited. The semi-coherent approach reduces the computational cost by dividing the entire observation timespan into short segments to be analyzed coherently, then combined together incoherently. Semi-coherent analyses that attempt to improve sensitivity by coherently combining data from multiple detectors face a computational challenge in accounting for uncertainties in signal parameters. In this article, we lay out a technique to meet this challenge using summed Fourier transform coefficients. Applying this technique to one all-sky search algorithm called TwoSpect, we confirm that the sensitivity of all-sky, semi-coherent searches can be improved by coherently combining the short data segments, e.g., by up to 42% over a single detector for an all-sky search. For misaligned detectors, however, this improvement requires careful attention when marginalizing over unknown polarization parameters. In addition, care must be taken in correcting for differential detector velocity due to the Earth’s rotation for high signal frequencies and widely separated detectors. (paper)

  16. Long term variability of Cygnus X-1. V. State definitions with all sky monitors

    NARCIS (Netherlands)

    Grinberg, V.; Hell, N.; Pottschmidt, K.; Böck, M.; Nowak, M.A.; Rodriguez, J.; Bodaghee, A.; Cadolle Bel, M.; Case, G.L.; Hanke, M.; Kühnel, M.; Markoff, S.; Pooley, G.G.; Rothschild, R.E.; Tomsick, J.A.; Wilson-Hodge, C.A.; Wilms, J.

    2013-01-01

    We present a scheme for determining the spectral state of the canonical black hole Cyg X-1 using data from previous and current X-ray all sky monitors (RXTE-ASM, Swift-BAT, MAXI, and Fermi-GBM). Determinations of the hard/intermediate and soft state agree to better than 10% between different

  17. All-sky search for short gravitational-wave bursts in the first Advanced LIGO run

    NARCIS (Netherlands)

    Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Phythian-Adams, A.T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.T.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allocca, A.; Altin, P. A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, R.D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Beer, C.; Bejger, M.; Belahcene, I.; Belgin, M.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, M.J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, A.L.S.; Bock, O.; Boer, M.; Bogaert, J.G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, A.D.; Brown, D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Bustillo, J. Calderon; Callister, T. A.; Calloni, E.; Camp, J. B.; Canepa, M.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, D. S.; Charlton, P.; Chassande-Mottin, E.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y; Cheng, H. -P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Qian; Chua, A. J. K.; Chua, S. E.; Chung, E.S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Cominsky, L.; Constancio, M., Jr.; Conti, L.; Cooper, S. J.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, A.C.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, A.L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Costa, C. F. Da Silva; Dattilo, V.; Dave, I.; Davier, M.; Davies, G. S.; Davis, D.; Daw, E. J.; Day, B.; Day, R.; De, S.; Debra, D.; Debreczeni, G.; Degallaix, J.; De laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.A.; Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Diaz, M. C.; Di Fiore, L.; Giovanni, M.G.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Virgilio, A.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Alvarez, M. Dovale; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H. -B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Etienne, Z.; Etzel, T.; Evans, M.C.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.M.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Galiana, A. Fernandez; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M; Fong, H.; Forsyth, S. S.; Fournier, J. -D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garufi, F.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.P.; Glaefke, A.; Goetz, E.; Goetz, R.; Gondan, L.; Gonzalez, R.G.; Castro, J. M. Gonzalez; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Lee-Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.M.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Buffoni-Hall, R.; Hall, E. D.; Hammond, G.L.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hanson, P.J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C. -J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.A.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J. -M.; Isi, M.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jimenez-Forteza, F.; Johnson, W.; Jones, I.D.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kandhasamy, S.; Kang, G.H.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kefelian, F.; Keitel, D.; Kelley, D. B.; Kennedy, R.E.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan., S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, Whansun; Kim, W.; Kim, Y.M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Klein, B.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kraemer, H.C.; Kringel, V.; Krishnan, B.; Krolak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C.H.; Lee, K.H.; Lee, M.H.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lockerbie, N. A.; Lombardi, A. L.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Luck, H.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magana-Sandoval, F.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Marka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGrath Hoareau, C.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mendell, G.; Mendoza-Gandara, D.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, F.A.; Miller, B.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B.C.; Moore, J.C.; Moraru, D.; Gutierrez Moreno, M.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, S.D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P.G.; Mytidis, A.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nelemans, G.; Nelson, T. J. N.; Gutierrez-Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton-Howes, G.; Nguyen, T. T.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J.; Oh, S. H.; Ohme, F.; Oliver, M. B.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.S; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Castro-Perez, J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poe, M.; Poggiani, R.; Popolizio, P.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Puerner, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Rhoades, E.; Ricci, F.; Riles, K.; Rizzo, D.M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romie, J. H.; Rosinska, D.; Rowan, S.; Ruediger, A.; Ruggi, P.; Ryan, K.A.; Sachdev, P.S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J; Schmidt, P.; Schnabel, R.B.; Schofield, R. M. S.; Schoenbeck, A.; Schreiber, K.E.C.; Schuette, D.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, M.S.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Setyawati, Y.; Shaddock, D. A.; Shaffer, T. J.; Shahriar, M. S.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, António Dias da; Singer, A; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J.R.; Smith, R. J. E.; Son, E. J.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stevenson-Moore, P.; Stone, J.R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepanczyk, M. J.; Tacca, M.D.; Talukder, D.; Tanner, D. B.; Tapai, M.; Taracchini, A.; Taylor, W.R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thrane, E.; Tippens, T.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tomlinson, C.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Torya, D.; Travasso, F.; Traylor, G.; Trifiro, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tse, M.; Tso, R.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.G.; van den Brand, J. F. J.; Van Den Broeck, C.F.F.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasuth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P.J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Vicere, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, MT; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, M.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.M.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, D.R.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Worden, J.; Wright, J.L.; Wu, D.S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; Zadrozny, A.; Zangrando, L.; Zanolin, M.; Zendri, J. -P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S.J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.

    2017-01-01

    We present the results from an all-sky search for short-duration gravitational waves in the data of the first run of the Advanced LIGO detectors between September 2015 and January 2016. The search algorithms use minimal assumptions on the signal morphology, so they are sensitive to a wide range of

  18. Planck early results. VIII. The all-sky early Sunyaev-Zeldovich cluster sample

    DEFF Research Database (Denmark)

    Poutanen, T.; Natoli, P.; Polenta, G.

    2011-01-01

    We present the first all-sky sample of galaxy clusters detected blindly by the Planck satellite through the Sunyaev-Zeldovich (SZ) effect from its six highest frequencies. This early SZ (ESZ) sample is comprised of 189 candidates, which have a high signal-to-noise ratio ranging from 6 to 29. Its ...

  19. A Method for Deriving All-Sky Evapotranspiration From the Synergistic Use of Remotely Sensed Images and Meteorological Data

    Science.gov (United States)

    Leng, Pei; Li, Zhao-Liang; Duan, Si-Bo; Tang, Ronglin; Gao, Mao-Fang

    2017-12-01

    Evapotranspiration (ET) is an important component of the water and energy cycle. The present study develops a practical approach for generating all-sky ET with the synergistic use of satellite images and meteorological data. In this approach, the ET over clear-sky pixels is estimated from a two-stage land surface temperature (LST)/fractional vegetation cover feature space method where the dry/wet edges are determined from theoretical calculations. For cloudy pixels, the Penman-Monteith equation is used to calculate the ET where no valid remotely sensed LST is available. An evaluation of the method with ET collected at ground-based large aperture scintillometer measurements at the Yucheng Comprehensive Experimental Station (YCES) in China is performed over a growth period from April to October 2010. The results show that the root-mean-square error (RMSE) and bias over clear-sky pixels are 57.3 W/m2 and 18.2 W/m2, respectively, whereas an RMSE of 69.3 W/m2 with a bias of 12.3 W/m2 can be found over cloudy pixels. Moreover, a reasonable overall RMSE of 65.3 W/m2 with a bias of 14.4 W/m2 at the YCES can be obtained under all-sky conditions, indicating a promising prospect for the derivation of all-sky ET using currently available satellite and meteorological data at a regional or global scale in future developments.

  20. Application of simple all-sky imagers for the estimation of aerosol optical depth

    Science.gov (United States)

    Kazantzidis, Andreas; Tzoumanikas, Panagiotis; Nikitidou, Efterpi; Salamalikis, Vasileios; Wilbert, Stefan; Prahl, Christoph

    2017-06-01

    Aerosol optical depth is a key atmospheric constituent for direct normal irradiance calculations at concentrating solar power plants. However, aerosol optical depth is typically not measured at the solar plants for financial reasons. With the recent introduction of all-sky imagers for the nowcasting of direct normal irradiance at the plants a new instrument is available which can be used for the determination of aerosol optical depth at different wavelengths. In this study, we are based on Red, Green and Blue intensities/radiances and calculations of the saturated area around the Sun, both derived from all-sky images taken with a low-cost surveillance camera at the Plataforma Solar de Almeria, Spain. The aerosol optical depth at 440, 500 and 675nm is calculated. The results are compared with collocated aerosol optical measurements and the mean/median difference and standard deviation are less than 0.01 and 0.03 respectively at all wavelengths.

  1. The ROSAT All-Sky Survey view of the Large Magellanic Cloud (LMC)

    Science.gov (United States)

    Pietsch, W.; Denner, K.; Kahabka, P.; Pakull, M.; Schaeidt, S.

    1996-01-01

    During the Rosat all sky survey, centered on the Large Magellanic Cloud (LMC), 516 X-ray sources were detected. The field was covered from July 1990 to January 1991. The X-ray parameters of the sources, involving position, count rates, hardness ratios, extent, and time variability during the observations, are discussed. Identifications with objects from optical, radio and infrared wavelength allow the LMC candidates to be separated from the foreground stars and the background objects.

  2. Planck 2013 results. XI. All-sky model of thermal dust emission

    CERN Document Server

    Abergel, A; Aghanim, N; Alina, D; Alves, M I R; Armitage-Caplan, C; Arnaud, M; Ashdown, M; Atrio-Barandela, F; Aumont, J; Baccigalupi, C; Banday, A J; Barreiro, R B; Bartlett, J G; Battaner, E; Benabed, K; Benoît, A; Benoit-Lévy, A; Bernard, J -P; Bersanelli, M; Bielewicz, P; Bobin, J; Bock, J J; Bonaldi, A; Bond, J R; Borrill, J; Bouchet, F R; Boulanger, F; Bridges, M; Bucher, M; Burigana, C; Butler, R C; Cardoso, J -F; Catalano, A; Chamballu, A; Chary, R -R; Chiang, H C; Chiang, L -Y; Christensen, P R; Church, S; Clemens, M; Clements, D L; Colombi, S; Colombo, L P L; Combet, C; Couchot, F; Coulais, A; Crill, B P; Curto, A; Cuttaia, F; Danese, L; Davies, R D; Davis, R J; de Bernardis, P; de Rosa, A; de Zotti, G; Delabrouille, J; Delouis, J -M; Désert, F -X; Dickinson, C; Diego, J M; Dole, H; Donzelli, S; Doré, O; Douspis, M; Dupac, X; Efstathiou, G; Enßlin, T A; Eriksen, H K; Falgarone, E; Finelli, F; Forni, O; Frailis, M; Fraisse, A A; Franceschi, E; Galeotta, S; Ganga, K; Ghosh, T; Giard, M; Giardino, G; Giraud-Héraud, Y; González-Nuevo, J; Górski, K M; Gratton, S; Gregorio, A; Grenier, I A; Gruppuso, A; Guillet, V; Hansen, F K; Hanson, D; Harrison, D; Helou, G; Henrot-Versillé, S; Hernández-Monteagudo, C; Herranz, D; Hildebrandt, S R; Hivon, E; Hobson, M; Holmes, W A; Hornstrup, A; Hovest, W; Huffenberger, K M; Jaffe, A H; Jaffe, T R; Jewell, J; Joncas, G; Jones, W C; Juvela, M; Keihänen, E; Keskitalo, R; Kisner, T S; Knoche, J; Knox, L; Kunz, M; Kurki-Suonio, H; Lagache, G; Lähteenmäki, A; Lamarre, J -M; Lasenby, A; Laureijs, R J; Lawrence, C R; Leonardi, R; León-Tavares, J; Lesgourgues, J; Levrier, F; Liguori, M; Lilje, P B; Linden-Vørnle, M; López-Caniego, M; Lubin, P M; Macías-Pérez, J F; Maffei, B; Maino, D; Mandolesi, N; Maris, M; Marshall, D J; Martin, P G; Martínez-González, E; Masi, S; Massardi, M; Matarrese, S; Matthai, F; Mazzotta, P; McGehee, P; Melchiorri, A; Mendes, L; Mennella, A; Migliaccio, M; Mitra, S; Miville-Deschênes, M -A; Moneti, A; Montier, L; Morgante, G; Mortlock, D; Munshi, D; Murphy, J A; Naselsky, P; Nati, F; Natoli, P; Netterfield, C B; Nørgaard-Nielsen, H U; Noviello, F; Novikov, D; Novikov, I; Osborne, S; Oxborrow, C A; Paci, F; Pagano, L; Pajot, F; Paladini, R; Paoletti, D; Pasian, F; Patanchon, G; Perdereau, O; Perotto, L; Perrotta, F; Piacentini, F; Piat, M; Pierpaoli, E; Pietrobon, D; Plaszczynski, S; Pointecouteau, E; Polenta, G; Ponthieu, N; Popa, L; Poutanen, T; Pratt, G W; Prézeau, G; Prunet, S; Puget, J -L; Rachen, J P; Reach, W T; Rebolo, R; Reinecke, M; Remazeilles, M; Renault, C; Ricciardi, S; Riller, T; Ristorcelli, I; Rocha, G; Rosset, C; Roudier, G; Rowan-Robinson, M; Rubiño-Martín, J A; Rusholme, B; Sandri, M; Santos, D; Savini, G; Scott, D; Seiffert, M D; Shellard, E P S; Spencer, L D; Starck, J -L; Stolyarov, V; Stompor, R; Sudiwala, R; Sunyaev, R; Sureau, F; Sutton, D; Suur-Uski, A -S; Sygnet, J -F; Tauber, J A; Tavagnacco, D; Terenzi, L; Toffolatti, L; Tomasi, M; Tristram, M; Tucci, M; Tuovinen, J; Türler, M; Umana, G; Valenziano, L; Valiviita, J; Van Tent, B; Vielva, P; Villa, F; Vittorio, N; Wade, L A; Wandelt, B D; Welikala, N; Yvon, D; Zacchei, A; Zonca, A

    2014-01-01

    This paper presents an all-sky model of dust emission from the Planck 857, 545 and 353 GHz, and IRAS 100 micron data. Using a modified black-body fit to the data we present all-sky maps of the dust optical depth, temperature, and spectral index over the 353-3000 GHz range. This model is a tight representation of the data at 5 arcmin. It shows variations of the order of 30 % compared with the widely-used model of Finkbeiner, Davis, and Schlegel. The Planck data allow us to estimate the dust temperature uniformly over the whole sky, providing an improved estimate of the dust optical depth compared to previous all-sky dust model, especially in high-contrast molecular regions. An increase of the dust opacity at 353 GHz, tau_353/N_H, from the diffuse to the denser interstellar medium (ISM) is reported. It is associated with a decrease in the observed dust temperature, T_obs, that could be due at least in part to the increased dust opacity. We also report an excess of dust emission at HI column densities lower than...

  3. Alaskan Auroral All-Sky Images on the World Wide Web

    Science.gov (United States)

    Stenbaek-Nielsen, H. C.

    1997-01-01

    In response to a 1995 NASA SPDS announcement of support for preservation and distribution of important data sets online, the Geophysical Institute, University of Alaska Fairbanks, Alaska, proposed to provide World Wide Web access to the Poker Flat Auroral All-sky Camera images in real time. The Poker auroral all-sky camera is located in the Davis Science Operation Center at Poker Flat Rocket Range about 30 miles north-east of Fairbanks, Alaska, and is connected, through a microwave link, with the Geophysical Institute where we maintain the data base linked to the Web. To protect the low light-level all-sky TV camera from damage due to excessive light, we only operate during the winter season when the moon is down. The camera and data acquisition is now fully computer controlled. Digital images are transmitted each minute to the Web linked data base where the data are available in a number of different presentations: (1) Individual JPEG compressed images (1 minute resolution); (2) Time lapse MPEG movie of the stored images; and (3) A meridional plot of the entire night activity.

  4. WATCHDOG: A COMPREHENSIVE ALL-SKY DATABASE OF GALACTIC BLACK HOLE X-RAY BINARIES

    International Nuclear Information System (INIS)

    Tetarenko, B. E.; Sivakoff, G. R.; Heinke, C. O.; Gladstone, J. C.

    2016-01-01

    With the advent of more sensitive all-sky instruments, the transient universe is being probed in greater depth than ever before. Taking advantage of available resources, we have established a comprehensive database of black hole (and black hole candidate) X-ray binary (BHXB) activity between 1996 and 2015 as revealed by all-sky instruments, scanning surveys, and select narrow-field X-ray instruments on board the INTErnational Gamma-Ray Astrophysics Laboratory, Monitor of All-Sky X-ray Image, Rossi X-ray Timing Explorer, and Swift telescopes; the Whole-sky Alberta Time-resolved Comprehensive black-Hole Database Of the Galaxy or WATCHDOG. Over the past two decades, we have detected 132 transient outbursts, tracked and classified behavior occurring in 47 transient and 10 persistently accreting BHs, and performed a statistical study on a number of outburst properties across the Galactic population. We find that outbursts undergone by BHXBs that do not reach the thermally dominant accretion state make up a substantial fraction (∼40%) of the Galactic transient BHXB outburst sample over the past ∼20 years. Our findings suggest that this “hard-only” behavior, observed in transient and persistently accreting BHXBs, is neither a rare nor recent phenomenon and may be indicative of an underlying physical process, relatively common among binary BHs, involving the mass-transfer rate onto the BH remaining at a low level rather than increasing as the outburst evolves. We discuss how the larger number of these “hard-only” outbursts and detected outbursts in general have significant implications for both the luminosity function and mass-transfer history of the Galactic BHXB population

  5. Planck early results. XXIII. The first all-sky survey of Galactic cold clumps

    DEFF Research Database (Denmark)

    Poutanen, T.; Natoli, P.; Polenta, G.

    2011-01-01

    We present the statistical properties of the Cold Clump Catalogue of Planck Objects (C3PO), the first all-sky catalogue of cold objects, in terms of their spatial distribution, dust temperature, distance, mass, and morphology. We have combined Planck and IRAS data to extract 10342 cold sources...... dark clouds where the latter have been catalogued. These cold clumps are not isolated but clustered in groups. Dust temperature and emissivity spectral index values are derived from their spectral energy distributions using both Planck and IRAS data. The temperatures range from 7K to 19K...

  6. First all-sky search for continuous gravitational waves from unknown sources in binary systems

    OpenAIRE

    Aasi, J.; Abbott, B.; Abbott, R.; Abbott, T.; Abernathy, M.; Accadia, T.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R.; Affeldt, C.; Agathos, M.; Aggarwal, N.

    2014-01-01

    We present the first results of an all-sky search for continuous gravitational waves from unknown spinning neutron stars in binary systems using LIGO and Virgo data. Using a specially developed analysis program, the TwoSpect algorithm, the search was carried out on data from the sixth LIGO Science Run and the second and third Virgo Science Runs. The search covers a range of frequencies from 20 Hz to 520 Hz, a range of orbital periods from 2 to ~2,254 h and a frequency- and period-dependent ra...

  7. RXTE All-Sky Monitor Localization of SGR 1627-41

    OpenAIRE

    Smith, Donald A.; Bradt, Hale V.; Levine, Alan M.

    1999-01-01

    The fourth unambiguously identified Soft Gamma Repeater (SGR), SGR1627-41, was discovered with the BATSE instrument on 1998 June 15 (Kouveliotou et al. 1998). Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6 deg segment of a narrow (19") annulus (Hurley et al. 1999; Woods et al. 1998). We present two bursts from this source observed by the All-Sky Monitor (ASM) on RXTE. We use the ASM data to further constrain the source location to a 5'...

  8. Equatorial All Sky Imager Images from the Seychelles during the March 17th, 2015 geomagnetic storm.

    Science.gov (United States)

    Curtis, B.

    2015-12-01

    An all sky imager was installed in the Seychelles earlier this year. The Seychelles islands are located northeast of Madagascar and east of Somalia in the equatorial Indian Ocean. The all sky imager is located on the island of Mahe (4.6667°S, 55.4667°E geographic), (10.55°S, 127.07°E geomagnetic), with filters of 557.7, 620.0, 630.0, 765.0 and 777.4 nm. Images with a 90 second exposure from Seychelles in 777.4nm and 630.0nm from the night before and night of the March 17th geomagnetic storm are discussed in comparison to solar wind measurements at ACE and the disturbance storm time (Dst) index. These images show line-of-sight intensities of photons received dependent on each filters wavelength. A time series of these images sometimes will show the movement of relatively dark areas, or depletions, in each emission. The depletion regions are known to cause scintillation in GPS signals. The direction and speed of movement of these depletions are related to changes observed in the solar wind.

  9. First observations from a CCD all-sky spectrograph at Barentsburg (Spitsbergen

    Directory of Open Access Journals (Sweden)

    S. A. Chernouss

    2008-05-01

    Full Text Available A digital CCD all-sky spectrograph was made by the Polar Geophysical Institute (PGI to support IPY activity in auroral research. The device was tested at the Barentsburg observatory of PGI during the winter season of 2005–2006. The spectrograph is based on a cooled CCD and a transmission grating. The main features of this spectrograph are: a wide field of view (~180°, a wide spectral range (380–740 nm, a spectral resolution of 0.6 nm, a background level of about 100 R at 1-min exposure time. Several thousand spectra of nightglow and aurora were recorded during the observation season. It was possible to register both the strong auroral emissions, as well as weak ones. Spectra of aurora, including nitrogen and oxygen molecular and atomic emissions, as well as OH emissions of the nightglow are shown. A comparison has been conducted of auroral spectra obtained by the film all-sky spectral camera C-180-S at Spitsbergen during IGY, with spectra obtained at Barentsburg during the last winter season. The relationship between the red (630.0 nm and green (557.7 nm auroral emissions shows that the green emission is dominant near the minimum of the solar cycle activity (2005–2006. The opposite situation is observed during 1958–1959, with a maximum solar cycle activity.

  10. Imaging and mapping the impact of clouds on skyglow with all-sky photometry.

    Science.gov (United States)

    Jechow, Andreas; Kolláth, Zoltán; Ribas, Salvador J; Spoelstra, Henk; Hölker, Franz; Kyba, Christopher C M

    2017-07-27

    Artificial skyglow is constantly growing on a global scale, with potential ecological consequences ranging up to affecting biodiversity. To understand these consequences, worldwide mapping of skyglow for all weather conditions is urgently required. In particular, the amplification of skyglow by clouds needs to be studied, as clouds can extend the reach of skyglow into remote areas not affected by light pollution on clear nights. Here we use commercial digital single lens reflex cameras with fisheye lenses for all-sky photometry. We track the reach of skyglow from a peri-urban into a remote area on a clear and a partly cloudy night by performing transects from the Spanish town of Balaguer towards Montsec Astronomical Park. From one single all-sky image, we extract zenith luminance, horizontal and scalar illuminance. While zenith luminance reaches near-natural levels at 5 km distance from the town on the clear night, similar levels are only reached at 27 km on the partly cloudy night. Our results show the dramatic increase of the reach of skyglow even for moderate cloud coverage at this site. The powerful and easy-to-use method promises to be widely applicable for studies of ecological light pollution on a global scale also by non-specialists in photometry.

  11. Observation of the Coma cluster of galaxies with ROSAT during the all-sky survey

    Science.gov (United States)

    Briel, U. G.; Henry, J. P.; Boehringer, H.

    1992-01-01

    The Coma cluster of galaxies was observed with the position sensitive proportional counter (PSPC) during the ROSAT all sky survey. We find evidence for substructure in this cluster. Diffuse X-ray emission is detected from the regions of the NGC 4839 and 4911 subgroups at 6 percent and 1 percent of the total cluster emission respectively. There may be emission associated with the NGC 4874 and 4889 subgroups as well. The NGC 4839 group appears to be in the process of merging with the cluster. These X-ray data show that at least some of the groups previously found in projection are in fact physical objects possessing potential wells deep enough to trap their own X-ray gas. Because of the unlimited field of view of the all sky survey and the low background of the PSPC, we were able to measure the azimuthally averaged surface brightness of Coma out to approximately 100 arcmin, twice as far as was previously possible. Given the validity of our mass models, these new X-ray data imply that within 5/h(50) Mpc the binding mass of the Coma cluster is 1.8 +/- 0.6 x 10 exp 15/h(50) solar mass, and the fraction of cluster mass contained in hot gas is 0.30 +/- 0.14h(50) exp -3/2. Furthermore, the binding mass is more centrally concentrated than is the X-ray gas.

  12. All-sky analysis of the general relativistic galaxy power spectrum

    Science.gov (United States)

    Yoo, Jaiyul; Desjacques, Vincent

    2013-07-01

    We perform an all-sky analysis of the general relativistic galaxy power spectrum using the well-developed spherical Fourier decomposition. Spherical Fourier analysis expresses the observed galaxy fluctuation in terms of the spherical harmonics and spherical Bessel functions that are angular and radial eigenfunctions of the Helmholtz equation, providing a natural orthogonal basis for all-sky analysis of the large-scale mode measurements. Accounting for all the relativistic effects in galaxy clustering, we compute the spherical power spectrum and its covariance matrix and compare it to the standard three-dimensional power spectrum to establish a connection. The spherical power spectrum recovers the three-dimensional power spectrum at each wave number k with its angular dependence μk encoded in angular multipole l, and the contributions of the line-of-sight projection to galaxy clustering such as the gravitational lensing effect can be readily accommodated in the spherical Fourier analysis. A complete list of formulas for computing the relativistic spherical galaxy power spectrum is also presented.

  13. SPHEREx: Probing the Physics of Inflation with an All-Sky Spectroscopic Galaxy Survey

    Science.gov (United States)

    Dore, Olivier; SPHEREx Science Team

    2018-01-01

    SPHEREx, a mission in NASA's Medium Explorer (MIDEX) program that was selected for Phase A in August 2017, is an all-sky survey satellite designed to address all three science goals in NASA’s astrophysics division: probe the origin and destiny of our Universe; explore whether planets around other stars could harbor life; and explore the origin and evolution of galaxies. These themes are addressed by a single survey, with a single instrument.In this poster, we describe how SPHEREx can probe the physics of inflationary non-Gaussianity by measuring large-scale structure with galaxy redshifts over a large cosmological volume at low redshifts, complementing high-redshift surveys optimized to constrain dark energy.SPHEREx will be the first all-sky near-infrared spectral survey, creating a legacy archive of spectra. In particular, it will measure the redshifts of over 500 million galaxies of all types, an unprecedented dataset. Using this catalog, SPHEREx will reduce the uncertainty in fNL -- a parameter describing the inflationary initial conditions -- by a factor of more than 10 compared with CMB measurements. At the same time, this catalog will enable strong scientific synergies with Euclid, WFIRST and LSST

  14. SCANDI – an all-sky Doppler imager for studies of thermospheric spatial structure

    Directory of Open Access Journals (Sweden)

    A. L. Aruliah

    2010-02-01

    Full Text Available A new all-sky Fabry-Perot Interferometer called the Scanning Doppler Imager (SCANDI was built and installed at Longyearbyen in December 2006. Observations have been made of the Doppler shifts and Doppler broadening of the 630 nm airglow and aurora, from which upper thermospheric winds and temperatures are calculated. SCANDI allows measurements over a field-of-view (FOV with a horizontal radius of nearly 600 km for observations at an altitude of 250 km using a time resolution of 8 min. The instrument provides the ability to observe thermospheric spatial structure within a FOV which overlaps that of the EISCAT Svalbard radar and CUTLASS SuperDARN radars. Coordinating with these instruments provides an important opportunity for studying ion-neutral coupling. The all-sky image is divided into several sectors to provide a horizontal spatial resolution of between 100–300 km. This is a powerful extension in observational capability but requires careful calibration and data analysis, as described here. Two observation modes were used: a fixed and a scanning etalon gap. SCANDI results are corroborated using the Longyearbyen single look direction FPI, and ESR measurements of the ion temperatures. The data show thermospheric temperature gradients of a few Kelvins per kilometre, and a great deal of meso-scale variability on spatial scales of several tens of kilometres.

  15. Improved analysis of all-sky meteor radar measurements of gravity wave variances and momentum fluxes

    Directory of Open Access Journals (Sweden)

    V. F. Andrioli

    2013-05-01

    Full Text Available The advantages of using a composite day analysis for all-sky interferometric meteor radars when measuring mean winds and tides are widely known. On the other hand, problems arise if this technique is applied to Hocking's (2005 gravity wave analysis for all-sky meteor radars. In this paper we describe how a simple change in the procedure makes it possible to use a composite day in Hocking's analysis. Also, we explain how a modified composite day can be constructed to test its ability to measure gravity wave momentum fluxes. Test results for specified mean, tidal, and gravity wave fields, including tidal amplitudes and gravity wave momentum fluxes varying strongly with altitude and/or time, suggest that the modified composite day allows characterization of monthly mean profiles of the gravity wave momentum fluxes, with good accuracy at least at the altitudes where the meteor counts are large (from 89 to 92.5 km. In the present work we also show that the variances measured with Hocking's method are often contaminated by the tidal fields and suggest a method of empirical correction derived from a simple simulation model. The results presented here greatly increase our confidence because they show that our technique is able to remove the tide-induced false variances from Hocking's analysis.

  16. GASS: THE PARKES GALACTIC ALL-SKY SURVEY. I. SURVEY DESCRIPTION, GOALS, AND INITIAL DATA RELEASE

    International Nuclear Information System (INIS)

    McClure-Griffiths, N. M.; Calabretta, M. R.; Ford, H. Alyson; Newton-McGee, K.

    2009-01-01

    The Parkes Galactic All-Sky Survey (GASS) is a survey of Galactic atomic hydrogen (H I) emission in the Southern sky covering declinations δ ≤ 1 0 using the Parkes Radio Telescope. The survey covers 2π steradians with an effective angular resolution of ∼16', at a velocity resolution of 1.0 km s -1 , and with an rms brightness temperature noise of 57 mK. GASS is the most sensitive, highest angular resolution survey of Galactic H I emission ever made in the Southern sky. In this paper, we outline the survey goals, describe the observations and data analysis, and present the first-stage data release. The data product is a single cube at full resolution, not corrected for stray radiation. Spectra from the survey and other data products are publicly available online.

  17. MOXE: An X-ray all-sky monitor for Soviet Spectrum-X-Gamma Mission

    Science.gov (United States)

    Priedhorsky, W.; Fenimore, E. E.; Moss, C. E.; Kelley, R. L.; Holt, S. S.

    1989-01-01

    A Monitoring Monitoring X-Ray Equipment (MOXE) is being developed for the Soviet Spectrum-X-Gamma Mission. MOXE is an X-ray all-sky monitor based on array of pinhole cameras, to be provided via a collaboration between Goddard Space Flight Center and Los Alamos National Laboratory. The objectives are to alert other observers on Spectrum-X-Gamma and other platforms of interesting transient activity, and to synoptically monitor the X-ray sky and study long-term changes in X-ray binaries. MOXE will be sensitive to sources as faint as 2 milliCrab (5 sigma) in 1 day, and cover the 2 to 20 KeV band.

  18. Noctilucent cloud particle size determination based on multi-wavelength all-sky analysis

    Science.gov (United States)

    Ugolnikov, Oleg S.; Galkin, Alexey A.; Pilgaev, Sergey V.; Roldugin, Alexey V.

    2017-10-01

    The article deals with the analysis of color distribution in noctilucent clouds (NLC) in the sky based on multi-wavelength (RGB) CCD-photometry provided with the all-sky camera in Lovozero in the north of Russia (68.0°N, 35.1°E) during the bright expanded NLC performance in the night of August 12, 2016. Small changes in the NLC color across the sky are interpreted as the atmospheric absorption and extinction effects combined with the difference in the Mie scattering functions of NLC particles for the three color channels of the camera. The method described in this paper is used to find the effective monodisperse radius of particles about 55 nm. The result of these simple and cost-effective measurements is in good agreement with previous estimations of comparable accuracy. Non-spherical particles, Gaussian and lognormal distribution of the particle size are also considered.

  19. RXTE All-Sky Monitor Localization of SGR 1627-41

    Science.gov (United States)

    Smith, D. A.; Bradt, H. V.; Levine, A. M.

    1999-09-01

    The fourth unambiguously identified Soft Gamma Repeater (SGR), SGR 1627--41, was discovered with the BATSE instrument on 1998 June 15 (Kouveliotou et al. 1998). Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6(deg) segment of a narrow (19('') ) annulus (Hurley et al. 1999; Woods et al. 1998). We report on two bursts from this source observed by the All-Sky Monitor (ASM) on RXTE. We use the ASM data to further constrain the source location to a 5(') long segment of the BATSE/IPN error box. The ASM/IPN error box lies within 0.3(') of the supernova remnant (SNR) G337.0--0.1. The probability that a SNR would fall so close to the error box purely by chance is ~ 5%.

  20. Rossi X-Ray Timing Explorer All-Sky Monitor Localization of SGR 1627-41

    Science.gov (United States)

    Smith, Donald A.; Bradt, Hale V.; Levine, Alan M.

    1999-07-01

    The fourth unambiguously identified soft gamma repeater (SGR), SGR 1627-41, was discovered with the BATSE instrument on 1998 June 15. Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6° segment of a narrow (19") annulus. We present two bursts from this source observed by the All-Sky Monitor (ASM) on the Rossi X-Ray Timing Explorer. We use the ASM data to further constrain the source location to a 5' long segment of the BATSE/IPN error box. The ASM/IPN error box lies within 0.3 arcmin of the supernova remnant G337.0-0.1. The probability that a supernova remnant would fall so close to the error box purely by chance is ~5%.

  1. Meteor Shower Forecast Improvements from a Survey of All-Sky Network Observations

    Science.gov (United States)

    Moorhead, Althea V.; Sugar, Glenn; Brown, Peter G.; Cooke, William J.

    2015-01-01

    Meteoroid impacts are capable of damaging spacecraft and potentially ending missions. In order to help spacecraft programs mitigate these risks, NASA's Meteoroid Environment Office (MEO) monitors and predicts meteoroid activity. Temporal variations in near-Earth space are described by the MEO's annual meteor shower forecast, which is based on both past shower activity and model predictions. The MEO and the University of Western Ontario operate sister networks of all-sky meteor cameras. These networks have been in operation for more than 7 years and have computed more than 20,000 meteor orbits. Using these data, we conduct a survey of meteor shower activity in the "fireball" size regime using DBSCAN. For each shower detected in our survey, we compute the date of peak activity and characterize the growth and decay of the shower's activity before and after the peak. These parameters are then incorporated into the annual forecast for an improved treatment of annual activity.

  2. Predicting Downward Longwave Radiation for Various Land Use in All-Sky Condition: Northeast Florida

    Directory of Open Access Journals (Sweden)

    Chi-Han Cheng

    2014-01-01

    Full Text Available Accurate estimate of the surface longwave radiation is important for the surface radiation budget, which in turn controls evaporation and sensible heat fluxes. Regional land use changes can impact local weather conditions; for example, heterogeneous land use patterns and temporal changes in atmospheric circulation patterns would affect air temperature and water vapor pressure, which are more commonly used as inputs in existing models for estimating downward longwave radiation (LWd. In this study, first, we analyzed the cloud cover and land use covers impacts on LWd. Next, LWd on all-sky conditions were developed by using the existing land use-adapted model and cloud cover data from the region of Saint Johns River Water Management District (SJRWMD, FL. The results show that factors, such as, seasonal effects, cloud cover, and land use, are of importance in the estimation of LWd and they cannot be ignored when developing a model for LWd prediction. The all-sky land use-adapted model with all factors taken into account performs better than other existing models statistically. The results of the statistical analyses indicated that the BIAS, RMSE, MAE, and PMRE are −0.18 Wm−2, 10.81 Wm−2, 8.00 Wm−2, and 2.30%; −2.61 Wm−2, 14.45 Wm−2, 10.64 Wm−2, and 3.19%; −0.07 Wm−2, 10.53 Wm−2, 8.03 Wm−2, and 2.27%; and −0.62 Wm−2, 13.97 Wm−2, 9.76 Wm−2, and 2.87% for urban, rangeland, agricultural, and wetland areas, respectively.

  3. THE 22 MONTH SWIFT-BAT ALL-SKY HARD X-RAY SURVEY

    International Nuclear Information System (INIS)

    Tueller, J.; Baumgartner, W. H.; Markwardt, C. B.; Skinner, G. K.; Mushotzky, R. F.; Barthelmy, S.; Cummings, J.; Gehrels, N.; Holland, S.; Ajello, M.; Beardmore, A.; Evans, P.; Godet, O.; Brandt, W. N.; Burrows, D.; Grupe, D.; Chincarini, G.; Campana, S.; Cusumano, G.; Fenimore, E.

    2010-01-01

    We present the catalog of sources detected in the first 22 months of data from the hard X-ray survey (14-195 keV) conducted with the Burst Alert Telescope (BAT) coded mask imager on the Swift satellite. The catalog contains 461 sources detected above the 4.8σ level with BAT. High angular resolution X-ray data for every source from Swift-XRT or archival data have allowed associations to be made with known counterparts in other wavelength bands for over 97% of the detections, including the discovery of ∼30 galaxies previously unknown as active galactic nuclei and several new Galactic sources. A total of 266 of the sources are associated with Seyfert galaxies (median redshift z ∼ 0.03) or blazars, with the majority of the remaining sources associated with X-ray binaries in our Galaxy. This ongoing survey is the first uniform all-sky hard X-ray survey since HEAO-1 in 1977. Since the publication of the nine-month BAT survey we have increased the number of energy channels from four to eight and have substantially increased the number of sources with accurate average spectra. The BAT 22 month catalog is the product of the most sensitive all-sky survey in the hard X-ray band, with a detection sensitivity (4.8σ) of 2.2 x 10 -11 erg cm -2 s -1 (1 mCrab) over most of the sky in the 14-195 keV band.

  4. Dicty_cDB: VHE867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  5. Uncertainties of parameterized surface downward clear-sky shortwave and all-sky longwave radiation.

    Science.gov (United States)

    Gubler, S.; Gruber, S.; Purves, R. S.

    2012-06-01

    As many environmental models rely on simulating the energy balance at the Earth's surface based on parameterized radiative fluxes, knowledge of the inherent model uncertainties is important. In this study we evaluate one parameterization of clear-sky direct, diffuse and global shortwave downward radiation (SDR) and diverse parameterizations of clear-sky and all-sky longwave downward radiation (LDR). In a first step, SDR is estimated based on measured input variables and estimated atmospheric parameters for hourly time steps during the years 1996 to 2008. Model behaviour is validated using the high quality measurements of six Alpine Surface Radiation Budget (ASRB) stations in Switzerland covering different elevations, and measurements of the Swiss Alpine Climate Radiation Monitoring network (SACRaM) in Payerne. In a next step, twelve clear-sky LDR parameterizations are calibrated using the ASRB measurements. One of the best performing parameterizations is elected to estimate all-sky LDR, where cloud transmissivity is estimated using measured and modeled global SDR during daytime. In a last step, the performance of several interpolation methods is evaluated to determine the cloud transmissivity in the night. We show that clear-sky direct, diffuse and global SDR is adequately represented by the model when using measurements of the atmospheric parameters precipitable water and aerosol content at Payerne. If the atmospheric parameters are estimated and used as a fix value, the relative mean bias deviance (MBD) and the relative root mean squared deviance (RMSD) of the clear-sky global SDR scatter between between -2 and 5%, and 7 and 13% within the six locations. The small errors in clear-sky global SDR can be attributed to compensating effects of modeled direct and diffuse SDR since an overestimation of aerosol content in the atmosphere results in underestimating the direct, but overestimating the diffuse SDR. Calibration of LDR parameterizations to local conditions

  6. Uncertainties of parameterized surface downward clear-sky shortwave and all-sky longwave radiation.

    Directory of Open Access Journals (Sweden)

    S. Gubler

    2012-06-01

    Full Text Available As many environmental models rely on simulating the energy balance at the Earth's surface based on parameterized radiative fluxes, knowledge of the inherent model uncertainties is important. In this study we evaluate one parameterization of clear-sky direct, diffuse and global shortwave downward radiation (SDR and diverse parameterizations of clear-sky and all-sky longwave downward radiation (LDR. In a first step, SDR is estimated based on measured input variables and estimated atmospheric parameters for hourly time steps during the years 1996 to 2008. Model behaviour is validated using the high quality measurements of six Alpine Surface Radiation Budget (ASRB stations in Switzerland covering different elevations, and measurements of the Swiss Alpine Climate Radiation Monitoring network (SACRaM in Payerne. In a next step, twelve clear-sky LDR parameterizations are calibrated using the ASRB measurements. One of the best performing parameterizations is elected to estimate all-sky LDR, where cloud transmissivity is estimated using measured and modeled global SDR during daytime. In a last step, the performance of several interpolation methods is evaluated to determine the cloud transmissivity in the night.

    We show that clear-sky direct, diffuse and global SDR is adequately represented by the model when using measurements of the atmospheric parameters precipitable water and aerosol content at Payerne. If the atmospheric parameters are estimated and used as a fix value, the relative mean bias deviance (MBD and the relative root mean squared deviance (RMSD of the clear-sky global SDR scatter between between −2 and 5%, and 7 and 13% within the six locations. The small errors in clear-sky global SDR can be attributed to compensating effects of modeled direct and diffuse SDR since an overestimation of aerosol content in the atmosphere results in underestimating the direct, but overestimating the diffuse SDR. Calibration of LDR parameterizations

  7. Testing an inversion method for estimating electron energy fluxes from all-sky camera images

    Directory of Open Access Journals (Sweden)

    N. Partamies

    2004-06-01

    Full Text Available An inversion method for reconstructing the precipitating electron energy flux from a set of multi-wavelength digital all-sky camera (ASC images has recently been developed by tomografia. Preliminary tests suggested that the inversion is able to reconstruct the position and energy characteristics of the aurora with reasonable accuracy. This study carries out a thorough testing of the method and a few improvements for its emission physics equations. We compared the precipitating electron energy fluxes as estimated by the inversion method to the energy flux data recorded by the Defense Meteorological Satellite Program (DMSP satellites during four passes over auroral structures. When the aurorae appear very close to the local zenith, the fluxes inverted from the blue (427.8nm filtered ASC images or blue and green line (557.7nm images together give the best agreement with the measured flux values. The fluxes inverted from green line images alone are clearly larger than the measured ones. Closer to the horizon the quality of the inversion results from blue images deteriorate to the level of the ones from green images. In addition to the satellite data, the precipitating electron energy fluxes were estimated from the electron density measurements by the EISCAT Svalbard Radar (ESR. These energy flux values were compared to the ones of the inversion method applied to over 100 ASC images recorded at the nearby ASC station in Longyearbyen. The energy fluxes deduced from these two types of data are in general of the same order of magnitude. In 35% of all of the blue and green image inversions the relative errors were less than 50% and in 90% of the blue and green image inversions less than 100%. This kind of systematic testing of the inversion method is the first step toward using all-sky camera images in the way in which global UV images have recently been used to estimate the energy fluxes. The advantages of ASCs, compared to the space-born imagers, are

  8. The 105-Month Swift-BAT All-Sky Hard X-Ray Survey

    Science.gov (United States)

    Oh, Kyuseok; Koss, Michael; Markwardt, Craig B.; Schawinski, Kevin; Baumgartner, Wayne H.; Barthelmy, Scott D.; Cenko, S. Bradley; Gehrels, Neil; Mushotzky, Richard; Petulante, Abigail; hide

    2018-01-01

    We present a catalog of hard X-ray sources detected in the first 105 months of observations with the Burst Alert Telescope (BAT) coded-mask imager on board the Swift observatory. The 105-month Swift-BAT survey is a uniform hard X-ray all-sky survey with a sensitivity of 8.40 x 10(exp -12) erg s(exp -1) cm(exp -2) over 90% of the sky and 7.24 x 10(exp -12) erg s(exp -1) cm(exp -2) over 50% of the sky in the 14-195 keV band. The Swift-BAT 105-month catalog provides 1632 (422 new detections) hard X-ray sources in the 14-195 keV band above the 4.8 sigma significance level. Adding to the previously known hard X-ray sources, 34% (144/422) of the new detections are identified as Seyfert active galactic nuclei (AGNs) in nearby galaxies (z < 0.2). The majority of the remaining identified sources are X-ray binaries (7%, 31) and blazars/BL Lac objects (10%, 43). As part of this new edition of the Swift-BAT catalog, we release eight-channel spectra and monthly sampled light curves for each object in the online journal and at the Swift-BAT 105-month website.

  9. THE 70 MONTH SWIFT-BAT ALL-SKY HARD X-RAY SURVEY

    International Nuclear Information System (INIS)

    Baumgartner, W. H.; Tueller, J.; Markwardt, C. B.; Skinner, G. K.; Barthelmy, S.; Gehrels, N.; Mushotzky, R. F.; Evans, P. A.

    2013-01-01

    We present the catalog of sources detected in 70 months of observations with the Burst Alert Telescope (BAT) hard X-ray detector on the Swift gamma-ray burst observatory. The Swift-BAT 70 month survey has detected 1171 hard X-ray sources (more than twice as many sources as the previous 22 month survey) in the 14-195 keV band down to a significance level of 4.8σ, associated with 1210 counterparts. The 70 month Swift-BAT survey is the most sensitive and uniform hard X-ray all-sky survey and reaches a flux level of 1.03 × 10 –11 erg s –1 cm –2 over 50% of the sky and 1.34 × 10 –11 erg s –1 cm –2 over 90% of the sky. The majority of new sources in the 70 month survey continue to be active galactic nuclei, with over 700 in the catalog. As part of this new edition of the Swift-BAT catalog, we also make available eight-channel spectra and monthly sampled light curves for each object detected in the survey in the online journal and at the Swift-BAT 70 month Web site

  10. Multifrequency observations of KAZ 102 during the ROSAT all-sky survey

    Science.gov (United States)

    Treves, A.; Fink, H. H.; Malkan, M.; Wilkes, B. J.; Baganoff, F.; Heidt, J.; Pian, E.; Sadun, A.; Schaeidt, S.; Bonnell, J. T.

    1995-01-01

    The bright quasar Kaz 102, which lies in the vicinity of the North Ecliptic Pole, was monitored during the ROSAT All Sky Survey for 121.5 days from 1990 July 30 to 1991 January 25. In the course of the survey, optical photometry with various filters was peformed at several epochs, together with UV (IUE) and optical spectrophotometry. The spectral energy distribution in the 3 x 10(exp 14) -3 x 10(exp 17) Hz range is obtained simultaneously among the various frequencies to less than or = 1 day. No clear case of variability can be made in the X-rays, while in the optical and UV variability of 10%-20% is apparent. An analysis of IUE and Einstein archives indicates a doubling timescale of years for the UV and soft X-ray flux. The X-ray photon index, which in 1979 was rather flat (Gamma = 0.8(+0.6 -0.4), in 1990/1991 was found to be Gamma = 2.22 +/- 0.13, a typical value for radio-quiet quasars in this energy range. The overall energy distribution and the variability are discussed.

  11. THE 70 MONTH SWIFT-BAT ALL-SKY HARD X-RAY SURVEY

    Energy Technology Data Exchange (ETDEWEB)

    Baumgartner, W. H.; Tueller, J.; Markwardt, C. B.; Skinner, G. K.; Barthelmy, S.; Gehrels, N. [NASA/Goddard Space Flight Center, Astrophysics Science Division, Greenbelt, MD 20771 (United States); Mushotzky, R. F. [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Evans, P. A., E-mail: whbaumga@alum.mit.edu [X-Ray and Observational Astronomy Group/Department of Physics and Astronomy, University of Leicester, Leicester, LE1 7RH (United Kingdom)

    2013-08-15

    We present the catalog of sources detected in 70 months of observations with the Burst Alert Telescope (BAT) hard X-ray detector on the Swift gamma-ray burst observatory. The Swift-BAT 70 month survey has detected 1171 hard X-ray sources (more than twice as many sources as the previous 22 month survey) in the 14-195 keV band down to a significance level of 4.8{sigma}, associated with 1210 counterparts. The 70 month Swift-BAT survey is the most sensitive and uniform hard X-ray all-sky survey and reaches a flux level of 1.03 Multiplication-Sign 10{sup -11} erg s{sup -1} cm{sup -2} over 50% of the sky and 1.34 Multiplication-Sign 10{sup -11} erg s{sup -1} cm{sup -2} over 90% of the sky. The majority of new sources in the 70 month survey continue to be active galactic nuclei, with over 700 in the catalog. As part of this new edition of the Swift-BAT catalog, we also make available eight-channel spectra and monthly sampled light curves for each object detected in the survey in the online journal and at the Swift-BAT 70 month Web site.

  12. H I Clouds in the Lower Halo. I. The Galactic All-Sky Survey Pilot Region

    International Nuclear Information System (INIS)

    Ford, H. Alyson; McClure-Griffiths, N. M.; Calabretta, M. R.; Lockman, Felix J.; Pisano, D. J.; Bailin, J.; Kalberla, P. M. W.; Murphy, T.

    2008-01-01

    We have detected over 400 H I clouds in the lower halo of the Galaxy within the pilot region of the Galactic All-Sky Survey (GASS), a region of the fourth quadrant that spans 18 deg. in longitude, 40 deg. in latitude, and is centered on the Galactic equator. These clouds have a median peak brightness temperature of 0.6 K, a median velocity width of 12.8 km s -1 , and angular sizes ∼ -1 . A sample of clouds likely to be near tangent points was analyzed in detail. These clouds have radii on the order of 30 pc and a median H I mass of 630 M sun . The population has a vertical scale height of 400 pc and is concentrated in Galactocentric radius, peaking at R = 3.8 kpc. This confined structure suggests that the clouds are linked to spiral features, while morphological evidence that many clouds are aligned with loops and filaments is suggestive of a relationship with star formation. The clouds might result from supernovae and stellar winds in the form of fragmenting shells and gas that has been pushed into the halo rather than from a galactic fountain.

  13. Long term variability of Cygnus X-1. V. State definitions with all sky monitors

    Science.gov (United States)

    Grinberg, V.; Hell, N.; Pottschmidt, K.; Böck, M.; Nowak, M. A.; Rodriguez, J.; Bodaghee, A.; Cadolle Bel, M.; Case, G. L.; Hanke, M.; Kühnel, M.; Markoff, S. B.; Pooley, G. G.; Rothschild, R. E.; Tomsick, J. A.; Wilson-Hodge, C. A.; Wilms, J.

    2013-06-01

    We present a scheme for determining the spectral state of the canonical black hole Cyg X-1 using data from previous and current X-ray all sky monitors (RXTE-ASM, Swift-BAT, MAXI, and Fermi-GBM). Determinations of the hard/intermediate and soft state agree to better than 10% between different monitors, facilitating the determination of the state and its context for any observation of the source, potentially over the lifetimes of different individual monitors. A separation of the hard and the intermediate states, which strongly differ in their spectral shape and short-term timing behavior, is only possible when data in the soft X-rays (probability of Cyg X-1 remaining in a given state for at least one week to be larger than 85% in the hard state and larger than 75% in the soft state. Intermediate states are short lived, with a 50% probability that the source leaves the intermediate state within three days. Reliable detection of these potentially short-lived events is only possible with monitor data that have a time resolution better than 1 d.

  14. All-sky-imaging capabilities for ionospheric space weather research using geomagnetic conjugate point observing sites

    Science.gov (United States)

    Martinis, C.; Baumgardner, J.; Wroten, J.; Mendillo, M.

    2018-04-01

    Optical signatures of ionospheric disturbances exist at all latitudes on Earth-the most well known case being visible aurora at high latitudes. Sub-visual emissions occur equatorward of the auroral zones that also indicate periods and locations of severe Space Weather effects. These fall into three magnetic latitude domains in each hemisphere: (1) sub-auroral latitudes ∼40-60°, (2) mid-latitudes (20-40°) and (3) equatorial-to-low latitudes (0-20°). Boston University has established a network of all-sky-imagers (ASIs) with sites at opposite ends of the same geomagnetic field lines in each hemisphere-called geomagnetic conjugate points. Our ASIs are autonomous instruments that operate in mini-observatories situated at four conjugate pairs in North and South America, plus one pair linking Europe and South Africa. In this paper, we describe instrument design, data-taking protocols, data transfer and archiving issues, image processing, science objectives and early results for each latitude domain. This unique capability addresses how a single source of disturbance is transformed into similar or different effects based on the unique "receptor" conditions (seasonal effects) found in each hemisphere. Applying optical conjugate point observations to Space Weather problems offers a new diagnostic approach for understanding the global system response functions operating in the Earth's upper atmosphere.

  15. Planck 2013 results. XXI. All-sky Compton parameter power spectrum and high-order statistics

    CERN Document Server

    Ade, P.A.R.; Armitage-Caplan, C.; Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.; Aumont, J.; Baccigalupi, C.; Banday, A.J.; Barreiro, R.B.; Bartlett, J.G.; Battaner, E.; Benabed, K.; Benoit, A.; Benoit-Levy, A.; Bernard, J.P.; Bersanelli, M.; Bielewicz, P.; Bobin, J.; Bock, J.J.; Bonaldi, A.; Bond, J.R.; Borrill, J.; Bouchet, F.R.; Bridges, M.; Bucher, M.; Burigana, C.; Butler, R.C.; Cardoso, J.F.; Carvalho, P.; Catalano, A.; Challinor, A.; Chamballu, A.; Chiang, L.Y.; Chiang, H.C.; Christensen, P.R.; Church, S.; Clements, D.L.; Colombi, S.; Colombo, L.P.L.; Comis, B.; Couchot, F.; Coulais, A.; Crill, B.P.; Curto, A.; Cuttaia, F.; Da Silva, A.; Danese, L.; Davies, R.D.; Davis, R.J.; de Bernardis, P.; de Rosa, A.; de Zotti, G.; Delabrouille, J.; Delouis, J.M.; Desert, F.X.; Dickinson, C.; Diego, J.M.; Dolag, K.; Dole, H.; Donzelli, S.; Dore, O.; Douspis, M.; Dupac, X.; Efstathiou, G.; Ensslin, T.A.; Eriksen, H.K.; Finelli, F.; Flores-Cacho, I.; Forni, O.; Frailis, M.; Franceschi, E.; Galeotta, S.; Ganga, K.; Genova-Santos, R.T.; Giard, M.; Giardino, G.; Giraud-Heraud, Y.; Gonzalez-Nuevo, J.; Gorski, K.M.; Gratton, S.; Gregorio, A.; Gruppuso, A.; Hansen, F.K.; Hanson, D.; Harrison, D.; Henrot-Versille, S.; Hernandez-Monteagudo, C.; Herranz, D.; Hildebrandt, S.R.; Hivon, E.; Hobson, M.; Holmes, W.A.; Hornstrup, A.; Hovest, W.; Huffenberger, K.M.; Hurier, G.; Jaffe, T.R.; Jaffe, A.H.; Jones, W.C.; Juvela, M.; Keihanen, E.; Keskitalo, R.; Kisner, T.S.; Kneissl, R.; Knoche, J.; Knox, L.; Kunz, M.; Kurki-Suonio, H.; Lacasa, F.; Lagache, G.; Lahteenmaki, A.; Lamarre, J.M.; Lasenby, A.; Laureijs, R.J.; Lawrence, C.R.; Leahy, J.P.; Leonardi, R.; Leon-Tavares, J.; Lesgourgues, J.; Liguori, M.; Lilje, P.B.; Linden-Vornle, M.; Lopez-Caniego, M.; Lubin, P.M.; Macias-Perez, J.F.; Maffei, B.; Maino, D.; Mandolesi, N.; Marcos-Caballero, A.; Maris, M.; Marshall, D.J.; Martin, P.G.; Martinez-Gonzalez, E.; Masi, S.; Matarrese, S.; Matthai, F.; Mazzotta, P.; Melchiorri, A.; Melin, J.B.; Mendes, L.; Mennella, A.; Migliaccio, M.; Mitra, S.; Miville-Deschenes, M.A.; Moneti, A.; Montier, L.; Morgante, G.; Mortlock, D.; Moss, A.; Munshi, D.; Naselsky, P.; Nati, F.; Natoli, P.; Netterfield, C.B.; Norgaard-Nielsen, H.U.; Noviello, F.; Novikov, D.; Novikov, I.; Osborne, S.; Oxborrow, C.A.; Paci, F.; Pagano, L.; Pajot, F.; Paoletti, D.; Partridge, B.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Pietrobon, D.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Poutanen, T.; Pratt, G.W.; Prezeau, G.; Prunet, S.; Puget, J.L.; Rachen, J.P.; Rebolo, R.; Reinecke, M.; Remazeilles, M.; Renault, C.; Ricciardi, S.; Riller, T.; Ristorcelli, I.; Rocha, G.; Rosset, C.; Rossetti, M.; Roudier, G.; Rubino-Martin, J.A.; Rusholme, B.; Sandri, M.; Santos, D.; Savini, G.; Scott, D.; Seiffert, M.D.; Shellard, E.P.S.; Spencer, L.D.; Starck, J.L.; Stolyarov, V.; Stompor, R.; Sudiwala, R.; Sunyaev, R.; Sureau, F.; Sutton, D.; Suur-Uski, A.S.; Sygnet, J.F.; Tauber, J.A.; Tavagnacco, D.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tucci, M.; Tuovinen, J.; Umana, G.; Valenziano, L.; Valiviita, J.; Van Tent, B.; Varis, J.; Vielva, P.; Villa, F.; Vittorio, N.; Wade, L.A.; Wandelt, B.D.; White, S.D.M.; Yvon, D.; Zacchei, A.; Zonca, A.

    2014-01-01

    We have constructed the first all-sky map of the thermal Sunyaev-Zeldovich (tSZ) effect by applying specifically tailored component separation algorithms to the 100 to 857 GHz frequency channel maps from the Planck survey. These maps show an obvious galaxy cluster tSZ signal that is well matched with blindly detected clusters in the Planck SZ catalogue. To characterize the signal in the tSZ map we have computed its angular power spectrum. At large angular scales ($\\ell 500$) the clustered Cosmic Infrared Background (CIB) and residual point sources are the major contaminants. These foregrounds are carefully modelled and subtracted. We measure the tSZ power spectrum in angular scales, $0.17^{\\circ} \\lesssim \\theta \\lesssim 3.0^{\\circ}$, that were previously unexplored. The measured tSZ power spectrum is consistent with that expected from the Planck catalogue of SZ sources, with additional clear evidence of signal from unresolved clusters and, potentially, diffuse warm baryons. We use the tSZ power spectrum to ...

  16. The 105-Month Swift-BAT All-sky Hard X-Ray Survey

    Science.gov (United States)

    Oh, Kyuseok; Koss, Michael; Markwardt, Craig B.; Schawinski, Kevin; Baumgartner, Wayne H.; Barthelmy, Scott D.; Cenko, S. Bradley; Gehrels, Neil; Mushotzky, Richard; Petulante, Abigail; Ricci, Claudio; Lien, Amy; Trakhtenbrot, Benny

    2018-03-01

    We present a catalog of hard X-ray sources detected in the first 105 months of observations with the Burst Alert Telescope (BAT) coded-mask imager on board the Swift observatory. The 105-month Swift-BAT survey is a uniform hard X-ray all-sky survey with a sensitivity of 8.40× {10}-12 {erg} {{{s}}}-1 {cm}}-2 over 90% of the sky and 7.24× {10}-12 {erg} {{{s}}}-1 {cm}}-2 over 50% of the sky in the 14–195 keV band. The Swift-BAT 105-month catalog provides 1632 (422 new detections) hard X-ray sources in the 14–195 keV band above the 4.8σ significance level. Adding to the previously known hard X-ray sources, 34% (144/422) of the new detections are identified as Seyfert active galactic nuclei (AGNs) in nearby galaxies (zBAT catalog, we release eight-channel spectra and monthly sampled light curves for each object in the online journal and at the Swift-BAT 105-month website.

  17. Tomographic local 2D analyses of the WISExSuperCOSMOS all-sky galaxy catalogue

    Science.gov (United States)

    Novaes, C. P.; Bernui, A.; Xavier, H. S.; Marques, G. A.

    2018-05-01

    The recent progress in obtaining larger and deeper galaxy catalogues is of fundamental importance for cosmological studies, especially to robustly measure the large scale density fluctuations in the Universe. The present work uses the Minkowski Functionals (MF) to probe the galaxy density field from the WISExSuperCOSMOS (WSC) all-sky catalogue by performing tomographic local analyses in five redshift shells (of thickness δz = 0.05) in the total range of 0.10 methodology reveals 1 - 3 regions of the GNC maps in each redshift shell with an uncommon behaviour (extreme regions), i.e., p-value < 1.4%. Indeed, the resulting MF curves show signatures that suggest the uncommon behaviour to be associated with the presence of over- or under-densities there, but contamination due to residual foregrounds is not discarded. Additionally, even though our analyses indicate a good agreement among data and simulations, we identify 1 highly extreme region, seemingly associated to a large clustered distribution of galaxies. Our results confirm the usefulness of the MF to analyse GNC maps from photometric galaxy datasets.

  18. Full band all-sky search for periodic gravitational waves in the O1 LIGO data

    Science.gov (United States)

    Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allen, G.; Allocca, A.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Angelova, S. V.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Atallah, D. V.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Austin, C.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barkett, K.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Bawaj, M.; Bayley, J. C.; Bazzan, M.; Bécsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Bero, J. J.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Biscoveanu, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonilla, E.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bossie, K.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Bustillo, J. Calderón; Callister, T. A.; Calloni, E.; Camp, J. B.; Canepa, M.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerdá-Durán, P.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chase, E.; Chassande-Mottin, E.; Chatterjee, D.; Cheeseboro, B. D.; Chen, H. Y.; Chen, X.; Chen, Y.; Cheng, H.-P.; Chia, H. Y.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciecielag, P.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Clearwater, P.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Cohen, D.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Cordero-Carrión, I.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, E. T.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Canton, T. Dal; Dálya, G.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Demos, N.; Denker, T.; Dent, T.; De Pietri, R.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; De Rossi, C.; DeSalvo, R.; de Varona, O.; Devenson, J.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorosh, O.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Dreissigacker, C.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dupej, P.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Estevez, D.; Etienne, Z. B.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fee, C.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Finstad, D.; Fiori, I.; Fiorucci, D.; Fishbach, M.; Fisher, R. P.; Fitz-Axen, M.; Flaminio, R.; Fletcher, M.; Fong, H.; Font, J. A.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garcia-Quiros, C.; Garufi, F.; Gateley, B.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; Goncharov, B.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Gretarsson, E. M.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Halim, O.; Hall, B. R.; Hall, E. D.; Hamilton, E. Z.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hinderer, T.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hreibi, A.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J.-M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kamai, B.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Kapadia, S. J.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, K.; Kim, W.; Kim, W. S.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kinley-Hanlon, M.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Knowles, T. D.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Linker, S. D.; Littenberg, T. B.; Liu, J.; Lo, R. K. L.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Lück, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macas, R.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña Hernandez, I.; Magaña-Sandoval, F.; Magaña Zertuche, L.; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markakis, C.; Markosyan, A. S.; Markowitz, A.; Maros, E.; Marquina, A.; Martelli, F.; Martellini, L.; Martin, I. W.; Martin, R. M.; Martynov, D. V.; Mason, K.; Massera, E.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McNeill, L.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Mehmet, M.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, B. B.; Miller, J.; Millhouse, M.; Milovich-Goff, M. C.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moffa, D.; Moggi, A.; Mogushi, K.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muñiz, E. A.; Muratore, M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Neilson, J.; Nelemans, G.; Nelson, T. J. N.; Nery, M.; Neunzert, A.; Nevin, L.; Newport, J. M.; Newton, G.; Ng, K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; North, C.; Nuttall, L. K.; Oberling, J.; O'Dea, G. D.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Okada, M. A.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ossokine, S.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, Howard; Pan, Huang-Wei; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Parida, A.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patil, M.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pirello, M.; Pisarski, A.; Pitkin, M.; Poe, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Pratten, G.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rajbhandari, B.; Rakhmanov, M.; Ramirez, K. E.; Ramos-Buades, A.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Ren, W.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosińska, D.; Ross, M. P.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Rutins, G.; Ryan, K.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sanchez, L. E.; Sanchis-Gual, N.; Sandberg, V.; Sanders, J. R.; Sassolas, B.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheel, M.; Scheuer, J.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shaner, M. B.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, L. P.; Singh, A.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Somala, S.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staats, K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stevenson, S. P.; Stone, R.; Stops, D. J.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Strunk, A.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Suresh, J.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Tait, S. C.; Talbot, C.; Talukder, D.; Tanner, D. B.; Tao, D.; Tápai, M.; Taracchini, A.; Tasson, J. D.; Taylor, J. A.; Taylor, R.; Tewari, S. V.; Theeg, T.; Thies, F.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torres-Forné, A.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tsukada, L.; Tsuna, D.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, W. H.; Wang, Y. F.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Weßels, P.; Westerweck, J.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Wilken, D.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wysocki, D. M.; Xiao, S.; Yamamoto, H.; Yancey, C. C.; Yang, L.; Yap, M. J.; Yazback, M.; Yu, Hang; Yu, Haocun; Yvert, M.; Zadroźny, A.; Zanolin, M.; Zelenova, T.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.-H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S. J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; LIGO Scientific Collaboration; Virgo Collaboration

    2018-05-01

    We report on a new all-sky search for periodic gravitational waves in the frequency band 475-2000 Hz and with a frequency time derivative in the range of [-1.0 ,+0.1 ] ×1 0-8 Hz /s . Potential signals could be produced by a nearby spinning and slightly nonaxisymmetric isolated neutron star in our Galaxy. This search uses the data from Advanced LIGO's first observational run O1. No gravitational-wave signals were observed, and upper limits were placed on their strengths. For completeness, results from the separately published low-frequency search 20-475 Hz are included as well. Our lowest upper limit on worst-case (linearly polarized) strain amplitude h0 is ˜4 ×1 0-25 near 170 Hz, while at the high end of our frequency range, we achieve a worst-case upper limit of 1.3 ×1 0-24. For a circularly polarized source (most favorable orientation), the smallest upper limit obtained is ˜1.5 ×1 0-25.

  19. All-sky brightness monitoring of light pollution with astronomical methods.

    Science.gov (United States)

    Rabaza, O; Galadí-Enríquez, D; Estrella, A Espín; Dols, F Aznar

    2010-06-01

    This paper describes a mobile prototype and a protocol to measure light pollution based on astronomical methods. The prototype takes three all-sky images using BVR filters of the Johnson-Cousins astronomical photometric system. The stars are then identified in the images of the Hipparcos and General Catalogue of Photometric Data II astronomical catalogues, and are used as calibration sources. This method permits the measurement of night-sky brightness and facilitates an estimate of which fraction is due to the light up-scattered in the atmosphere by a wide variety of man-made sources. This is achieved by our software, which compares the sky background flux to that of many stars of known brightness. The reduced weight and dimensions of the prototype allow the user to make measurements from virtually any location. This prototype is capable of measuring the sky distribution of light pollution, and also provides an accurate estimate of the background flux at each photometric band. (c) 2010 Elsevier Ltd. All rights reserved.

  20. Multiband photometry and spectroscopy of an all-sky sample of bright white dwarfs

    Science.gov (United States)

    Raddi, R.; Gentile Fusillo, N. P.; Pala, A. F.; Hermes, J. J.; Gänsicke, B. T.; Chote, P.; Hollands, M. A.; Henden, A.; Catalán, S.; Geier, S.; Koester, D.; Munari, U.; Napiwotzki, R.; Tremblay, P.-E.

    2017-12-01

    The upcoming NASA Transiting Exoplanet Survey Satellite (TESS) will obtain space-based uninterrupted light curves for a large sample of bright white dwarfs distributed across the entire sky, providing a very rich resource for asteroseismological studies and the search for transits from planetary debris. We have compiled an all-sky catalogue of ultraviolet, optical and infrared photometry as well as proper motions, which we propose as an essential tool for the preliminary identification and characterization of potential targets. We present data for 1864 known white dwarfs and 305 high-probability white dwarf candidates brighter than 17 mag. We describe the spectroscopic follow-up of 135 stars, of which 82 are white dwarfs and 25 are hot subdwarfs. The new confirmed stars include six pulsating white dwarf candidates (ZZ Cetis), and nine white dwarf binaries with a cool main-sequence companion. We identify one star with a spectroscopic distance of only 25 pc from the Sun. Around the time TESS is launched, we foresee that all white dwarfs in this sample will have trigonometric parallaxes measured by the ESA Gaia mission next year.

  1. ASHI: An All Sky Heliospheric Imager for Viewing Thomson-Scattered Light

    Science.gov (United States)

    Buffington, A.; Jackson, B. V.; Yu, H. S.; Hick, P. P.; Bisi, M. M.

    2017-12-01

    We have developed, and are now making a detailed design for an All-Sky Heliospheric Imager (ASHI), to fly on future deep-space missions. ASHI's principal long-term objective is acquisition of a precision photometric map of the inner heliosphere as viewed from deep space. Photometers on the twin Helios spacecraft, the Solar Mass Ejection Imager (SMEI) upon the Coriolis satellite, and the Heliospheric Imagers (HIs) upon the Solar-TErrestrial RElations Observatory (STEREO) twin spacecraft, all indicate an optimum instrument design for visible-light Thomson-scattering observations. This design views a hemisphere of sky starting a few degrees from the Sun. Two imagers can cover almost all of the whole sky. A key photometric specification for ASHI is 0.1% differential photometry: this enables the three dimensional reconstruction of density starting from near the Sun and extending outward. SMEI analyses have demonstrated the success of this technique: when employed by ASHI, this will provide an order of magnitude better resolution in 3-D density over time. We augment this analysis to include velocity, and these imagers deployed in deep space can thus provide high-resolution comparisons both of direct in-situ density and velocity measurements to remote observations of solar wind structures. In practice we find that the 3-D velocity determinations provide the best tomographic timing depiction of heliospheric structures. We discuss the simple concept behind this, and present recent progress in the instrument design, and its expected performance specifications. A preliminary balloon flight of an ASHI prototype is planned to take place next Summer.

  2. Association between substorm onsets in auroral all-sky images and geomagnetic Pi2pulsations

    Science.gov (United States)

    Miura, T.; Ieda, A.; Teramoto, M.; Kawashima, T.

    2017-12-01

    Substorms are explosive disturbances in the magnetosphere and ionosphere of Earth. Substorm onsets are often identified usingsudden auroral brightenings (auroral breakup) or geomagnetic Pi2 pulsations. These auroral brightenings and Pi2 pulsations aresupposed to occur simultaneously within approximately 1 min of each other. However, as auroral brightenings typically includea two-stage development, this simultaneity is not straightforward. In this study, we clarify the correspondence between Pi2 pulsations and auroral brightenings, including the two-stage development.The first stage of the development is the sudden brightening of an auroral arc near the midnight (initial brightening)and the second stage is the poleward expansion of the auroral arc. We compared all-sky images (3 s resolution) in Canada andgeomagnetic observations (0.5-1 s resolution) in North and Central America, using data from the THEMIS project. In this study,we examined three substorms events that exhibit evidence of the two-stage auroral development. In the first event (4 March 2008), an auroral initial brightening occurred at 0533:57 UT and a poleward expansion was observedat 0538:12 UT (4 min after the initial brightening) in Gillam (magnetic latitude:66.0 °, longitude:333 °, MLT:22.9). In contract,the Pi2 pulsation started at 0539:30 UT, which is closer to the time of the poleward expansion, in Carson City (magnetic latitude:45.0 °, longitude:304 °). and San Juan (magnetic latitude:27.9 °, longitude:6.53 °). Thus, we consider this Pi2 pulsation ascorresponding to the poleward expansion rather than the initial brightening. This correspondence was also seen in the other twoevents, suggesting that it is not exceptional. We interpret that the Pi2 pulsation corresponds to the poleward expansion becauseboth are caused by the magnetic field dipolarization, which is a drastic change that propagates from low- to high-latitude fieldlines.

  3. A multi-sensor data-driven methodology for all-sky passive microwave inundation retrieval

    Directory of Open Access Journals (Sweden)

    Z. Takbiri

    2017-06-01

    Full Text Available We present a multi-sensor Bayesian passive microwave retrieval algorithm for flood inundation mapping at high spatial and temporal resolutions. The algorithm takes advantage of observations from multiple sensors in optical, short-infrared, and microwave bands, thereby allowing for detection and mapping of the sub-pixel fraction of inundated areas under almost all-sky conditions. The method relies on a nearest-neighbor search and a modern sparsity-promoting inversion method that make use of an a priori dataset in the form of two joint dictionaries. These dictionaries contain almost overlapping observations by the Special Sensor Microwave Imager and Sounder (SSMIS on board the Defense Meteorological Satellite Program (DMSP F17 satellite and the Moderate Resolution Imaging Spectroradiometer (MODIS on board the Aqua and Terra satellites. Evaluation of the retrieval algorithm over the Mekong Delta shows that it is capable of capturing to a good degree the inundation diurnal variability due to localized convective precipitation. At longer timescales, the results demonstrate consistency with the ground-based water level observations, denoting that the method is properly capturing inundation seasonal patterns in response to regional monsoonal rain. The calculated Euclidean distance, rank-correlation, and also copula quantile analysis demonstrate a good agreement between the outputs of the algorithm and the observed water levels at monthly and daily timescales. The current inundation products are at a resolution of 12.5 km and taken twice per day, but a higher resolution (order of 5 km and every 3 h can be achieved using the same algorithm with the dictionary populated by the Global Precipitation Mission (GPM Microwave Imager (GMI products.

  4. A multi-sensor data-driven methodology for all-sky passive microwave inundation retrieval

    Science.gov (United States)

    Takbiri, Zeinab; Ebtehaj, Ardeshir M.; Foufoula-Georgiou, Efi

    2017-06-01

    We present a multi-sensor Bayesian passive microwave retrieval algorithm for flood inundation mapping at high spatial and temporal resolutions. The algorithm takes advantage of observations from multiple sensors in optical, short-infrared, and microwave bands, thereby allowing for detection and mapping of the sub-pixel fraction of inundated areas under almost all-sky conditions. The method relies on a nearest-neighbor search and a modern sparsity-promoting inversion method that make use of an a priori dataset in the form of two joint dictionaries. These dictionaries contain almost overlapping observations by the Special Sensor Microwave Imager and Sounder (SSMIS) on board the Defense Meteorological Satellite Program (DMSP) F17 satellite and the Moderate Resolution Imaging Spectroradiometer (MODIS) on board the Aqua and Terra satellites. Evaluation of the retrieval algorithm over the Mekong Delta shows that it is capable of capturing to a good degree the inundation diurnal variability due to localized convective precipitation. At longer timescales, the results demonstrate consistency with the ground-based water level observations, denoting that the method is properly capturing inundation seasonal patterns in response to regional monsoonal rain. The calculated Euclidean distance, rank-correlation, and also copula quantile analysis demonstrate a good agreement between the outputs of the algorithm and the observed water levels at monthly and daily timescales. The current inundation products are at a resolution of 12.5 km and taken twice per day, but a higher resolution (order of 5 km and every 3 h) can be achieved using the same algorithm with the dictionary populated by the Global Precipitation Mission (GPM) Microwave Imager (GMI) products.

  5. The taxonomic distribution of asteroids from multi-filter all-sky photometric surveys

    Science.gov (United States)

    DeMeo, F. E.; Carry, B.

    2013-09-01

    The distribution of asteroids across the main belt has been studied for decades to understand the current compositional distribution and what that tells us about the formation and evolution of our Solar System. All-sky surveys now provide orders of magnitude more data than targeted surveys. We present a method to bias-correct the asteroid population observed in the Sloan Digital Sky Survey (SDSS) according to size, distance, and albedo. We taxonomically classify this dataset consistent with the Bus and Binzel (Bus, S.J., Binzel, R.P. [2002]. Icarus 158, 146-177) and Bus-DeMeo et al. (DeMeo, F.E., Binzel, R.P., Slivan, S.M., Bus, S.J. [2009]. Icarus 202(July), 160-180) systems and present the resulting taxonomic distribution. The dataset includes asteroids as small as 5 km, a factor of three in diameter smaller than in previous work such as by Mothé-Diniz et al. (Mothé-Diniz, T., Carvano, J.M.Á., Lazzaro, D. [2003]. Icarus 162(March), 10-21). Because of the wide range of sizes in our sample, we present the distribution by number, surface area, volume, and mass whereas previous work was exclusively by number. While the distribution by number is a useful quantity and has been used for decades, these additional quantities provide new insights into the distribution of total material. We find evidence for D-types in the inner main belt where they are unexpected according to dynamical models of implantation of bodies from the outer Solar System into the inner Solar System during planetary migration (Levison, H.F., Bottke, W.F., Gounelle, M., Morbidelli, A., Nesvorný, D., Tsiganis, K. [2009]. Nature 460(July), 364-366). We find no evidence of S-types or other unexpected classes among Trojans and Hildas, albeit a bias favoring such a detection. Finally, we estimate for the first time the total amount of material of each class in the inner Solar System. The main belt’s most massive classes are C, B, P, V and S in decreasing order. Excluding the four most massive

  6. THE GREAT OBSERVATORIES ALL-SKY LIRG SURVEY: COMPARISON OF ULTRAVIOLET AND FAR-INFRARED PROPERTIES

    International Nuclear Information System (INIS)

    Howell, Justin H.; Armus, Lee; Surace, Jason A.; Petric, Andreea; Bridge, Carrie; Haan, Sebastian; Inami, Hanae; Mazzarella, Joseph M.; Chan, Ben H. P.; Madore, Barry F.; Evans, Aaron S.; Kim, Dong-Chan; Sanders, David B.; Appleton, Phil; Frayer, David T.; Lord, Steven; Schulz, Bernhard; Bothun, Greg; Charmandaris, Vassilis; Melbourne, Jason

    2010-01-01

    The Great Observatories All-sky LIRG Survey (GOALS) consists of a complete sample of 202 luminous infrared galaxies (LIRGs) selected from the IRAS Revised Bright Galaxy Sample (RBGS). The galaxies span the full range of interaction stages, from isolated galaxies to interacting pairs to late stage mergers. We present a comparison of the UV and infrared properties of 135 galaxies in GOALS observed by GALEX and Spitzer. For interacting galaxies with separations greater than the resolution of GALEX and Spitzer (∼2''-6''), we assess the UV and IR properties of each galaxy individually. The contribution of the FUV to the measured star formation rate (SFR) ranges from 0.2% to 17.9%, with a median of 2.8% and a mean of 4.0% ± 0.4%. The specific star formation rate (SSFR) of the GOALS sample is extremely high, with a median value (3.9 x 10 -10 yr -1 ) that is comparable to the highest SSFRs seen in the Spitzer Infrared Nearby Galaxies Survey sample. We examine the position of each galaxy on the IR excess-UV slope (IRX-β) diagram as a function of galaxy properties, including IR luminosity and interaction stage. The LIRGs on average have greater IR excesses than would be expected based on their UV colors if they obeyed the same relations as starbursts with L IR 11 L sun or normal late-type galaxies. The ratio of L IR to the value one would estimate from the IRX-β relation published for lower luminosity starburst galaxies ranges from 0.2 to 68, with a median value of 2.7. A minimum of 19% of the total IR luminosity in the RBGS is produced in LIRGs and ultraluminous infrared galaxies with red UV colors (β>0). Among resolved interacting systems, 32% contain one galaxy which dominates the IR emission while the companion dominates the UV emission. Only 21% of the resolved systems contain a single galaxy which dominates both wavelengths.

  7. Point source detection using the Spherical Mexican Hat Wavelet on simulated all-sky Planck maps

    Science.gov (United States)

    Vielva, P.; Martínez-González, E.; Gallegos, J. E.; Toffolatti, L.; Sanz, J. L.

    2003-09-01

    We present an estimation of the point source (PS) catalogue that could be extracted from the forthcoming ESA Planck mission data. We have applied the Spherical Mexican Hat Wavelet (SMHW) to simulated all-sky maps that include cosmic microwave background (CMB), Galactic emission (thermal dust, free-free and synchrotron), thermal Sunyaev-Zel'dovich effect and PS emission, as well as instrumental white noise. This work is an extension of the one presented in Vielva et al. We have developed an algorithm focused on a fast local optimal scale determination, that is crucial to achieve a PS catalogue with a large number of detections and a low flux limit. An important effort has been also done to reduce the CPU time processor for spherical harmonic transformation, in order to perform the PS detection in a reasonable time. The presented algorithm is able to provide a PS catalogue above fluxes: 0.48 Jy (857 GHz), 0.49 Jy (545 GHz), 0.18 Jy (353 GHz), 0.12 Jy (217 GHz), 0.13 Jy (143 GHz), 0.16 Jy (100 GHz HFI), 0.19 Jy (100 GHz LFI), 0.24 Jy (70 GHz), 0.25 Jy (44 GHz) and 0.23 Jy (30 GHz). We detect around 27 700 PS at the highest frequency Planck channel and 2900 at the 30-GHz one. The completeness level are: 70 per cent (857 GHz), 75 per cent (545 GHz), 70 per cent (353 GHz), 80 per cent (217 GHz), 90 per cent (143 GHz), 85 per cent (100 GHz HFI), 80 per cent (100 GHz LFI), 80 per cent (70 GHz), 85 per cent (44 GHz) and 80 per cent (30 GHz). In addition, we can find several PS at different channels, allowing the study of the spectral behaviour and the physical processes acting on them. We also present the basic procedure to apply the method in maps convolved with asymmetric beams. The algorithm takes ~72 h for the most CPU time-demanding channel (857 GHz) in a Compaq HPC320 (Alpha EV68 1-GHz processor) and requires 4 GB of RAM memory; the CPU time goes as O[NRoN3/2pix log(Npix)], where Npix is the number of pixels in the map and NRo is the number of optimal scales needed.

  8. First low-frequency Einstein@Home all-sky search for continuous gravitational waves in Advanced LIGO data

    NARCIS (Netherlands)

    Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allen, G.; Allocca, A.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bawaj, M.; Bazzan, M.; Becsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Bustillo, J. Calderon; Callister, T. A.; Calloni, E.; Camp, J. B.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chatterjee, D.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H. -P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M., Jr.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Costa, C. F. Da Silva; Dattilo, V.; Dave, I.; Davier, M.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Deelman, E.; Degallaix, J.; De Laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Diaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Alvarez, M. Dovale; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Duncan, J.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H. -B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Etienne, Z. B.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J. -D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gabel, M.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garufi, F.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; Gonzalez, G.; Castro, J. M. Gonzalez; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C. -J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J. -M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jimenez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kefelian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, W.; Kim, W. S.; Kim, Y. -M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kraemer, C.; Kringel, V.; Krishnan, B.; Krolak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lo, R. K. L.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Lueck, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Hernandez, I. Magana; Magana-Sandoval, F.; Zertuche, L. Magana; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Marka, Z.; Markakis, C.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mayani, R.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Ng, K. K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Puerrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Ramirez, K. E.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosinska, D.; Ross, M. P.; Rowan, S.; Ruediger, A.; Ruggi, P.; Ryan, K.; Rynge, M.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schoenbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, R. J. E.; Smith, R. J. E.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepanczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tapai, M.; Taracchini, A.; Taylor, J. A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Toyra, D.; Travasso, F.; Traylor, G.; Trifiro, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahi, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasuth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Vicere, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, M.; Wang, Y. -F.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, K. W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; Zadrozny, A.; Zanolin, M.; Zelenova, T.; Zendri, J. -P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y. -H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S. J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; Anderson, D. P.

    2017-01-01

    We report results of a deep all-sky search for periodic gravitational waves from isolated neutron stars in data from the first Advanced LIGO observing run. This search investigates the low frequency range of Advanced LIGO data, between 20 and 100 Hz, much of which was not explored in initial LIGO.

  9. Planck 2013 results. XXI. Power spectrum and high-order statistics of the Planck all-sky Compton parameter map

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.

    2014-01-01

    We have constructed the first all-sky map of the thermal Sunyaev-Zeldovich (tSZ) effect by applying specifically tailored component separation algorithms to the 100 to 857 GHz frequency channel maps from the Planck survey. This map shows an obvious galaxy cluster tSZ signal that is well matched w...

  10. TWO MICRON ALL SKY SURVEY PHOTOMETRIC REDSHIFT CATALOG: A COMPREHENSIVE THREE-DIMENSIONAL CENSUS OF THE WHOLE SKY

    International Nuclear Information System (INIS)

    Bilicki, Maciej; Jarrett, Thomas H.; Cluver, Michelle E.; Steward, Louise; Peacock, John A.

    2014-01-01

    Key cosmological applications require the three-dimensional (3D) galaxy distribution on the entire celestial sphere. These include measuring the gravitational pull on the Local Group, estimating the large-scale bulk flow, and testing the Copernican principle. However, the largest all-sky redshift surveys—the 2MASS Redshift Survey and IRAS Point Source Catalog Redshift Survey—have median redshifts of only z = 0.03 and sample the very local universe. All-sky galaxy catalogs exist that reach much deeper—SuperCOSMOS in the optical, the Two Micron All Sky Survey (2MASS) in the near-IR, and WISE in the mid-IR—but these lack complete redshift information. At present, the only rapid way toward larger 3D catalogs covering the whole sky is through photometric redshift techniques. In this paper we present the 2MASS Photometric Redshift catalog (2MPZ) containing one million galaxies, constructed by cross-matching Two Micron All Sky Survey Extended Source Catalog (2MASS XSC), WISE, and SuperCOSMOS all-sky samples and employing the artificial neural network approach (the ANNz algorithm), trained on such redshift surveys as the Sloan Digital Sky Survey, 6dFGS, and 2dFGRS. The derived photometric redshifts have errors nearly independent of distance, with an all-sky accuracy of σ z = 0.015 and a very small percentage of outliers. In this way, we obtain redshift estimates with a typical precision of 12% for all the 2MASS XSC galaxies that lack spectroscopy. In addition, we have made an early effort toward probing the entire 3D sky beyond 2MASS, by pairing up WISE with SuperCOSMOS and training the ANNz on GAMA redshift data currently reaching to z med ∼ 0.2. This has yielded photo-z accuracies comparable to those in the 2MPZ. These all-sky photo-z catalogs, with a median z ∼ 0.1 for the 2MPZ, and significantly deeper for future WISE-based samples, will be the largest and most complete of their kind for the foreseeable future

  11. Data analysis of gravitational-wave signals from spinning neutron stars. IV. An all-sky search

    International Nuclear Information System (INIS)

    Astone, Pia; Borkowski, Kazimierz M.; Jaranowski, Piotr; Krolak, Andrzej

    2002-01-01

    We develop a set of data analysis tools for a realistic all-sky search for continuous gravitational-wave signals and we test our tools against simulated data. The aim of the paper is to prepare for an analysis of the real data from the EXPLORER bar detector; however, the methods that we present apply both to data from the resonant bar detectors that are currently in operation and the laser interferometric detectors that are in the final stages of construction and commissioning. With our techniques we shall be able to perform an all-sky coherent search of 2 days of data from the EXPLORER detector for a frequency bandwidth of 0.76 Hz in one month with 250 Mflops computing power. This search will detect all the continuous gravitational-wave signals with the dimensionless amplitude larger than 2.8x10 -23 with 99% confidence, assuming that the noise in the detector is Gaussian

  12. RELIABLE IDENTIFICATIONS OF ACTIVE GALACTIC NUCLEI FROM THE WISE, 2MASS, AND ROSAT ALL-SKY SURVEYS

    International Nuclear Information System (INIS)

    Edelson, R.; Malkan, M.

    2012-01-01

    We have developed the ''S IX '' statistic to identify bright, highly likely active galactic nucleus (AGN) candidates solely on the basis of Wide-field Infrared Survey Explorer (WISE), Two Micron All-Sky Survey (2MASS), and ROSAT all-sky survey (RASS) data. This statistic was optimized with data from the preliminary WISE survey and the Sloan Digital Sky Survey, and tested with Lick 3 m Kast spectroscopy. We find that sources with S IX 95% likelihood of being an AGN (defined in this paper as a Seyfert 1, quasar, or blazar). This statistic was then applied to the full WISE/2MASS/RASS dataset, including the final WISE data release, to yield the ''W2R'' sample of 4316 sources with S IX 2 , permitting construction of AGN samples in any sufficiently large region of sky.

  13. A LIMIT ON THE NUMBER OF ISOLATED NEUTRON STARS DETECTED IN THE ROSAT ALL-SKY-SURVEY BRIGHT SOURCE CATALOG

    International Nuclear Information System (INIS)

    Turner, Monica L.; Rutledge, Robert E.; Letcavage, Ryan; Shevchuk, Andrew S. H.; Fox, Derek B.

    2010-01-01

    Using new and archival observations made with the Swift satellite and other facilities, we examine 147 X-ray sources selected from the ROSAT All-Sky-Survey Bright Source Catalog (RASS/BSC) to produce a new limit on the number of isolated neutron stars (INSs) in the RASS/BSC, the most constraining such limit to date. Independent of X-ray spectrum and variability, the number of INSs is ≤48 (90% confidence). Restricting attention to soft (kT eff < 200 eV), non-variable X-ray sources-as in a previous study-yields an all-sky limit of ≤31 INSs. In the course of our analysis, we identify five new high-quality INS candidates for targeted follow-up observations. A future all-sky X-ray survey with eROSITA, or another mission with similar capabilities, can be expected to increase the detected population of X-ray-discovered INSs from the 8-50 in the BSC, to (for a disk population) 240-1500, which will enable a more detailed study of neutron star population models.

  14. Toward long-term all-sky time domain surveys-SINDICS: a prospective concept for a Seismic INDICes Survey of half a million red giants

    Directory of Open Access Journals (Sweden)

    Michel Eric

    2015-01-01

    Full Text Available CoRoT and Kepler have brought a new and deep experience in long-term photometric surveys and how to use them. This is true for exoplanets characterizing, stellar seismology and beyond for studying several other phenomena, like granulation or activity. Based on this experience, it has been possible to propose new generation projects, like TESS and PLATO, with more specific scientific objectives and more ambitious observational programs in terms of sky coverage and/or duration of the observations. In this context and as a prospective exercise, we explore here the possibility to set up an all-sky survey optimized for seismic indices measurement, providing masses, radii and evolution stages for half a million solar-type pulsators (subgiants and red giants, in our galactic neighborhood and allowing unprecedented stellar population studies.

  15. Disaggregation of remotely sensed soil moisture under all sky condition using machine learning approach in Northeast Asia

    Science.gov (United States)

    Kim, S.; Kim, H.; Choi, M.; Kim, K.

    2016-12-01

    Estimating spatiotemporal variation of soil moisture is crucial to hydrological applications such as flood, drought, and near real-time climate forecasting. Recent advances in space-based passive microwave measurements allow the frequent monitoring of the surface soil moisture at a global scale and downscaling approaches have been applied to improve the spatial resolution of passive microwave products available at local scale applications. However, most downscaling methods using optical and thermal dataset, are valid only in cloud-free conditions; thus renewed downscaling method under all sky condition is necessary for the establishment of spatiotemporal continuity of datasets at fine resolution. In present study Support Vector Machine (SVM) technique was utilized to downscale a satellite-based soil moisture retrievals. The 0.1 and 0.25-degree resolution of daily Land Parameter Retrieval Model (LPRM) L3 soil moisture datasets from Advanced Microwave Scanning Radiometer 2 (AMSR2) were disaggregated over Northeast Asia in 2015. Optically derived estimates of surface temperature (LST), normalized difference vegetation index (NDVI), and its cloud products were obtained from MODerate Resolution Imaging Spectroradiometer (MODIS) for the purpose of downscaling soil moisture in finer resolution under all sky condition. Furthermore, a comparison analysis between in situ and downscaled soil moisture products was also conducted for quantitatively assessing its accuracy. Results showed that downscaled soil moisture under all sky condition not only preserves the quality of AMSR2 LPRM soil moisture at 1km resolution, but also attains higher spatial data coverage. From this research we expect that time continuous monitoring of soil moisture at fine scale regardless of weather conditions would be available.

  16. ROTSE All-Sky Surveys for Variable Stars. I. Test Fields

    International Nuclear Information System (INIS)

    Akerlof, C.; Amrose, S.; Balsano, R.; Bloch, J.; Casperson, D.; Fletcher, S.; Gisler, G.; Hills, J.; Kehoe, R.; Lee, B.

    2000-01-01

    The Robotic Optical Transient Search Experiment I (ROTSE-I) experiment has generated CCD photometry for the entire northern sky in two epochs nightly since 1998 March. These sky patrol data are a powerful resource for studies of astrophysical transients. As a demonstration project, we present first results of a search for periodic variable stars derived from ROTSE-I observations. Variable identification, period determination, and type classification are conducted via automatic algorithms. In a set of nine ROTSE-I sky patrol fields covering roughly 2000 deg2, we identify 1781 periodic variable stars with mean magnitudes between m v = 10.0 and m v = 15.5. About 90% of these objects are newly identified as variable. Examples of many familiar types are presented. All classifications for this study have been manually confirmed. The selection criteria for this analysis have been conservatively defined and are known to be biased against some variable classes. This preliminary study includes only 5.6% of the total ROTSE-I sky coverage, suggesting that the full ROTSE-I variable catalog will include more than 32,000 periodic variable stars. (c) (c) 2000. The American Astronomical Society

  17. Examining Dense Data Usage near the Regions with Severe Storms in All-Sky Microwave Radiance Data Assimilation and Impacts on GEOS Hurricane Analyses

    Science.gov (United States)

    Kim, Min-Jeong; Jin, Jianjun; McCarty, Will; El Akkraoui, Amal; Todling, Ricardo; Gelaro, Ron

    2018-01-01

    Many numerical weather prediction (NWP) centers assimilate radiances affected by clouds and precipitation from microwave sensors, with the expectation that these data can provide critical constraints on meteorological parameters in dynamically sensitive regions to make significant impacts on forecast accuracy for precipitation. The Global Modeling and Assimilation Office (GMAO) at NASA Goddard Space Flight Center assimilates all-sky microwave radiance data from various microwave sensors such as all-sky GPM Microwave Imager (GMI) radiance in the Goddard Earth Observing System (GEOS) atmospheric data assimilation system (ADAS), which includes the GEOS atmospheric model, the Gridpoint Statistical Interpolation (GSI) atmospheric analysis system, and the Goddard Aerosol Assimilation System (GAAS). So far, most of NWP centers apply same large data thinning distances, that are used in clear-sky radiance data to avoid correlated observation errors, to all-sky microwave radiance data. For example, NASA GMAO is applying 145 km thinning distances for most of satellite radiance data including microwave radiance data in which all-sky approach is implemented. Even with these coarse observation data usage in all-sky assimilation approach, noticeable positive impacts from all-sky microwave data on hurricane track forecasts were identified in GEOS-5 system. The motivation of this study is based on the dynamic thinning distance method developed in our all-sky framework to use of denser data in cloudy and precipitating regions due to relatively small spatial correlations of observation errors. To investigate the benefits of all-sky microwave radiance on hurricane forecasts, several hurricane cases selected between 2016-2017 are examined. The dynamic thinning distance method is utilized in our all-sky approach to understand the sources and mechanisms to explain the benefits of all-sky microwave radiance data from various microwave radiance sensors like Advanced Microwave Sounder Unit

  18. A new method of derived equatorial plasma bubbles motion by tracing OI 630 nm emission all-sky images

    Science.gov (United States)

    Li, M.; Yu, T.; Chunliang, X.; Zuo, X.; Liu, Z.

    2017-12-01

    A new method for estimating the equatorial plasma bubbles (EPBs) motions from airglow emission all-sky images is presented in this paper. This method, which is called 'cloud-derived wind technology' and widely used in satellite observation of wind, could reasonable derive zonal and meridional velocity vectors of EPBs drifts by tracking a series of successive airglow 630.0 nm emission images. Airglow emission images data are available from an all sky airglow camera in Hainan Fuke (19.5°N, 109.2°E) supported by China Meridional Project, which can receive the 630.0nm emission from the ionosphere F region at low-latitudes to observe plasma bubbles. A series of pretreatment technology, e.g. image enhancement, orientation correction, image projection are utilized to preprocess the raw observation. Then the regions of plasma bubble extracted from the images are divided into several small tracing windows and each tracing window can find a target window in the searching area in following image, which is considered as the position tracing window moved to. According to this, velocities in each window are calculated by using the technology of cloud-derived wind. When applying the cloud-derived wind technology, the maximum correlation coefficient (MCC) and the histogram of gradient (HOG) methods to find the target window, which mean to find the maximum correlation and the minimum euclidean distance between two gradient histograms in respectively, are investigated and compared in detail. The maximum correlation method is fianlly adopted in this study to analyze the velocity of plasma bubbles because of its better performance than HOG. All-sky images from Hainan Fuke, between August 2014 and October 2014, are analyzed to investigate the plasma bubble drift velocities using MCC method. The data at different local time at 9 nights are studied and find that zonal drift velocity in different latitude at different local time ranges from 50 m/s to 180 m/s and there is a peak value at

  19. VHE and UHE gamma ray astronomy: transients and sources

    International Nuclear Information System (INIS)

    Fegan, D.J.

    1987-01-01

    The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy

  20. DISCOVERY OF A HALO AROUND THE HELIX NEBULA NGC 7293 IN THE WISE ALL-SKY SURVEY

    International Nuclear Information System (INIS)

    Zhang Yong; Hsia, Chih-Hao; Kwok, Sun

    2012-01-01

    We report the discovery of an extended halo (∼40' in diameter) around the planetary nebula NGC 7293 (the Helix Nebula) observed in the 12 μm band from the Wide-field Infrared Survey Explorer all-sky survey. The mid-infrared halo has an axisymmetric structure with a sharp boundary to the northeast and a more diffuse boundary to the southwest, suggesting an interaction between the stellar wind and the interstellar medium (ISM). The symmetry axis of the halo is well aligned with that of a northeast arc, suggesting that the two structures are physically associated. We have attempted to fit the observed geometry with a model of a moving steady-state stellar wind interacting with the ISM. Possible combinations of the ISM density and the stellar velocity are derived from these fittings. The discrepancies between the model and the observations suggest that the stellar mass loss has a more complicated history, including possible time and angle dependences.

  1. First all-sky upper limits from LIGO on the strength of periodic gravitational waves using the Hough transform

    International Nuclear Information System (INIS)

    Abbott, B.; Adhikari, R.; Agresti, J.; Anderson, S.B.; Araya, M.; Armandula, H.; Asiri, F.; Barish, B.C.; Barnes, M.; Barton, M.A.; Bhawal, B.; Billingsley, G.; Black, E.; Blackburn, K.; Bork, R.; Brown, D.A.; Busby, D.; Cardenas, L.; Chandler, A.; Chapsky, J.

    2005-01-01

    We perform a wide parameter-space search for continuous gravitational waves over the whole sky and over a large range of values of the frequency and the first spin-down parameter. Our search method is based on the Hough transform, which is a semicoherent, computationally efficient, and robust pattern recognition technique. We apply this technique to data from the second science run of the LIGO detectors and our final results are all-sky upper limits on the strength of gravitational waves emitted by unknown isolated spinning neutron stars on a set of narrow frequency bands in the range 200-400 Hz. The best upper limit on the gravitational-wave strain amplitude that we obtain in this frequency range is 4.43x10 -23

  2. RELIABLE IDENTIFICATIONS OF ACTIVE GALACTIC NUCLEI FROM THE WISE, 2MASS, AND ROSAT ALL-SKY SURVEYS

    Energy Technology Data Exchange (ETDEWEB)

    Edelson, R. [Department of Astronomy, University of Maryland, College Park, MD 20742-2421 (United States); Malkan, M., E-mail: rickedelson@gmail.com [Department of Physics and Astronomy, University of California Los Angeles, Los Angeles, CA 90095-1547 (United States)

    2012-05-20

    We have developed the ''S{sub IX}'' statistic to identify bright, highly likely active galactic nucleus (AGN) candidates solely on the basis of Wide-field Infrared Survey Explorer (WISE), Two Micron All-Sky Survey (2MASS), and ROSAT all-sky survey (RASS) data. This statistic was optimized with data from the preliminary WISE survey and the Sloan Digital Sky Survey, and tested with Lick 3 m Kast spectroscopy. We find that sources with S{sub IX} < 0 have a {approx}>95% likelihood of being an AGN (defined in this paper as a Seyfert 1, quasar, or blazar). This statistic was then applied to the full WISE/2MASS/RASS dataset, including the final WISE data release, to yield the ''W2R'' sample of 4316 sources with S{sub IX} < 0. Only 2209 of these sources are currently in the Veron-Cetty and Veron (VCV) catalog of spectroscopically confirmed AGNs, indicating that the W2R sample contains nearly 2000 new, relatively bright (J {approx}< 16) AGNs. We utilize the W2R sample to quantify biases and incompleteness in the VCV catalog. We find that it is highly complete for bright (J < 14), northern AGNs, but the completeness drops below 50% for fainter, southern samples and for sources near the Galactic plane. This approach also led to the spectroscopic identification of 10 new AGNs in the Kepler field, more than doubling the number of AGNs being monitored by Kepler. The W2R sample contains better than 1 bright AGN every 10 deg{sup 2}, permitting construction of AGN samples in any sufficiently large region of sky.

  3. A new all-sky map of Galactic high-velocity clouds from the 21-cm HI4PI survey

    Science.gov (United States)

    Westmeier, Tobias

    2018-02-01

    High-velocity clouds (HVCs) are neutral or ionized gas clouds in the vicinity of the Milky Way that are characterized by high radial velocities inconsistent with participation in the regular rotation of the Galactic disc. Previous attempts to create a homogeneous all-sky H I map of HVCs have been hampered by a combination of poor angular resolution, limited surface brightness sensitivity and suboptimal sampling. Here, a new and improved H I map of Galactic HVCs based on the all-sky HI4PI survey is presented. The new map is fully sampled and provides significantly better angular resolution (16.2 versus 36 arcmin) and column density sensitivity (2.3 versus 3.7 × 1018 cm-2 at the native resolution) than the previously available LAB survey. The new HVC map resolves many of the major HVC complexes in the sky into an intricate network of narrow H I filaments and clumps that were not previously resolved by the LAB survey. The resulting sky coverage fraction of high-velocity H I emission above a column density level of 2 × 1018 cm-2 is approximately 15 per cent, which reduces to about 13 per cent when the Magellanic Clouds and other non-HVC emission are removed. The differential sky coverage fraction as a function of column density obeys a truncated power law with an exponent of -0.93 and a turnover point at about 5 × 1019 cm-2. H I column density and velocity maps of the HVC sky are made publicly available as FITS images for scientific use by the community.

  4. X-RAY-EMITTING STARS IDENTIFIED FROM THE ROSAT ALL-SKY SURVEY AND THE SLOAN DIGITAL SKY SURVEY

    International Nuclear Information System (INIS)

    Agueeros, Marcel A.; Newsom, Emily R.; Anderson, Scott F.; Hawley, Suzanne L.; Silvestri, Nicole M.; Szkody, Paula; Covey, Kevin R.; Posselt, Bettina; Margon, Bruce; Voges, Wolfgang

    2009-01-01

    The ROSAT All-Sky Survey (RASS) was the first imaging X-ray survey of the entire sky. Combining the RASS Bright and Faint Source Catalogs yields an average of about three X-ray sources per square degree. However, while X-ray source counterparts are known to range from distant quasars to nearby M dwarfs, the RASS data alone are often insufficient to determine the nature of an X-ray source. As a result, large-scale follow-up programs are required to construct samples of known X-ray emitters. We use optical data produced by the Sloan Digital Sky Survey (SDSS) to identify 709 stellar X-ray emitters cataloged in the RASS and falling within the SDSS Data Release 1 footprint. Most of these are bright stars with coronal X-ray emission unsuitable for SDSS spectroscopy, which is designed for fainter objects (g > 15 [mag]). Instead, we use SDSS photometry, correlations with the Two Micron All Sky Survey and other catalogs, and spectroscopy from the Apache Point Observatory 3.5 m telescope to identify these stellar X-ray counterparts. Our sample of 707 X-ray-emitting F, G, K, and M stars is one of the largest X-ray-selected samples of such stars. We derive distances to these stars using photometric parallax relations appropriate for dwarfs on the main sequence, and use these distances to calculate L X . We also identify a previously unknown cataclysmic variable (CV) as a RASS counterpart. Separately, we use correlations of the RASS and the SDSS spectroscopic catalogs of CVs and white dwarfs (WDs) to study the properties of these rarer X-ray-emitting stars. We examine the relationship between (f X /f g ) and the equivalent width of the Hβ emission line for 46 X-ray-emitting CVs and discuss tentative classifications for a subset based on these quantities. We identify 17 new X-ray-emitting DA (hydrogen) WDs, of which three are newly identified WDs. We report on follow-up observations of three candidate cool X-ray-emitting WDs (one DA and two DB (helium) WDs); we have not

  5. Characteristics of merging at the magnetopause inferred from dayside 557.7-nm all-sky images: IMF drivers of poleward moving auroral forms

    Directory of Open Access Journals (Sweden)

    N. C. Maynard

    2006-11-01

    Full Text Available We combine in situ measurements from Cluster with high-resolution 557.7 nm all-sky images from South Pole to investigate the spatial and temporal evolution of merging on the dayside magnetopause. Variations of 557.7 nm emissions were observed at a 6 s cadence at South Pole on 29 April 2003 while significant changes in the Interplanetary Magnetic Field (IMF clock angle were reaching the magnetopause. Electrons energized at merging sites are the probable sources for 557.7 nm cusp emissions. At the same time Cluster was crossing the pre-noon cusp in the Northern Hemisphere. The combined observations confirm results of a previous study that merging events can occur at multiple sites simultaneously and vary asynchronously on time scales of 10 s to 3 min (Maynard et al., 2004. The intensity of the emissions and the merging rate appear to vary with changes in the IMF clock angle, IMF BX and the dynamic pressure of the solar wind. Most poleward moving auroral forms (PMAFs reflect responses to changes in interplanetary medium rather than to local processes. The changes in magnetopause position required by increases in dynamic pressure are mediated by merging and result in the generation of PMAFs. Small (15–20% variations in dynamic pressure of the solar wind are sufficient to launch PMAFs. Changes in IMF BX create magnetic flux compressions and rarefactions in the solar wind. Increases (decreases in IMF BX strengthens |B| near northern (southern hemisphere merging sites thereby enhancing merging rates and triggering PMAFs. When correlating responses in the two hemispheres, the presence of significant IMF BX also requires that different lag-times be applied to ACE measurements acquired ~0.1 AU upstream of Earth. Cluster observations set lag times for merging at Northern Hemisphere sites; post-noon optical emissions set times of Southern Hemisphere merging. All-sky images and magnetohydrodynamic simulations indicate that merging occurs in multiple

  6. All-sky search for high-energy neutrinos from gravitational wave event GW170104 with the Antares neutrino telescope

    International Nuclear Information System (INIS)

    Albert, A.; Drouhin, D.; Racca, C.; Andre, M.; Anghinolfi, M.; Anton, G.; Eberl, T.; Graf, K.; Hallmann, S.; Hoessl, J.; Hofestaedt, J.; James, C.W.; Kalekin, O.; Katz, U.; Kiessling, D.; Lahmann, R.; Sieger, C.; Ardid, M.; Felis, I.; Martinez-Mora, J.A.; Saldana, M.; Aubert, J.J.; Bertin, V.; Brunner, J.; Busto, J.; Carr, J.; Costantini, H.; Coyle, P.; Dornic, D.; Enzenhoefer, A.; Quinn, L.; Salvadori, I.; Turpin, D.; Avgitas, T.; Baret, B.; Bourret, S.; Coelho, J.A.B.; Creusot, A.; Gregoire, T.; Gracia Ruiz, R.; Lachaud, C.; Barrios-Marti, J.; Hernandez-Rey, J.J.; Illuminati, G.; Lotze, M.; Toennis, C.; Zornoza, J.D.; Zuniga, J.; Basa, S.; Marcelin, M.; Nezri, E.; Belhorma, B.; Biagi, S.; Coniglione, R.; Distefano, C.; Piattelli, P.; Riccobene, G.; Sapienza, P.; Trovato, A.; Bormuth, R.; Jong, M. de; Samtleben, D.F.E.; Bouwhuis, M.C.; Heijboer, A.J.; Jongen, M.; Michael, T.; Branzas, H.; Caramete, L.; Pavalas, G.E.; Popa, V.; Bruijn, R.; Melis, K.; Capone, A.; Di Palma, I.; Perrina, C.; Vizzoca, A.; Celli, S.; Cherkaoui El Moursli, R.; El Khayati, N.; Ettahiri, A.; Fassi, F.; Tayalati, Y.; Chiarusi, T.; Circella, M.; Sanchez-Losa, A.; Coleiro, A.; Diaz, A.F.; Deschamps, A.; Hello, Y.; De Bonis, G.; Domi, A.; Hugon, C.; Sanguineti, M.; Taiuti, M.; Donzaud, C.; El Bojaddaini, I.; Moussa, A.; Elsaesser, D.; Kadler, M.; Kreter, M.; Fusco, L.A.; Margiotta, A.; Pellegrino, C.; Spurio, M.; Versari, F.; Gay, P.; Giordano, V.; Glotin, H.; Haren, H. van; Kouchner, A.; Van Elewyck, V.; Kreykenbohm, I.; Wilms, J.; Kulikovskiy, V.; Lefevre, D.; Leonora, E.; Loucatos, S.; Vallage, B.; Marinelli, A.; Mele, R.; Vivolo, D.; Migliozzi, P.; Navas, S.; Organokov, M.; Pradier, T.; Schuessler, F.; Stolarczyk, T.

    2017-01-01

    Advanced LIGO detected a significant gravitational wave signal (GW170104) originating from the coalescence of two black holes during the second observation run on January 4th, 2017. An all-sky high-energy neutrino follow-up search has been made using data from the Antares neutrino telescope, including both upgoing and downgoing events in two separate analyses. No neutrino candidates were found within ±500 s around the GW event time nor any time clustering of events over an extended time window of ±3 months. The non-detection is used to constrain isotropic-equivalent high-energy neutrino emission from GW170104 to less than ∝ 1.2 x 10 55 erg for a E -2 spectrum. This constraint is valid in the energy range corresponding to the 5-95% quantiles of the neutrino flux [3.2 TeV; 3.6 PeV], if the GW emitter was below the Antares horizon at the alert time. (orig.)

  7. First low-frequency Einstein@Home all-sky search for continuous gravitational waves in Advanced LIGO data

    Science.gov (United States)

    Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allen, G.; Allocca, A.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bawaj, M.; Bazzan, M.; Bécsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderón Bustillo, J.; Callister, T. A.; Calloni, E.; Camp, J. B.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerboni Baiardi, L.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chatterjee, D.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H.-P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Deelman, E.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Duncan, J.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Etienne, Z. B.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gabel, M.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garufi, F.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J.-M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, W.; Kim, W. S.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lo, R. K. L.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Lück, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña Hernandez, I.; Magaña-Sandoval, F.; Magaña Zertuche, L.; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markakis, C.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mayani, R.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Ng, K. K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Ramirez, K. E.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosińska, D.; Ross, M. P.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Rynge, M.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Taracchini, A.; Taylor, J. A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahi, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, M.; Wang, Y.-F.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Weßels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, K. W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; ZadroŻny, A.; Zanolin, M.; Zelenova, T.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.-H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S. J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; Anderson, D. P.; LIGO Scientific Collaboration; Virgo Collaboration

    2017-12-01

    We report results of a deep all-sky search for periodic gravitational waves from isolated neutron stars in data from the first Advanced LIGO observing run. This search investigates the low frequency range of Advanced LIGO data, between 20 and 100 Hz, much of which was not explored in initial LIGO. The search was made possible by the computing power provided by the volunteers of the Einstein@Home project. We find no significant signal candidate and set the most stringent upper limits to date on the amplitude of gravitational wave signals from the target population, corresponding to a sensitivity depth of 48.7 [1 /√{Hz }] . At the frequency of best strain sensitivity, near 100 Hz, we set 90% confidence upper limits of 1.8 ×1 0-25. At the low end of our frequency range, 20 Hz, we achieve upper limits of 3.9 ×1 0-24. At 55 Hz we can exclude sources with ellipticities greater than 1 0-5 within 100 pc of Earth with fiducial value of the principal moment of inertia of 1038 kg m2 .

  8. The All-Sky Automated Survey for Supernovae (ASAS-SN) Light Curve Server v1.0

    Science.gov (United States)

    Kochanek, C. S.; Shappee, B. J.; Stanek, K. Z.; Holoien, T. W.-S.; Thompson, Todd A.; Prieto, J. L.; Dong, Subo; Shields, J. V.; Will, D.; Britt, C.; Perzanowski, D.; Pojmański, G.

    2017-10-01

    The All-Sky Automated Survey for Supernovae (ASAS-SN) is working toward imaging the entire visible sky every night to a depth of V˜ 17 mag. The present data covers the sky and spans ˜2-5 years with ˜100-400 epochs of observation. The data should contain some ˜1 million variable sources, and the ultimate goal is to have a database of these observations publicly accessible. We describe here a first step, a simple but unprecedented web interface https://asas-sn.osu.edu/ that provides an up to date aperture photometry light curve for any user-selected sky coordinate. The V band photometry is obtained using a two-pixel (16.″0) radius aperture and is calibrated against the APASS catalog. Because the light curves are produced in real time, this web tool is relatively slow and can only be used for small samples of objects. However, it also imposes no selection bias on the part of the ASAS-SN team, allowing the user to obtain a light curve for any point on the celestial sphere. We present the tool, describe its capabilities, limitations, and known issues, and provide a few illustrative examples.

  9. Simultaneous observation of auroral substorm onset in Polar satellite global images and ground-based all-sky images

    Science.gov (United States)

    Ieda, Akimasa; Kauristie, Kirsti; Nishimura, Yukitoshi; Miyashita, Yukinaga; Frey, Harald U.; Juusola, Liisa; Whiter, Daniel; Nosé, Masahito; Fillingim, Matthew O.; Honary, Farideh; Rogers, Neil C.; Miyoshi, Yoshizumi; Miura, Tsubasa; Kawashima, Takahiro; Machida, Shinobu

    2018-05-01

    Substorm onset has originally been defined as a longitudinally extended sudden auroral brightening (Akasofu initial brightening: AIB) followed a few minutes later by an auroral poleward expansion in ground-based all-sky images (ASIs). In contrast, such clearly marked two-stage development has not been evident in satellite-based global images (GIs). Instead, substorm onsets have been identified as localized sudden brightenings that expand immediately poleward. To resolve these differences, optical substorm onset signatures in GIs and ASIs are compared in this study for a substorm that occurred on December 7, 1999. For this substorm, the Polar satellite ultraviolet global imager was operated with a fixed-filter (170 nm) mode, enabling a higher time resolution (37 s) than usual to resolve the possible two-stage development. These data were compared with 20-s resolution green-line (557.7 nm) ASIs at Muonio in Finland. The ASIs revealed the AIB at 2124:50 UT and the subsequent poleward expansion at 2127:50 UT, whereas the GIs revealed only an onset brightening that started at 2127:49 UT. Thus, the onset in the GIs was delayed relative to the AIB and in fact agreed with the poleward expansion in the ASIs. The fact that the AIB was not evident in the GIs may be attributed to the limited spatial resolution of GIs for thin auroral arc brightenings. The implications of these results for the definition of substorm onset are discussed herein.[Figure not available: see fulltext.

  10. All-sky LIGO search for periodic gravitational waves in the early fifth-science-run data.

    Science.gov (United States)

    Abbott, B P; Abbott, R; Adhikari, R; Ajith, P; Allen, B; Allen, G; Amin, R S; Anderson, S B; Anderson, W G; Arain, M A; Araya, M; Armandula, H; Armor, P; Aso, Y; Aston, S; Aufmuth, P; Aulbert, C; Babak, S; Baker, P; Ballmer, S; Bantilan, H; Barish, B C; Barker, C; Barker, D; Barr, B; Barriga, P; Barsotti, L; Barton, M A; Bartos, I; Bassiri, R; Bastarrika, M; Behnke, B; Benacquista, M; Betzwieser, J; Beyersdorf, P T; Bilenko, I A; Billingsley, G; Biswas, R; Black, E; Blackburn, J K; Blackburn, L; Blair, D; Bland, B; Bodiya, T P; Bogue, L; Bork, R; Boschi, V; Bose, S; Brady, P R; Braginsky, V B; Brau, J E; Brinkmann, M; Brooks, A F; Brown, D A; Brunet, G; Bullington, A; Buonanno, A; Burmeister, O; Byer, R L; Cadonati, L; Cagnoli, G; Camp, J B; Cannizzo, J; Cannon, K C; Cao, J; Cardenas, L; Cardoso, V; Caride, S; Casebolt, T; Castaldi, G; Caudill, S; Cavaglià, M; Cepeda, C; Chalkley, E; Charlton, P; Chatterji, S; Chelkowski, S; Chen, Y; Christensen, N; Clark, D; Clark, J; Clayton, J H; Cokelaer, T; Conte, R; Cook, D; Corbitt, T R C; Cornish, N; Coyne, D C; Creighton, J D E; Creighton, T D; Cruise, A M; Cumming, A; Cunningham, L; Cutler, R M; Danzmann, K; Daudert, B; Davies, G; Debra, D; Degallaix, J; Dergachev, V; Desai, S; Desalvo, R; Dhurandhar, S; Díaz, M; Dickson, J; Dietz, A; Donovan, F; Dooley, K L; Doomes, E E; Drever, R W P; Duke, I; Dumas, J-C; Dwyer, J; Echols, C; Edgar, M; Effler, A; Ehrens, P; Ely, G; Espinoza, E; Etzel, T; Evans, M; Evans, T; Fairhurst, S; Faltas, Y; Fan, Y; Fazi, D; Fejer, M M; Finn, L S; Flasch, K; Foley, S; Forrest, C; Fotopoulos, N; Franzen, A; Frei, Z; Freise, A; Frey, R; Fricke, T T; Fritschel, P; Frolov, V V; Fyffe, M; Garofoli, J A; Gholami, I; Giaime, J A; Giampanis, S; Giardina, K D; Goda, K; Goetz, E; Goggin, L M; González, G; Gossler, S; Gouaty, R; Grant, A; Gras, S; Gray, C; Gray, M; Greenhalgh, R J S; Gretarsson, A M; Grimaldi, F; Grosso, R; Grote, H; Grunewald, S; Guenther, M; Gustafson, E K; Gustafson, R; Hage, B; Hallam, J M; Hanna, C; Hanson, J; Harms, J; Harry, G M; Harstad, E D; Haughian, E; Hayama, K; Hayler, T; Heefner, J; Heng, I S; Heptonstall, A; Hewitson, M; Hild, S; Hirose, E; Hoak, D; Holt, K; Hosken, D; Hough, J; Huttner, S H; Ingram, D; Ito, M; Ivanov, A; Johnson, B; Johnson, W W; Jones, D I; Jones, G; Jones, R; Ju, L; Kalmus, P; Kalogera, V; Kamat, S; Kanner, J; Kasprzyk, D; Katsavounidis, E; Kawabe, K; Kawamura, S; Kawazoe, F; Kells, W; Keppel, D G; Khalaidovski, A; Khalili, F Ya; Khan, R; Khazanov, E; King, P; Kissel, J S; Klimenko, S; Kocsis, B; Kokeyama, K; Kondrashov, V; Kopparapu, R; Koranda, S; Kozak, D; Kozhevatov, I; Krishnan, B; Kwee, P; Landry, M; Lantz, B; Lazzarini, A; Lei, M; Leonor, I; Li, C; Lin, H; Lindquist, P E; Littenberg, T B; Lockerbie, N A; Lodhia, D; Lormand, M; Lu, P; Lubinski, M; Lucianetti, A; Lück, H; Machenschalk, B; Macinnis, M; Mageswaran, M; Mailand, K; Mandel, I; Mandic, V; Márka, S; Márka, Z; Markosyan, A; Markowitz, J; Maros, E; Martin, I W; Martin, R M; Marx, J N; Mason, K; Matichard, F; Matone, L; Matzner, R; Mavalvala, N; McCarthy, R; McClelland, D E; McGuire, S C; McHugh, M; McIntyre, G; McKechan, D; McKenzie, K; Mehmet, M; Melissinos, A; Mendell, G; Mercer, R A; Meshkov, S; Messenger, C J; Meyers, D; Miller, A; Miller, J; Minelli, J; Mitra, S; Mitrofanov, V P; Mitselmakher, G; Mittleman, R; Miyakawa, O; Moe, B; Mohanty, S D; Moreno, G; Mors, K; Mossavi, K; Mowlowry, C; Mueller, G; Muhammad, D; Mukherjee, S; Mukhopadhyay, H; Mullavey, A; Müller-Ebhardt, H; Munch, J; Murray, P G; Myers, E; Myers, J; Nash, T; Nelson, J; Newton, G; Nishizawa, A; Numata, K; Ochsner, E; O'Dell, J; Ogin, G; O'Reilly, B; O'Shaughnessy, R; Ottaway, D J; Ottens, R S; Overmier, H; Owen, B J; Pan, Y; Pankow, C; Papa, M A; Parameshwaraiah, V; Patel, P; Pedraza, M; Penn, S; Perraca, A; Petrie, T; Pinto, I M; Pitkin, M; Pletsch, H J; Plissi, M V; Postiglione, F; Principe, M; Prix, R; Quetschke, V; Raab, F J; Rabeling, D S; Radkins, H; Raffai, P; Rainer, N; Rakhmanov, M; Ramsunder, M; Reed, T; Rehbein, H; Reid, S; Reitze, D H; Riesen, R; Riles, K; Rivera, B; Robertson, N A; Robinson, C; Robinson, E L; Roddy, S; Rogan, A M; Rollins, J; Romano, J D; Romie, J H; Rowan, S; Rüdiger, A; Ruet, L; Russell, P; Ryan, K; Sakata, S; Sancho de la Jordana, L; Sandberg, V; Sannibale, V; Santamaria, L; Saraf, S; Sarin, P; Sathyaprakash, B S; Sato, S; Saulson, P R; Savage, R; Savov, P; Scanlan, M; Schediwy, S W; Schilling, R; Schnabel, R; Schofield, R; Schutz, B F; Schwinberg, P; Scott, J; Scott, S M; Searle, A C; Sears, B; Seifert, F; Sellers, D; Sengupta, A S; Sergeev, A; Shapiro, B; Shawhan, P; Shoemaker, D H; Sibley, A; Siemens, X; Sigg, D; Sinha, S; Sintes, A M; Slagmolen, B J J; Slutsky, J; Smith, J R; Smith, M R; Smith, N D; Somiya, K; Sorazu, B; Stein, L C; Strain, K A; Stuver, A; Summerscales, T Z; Sun, K-X; Sung, M; Sutton, P J; Takahashi, H; Tanner, D B; Taylor, R; Taylor, R; Thacker, J; Thorne, K A; Thorne, K S; Thüring, A; Tokmakov, K V; Torres, C; Torrie, C; Traylor, G; Trias, M; Ugolini, D; Urbanek, K; Vahlbruch, H; Van Den Broeck, C; van der Sluys, M V; van Veggel, A A; Vass, S; Vaulin, R; Vecchio, A; Veitch, J D; Veitch, P; Villar, A; Vorvick, C; Vyachanin, S P; Waldman, S J; Wallace, L; Ward, H; Ward, R L; Weinert, M; Weinstein, A J; Weiss, R; Wen, L; Wen, S; Wette, K; Whelan, J T; Whitcomb, S E; Whiting, B F; Wilkinson, C; Willems, P A; Williams, H R; Williams, L; Willke, B; Wilmut, I; Winkler, W; Wipf, C C; Wiseman, A G; Woan, G; Wooley, R; Worden, J; Wu, W; Yakushin, I; Yamamoto, H; Yan, Z; Yoshida, S; Zanolin, M; Zhang, J; Zhang, L; Zhao, C; Zotov, N; Zucker, M E; Zur Mühlen, H; Zweizig, J

    2009-03-20

    We report on an all-sky search with the LIGO detectors for periodic gravitational waves in the frequency range 50-1100 Hz and with the frequency's time derivative in the range -5 x 10{-9}-0 Hz s{-1}. Data from the first eight months of the fifth LIGO science run (S5) have been used in this search, which is based on a semicoherent method (PowerFlux) of summing strain power. Observing no evidence of periodic gravitational radiation, we report 95% confidence-level upper limits on radiation emitted by any unknown isolated rotating neutron stars within the search range. Strain limits below 10{-24} are obtained over a 200-Hz band, and the sensitivity improvement over previous searches increases the spatial volume sampled by an average factor of about 100 over the entire search band. For a neutron star with nominal equatorial ellipticity of 10{-6}, the search is sensitive to distances as great as 500 pc.

  11. All-sky search for high-energy neutrinos from gravitational wave event GW170104 with the Antares neutrino telescope

    Energy Technology Data Exchange (ETDEWEB)

    Albert, A.; Drouhin, D.; Racca, C. [Universite de Haute Alsace - Institut Universitaire de Technologie de Colmar, GRPHE, Colmar (France); Andre, M. [Technical University of Catalonia, Laboratory of Applied Bioacoustics, Vilanova i la Geltru, Barcelona (Spain); Anghinolfi, M. [INFN-Sezione di Genova, Genoa (Italy); Anton, G.; Eberl, T.; Graf, K.; Hallmann, S.; Hoessl, J.; Hofestaedt, J.; James, C.W.; Kalekin, O.; Katz, U.; Kiessling, D.; Lahmann, R.; Sieger, C. [Friedrich-Alexander-Universitaet Erlangen-Nuernberg, Erlangen Centre for Astroparticle Physics, Erlangen (Germany); Ardid, M.; Felis, I.; Martinez-Mora, J.A.; Saldana, M. [Universitat Politecnica de Valencia, Institut d' Investigacio per a la Gestio Integrada de les Zones Costaneres (IGIC), Gandia (Spain); Aubert, J.J.; Bertin, V.; Brunner, J.; Busto, J.; Carr, J.; Costantini, H.; Coyle, P.; Dornic, D.; Enzenhoefer, A.; Quinn, L.; Salvadori, I.; Turpin, D. [Aix Marseille Univ., CNRS/IN2P3, CPPM, Marseille (France); Avgitas, T.; Baret, B.; Bourret, S.; Coelho, J.A.B.; Creusot, A.; Gregoire, T.; Gracia Ruiz, R.; Lachaud, C. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (France); Barrios-Marti, J.; Hernandez-Rey, J.J.; Illuminati, G.; Lotze, M.; Toennis, C.; Zornoza, J.D.; Zuniga, J. [IFIC-Instituto de Fisica Corpuscular (CSIC-Universitat de Valencia), Paterna, Valencia (Spain); Basa, S.; Marcelin, M.; Nezri, E. [Pole de l' Etoile Site de Chateau-Gombert, LAM-Laboratoire d' Astrophysique de Marseille (France); Belhorma, B. [National Center for Energy Sciences and Nuclear Techniques, Rabat (Morocco); Biagi, S.; Coniglione, R.; Distefano, C.; Piattelli, P.; Riccobene, G.; Sapienza, P.; Trovato, A. [INFN-Laboratori Nazionali del Sud (LNS), Catania (Italy); Bormuth, R.; Jong, M. de; Samtleben, D.F.E. [Nikhef, Amsterdam (Netherlands); Universiteit Leiden, Huygens-Kamerlingh Onnes Laboratorium, Leiden (Netherlands); Bouwhuis, M.C.; Heijboer, A.J.; Jongen, M.; Michael, T. [Nikhef, Amsterdam (Netherlands); Branzas, H.; Caramete, L.; Pavalas, G.E.; Popa, V. [Institute for Space Science, Bucharest (Romania); Bruijn, R.; Melis, K. [Nikhef, Amsterdam (Netherlands); Universiteit van Amsterdam, Instituut voor Hoge-Energie Fysica, Amsterdam (Netherlands); Capone, A.; Di Palma, I.; Perrina, C.; Vizzoca, A. [INFN-Sezione di Roma, Rome (Italy); Dipartimento di Fisica dell' Universita La Sapienza, Rome (Italy); Celli, S. [INFN-Sezione di Roma, Rome (Italy); Dipartimento di Fisica dell' Universita La Sapienza, Rome (Italy); Gran Sasso Science Institute, L' Aquila (Italy); Cherkaoui El Moursli, R.; El Khayati, N.; Ettahiri, A.; Fassi, F.; Tayalati, Y. [University Mohammed V, Faculty of Sciences, Rabat (Morocco); Chiarusi, T. [INFN-Sezione di Bologna, Bologna (Italy); Circella, M.; Sanchez-Losa, A. [INFN-Sezione di Bari, Bari (Italy); Coleiro, A. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (France); IFIC-Instituto de Fisica Corpuscular (CSIC-Universitat de Valencia), Paterna, Valencia (Spain); Diaz, A.F. [University of Granada, Department of Computer Architecture and Technology/CITIC, Granada (Spain); Deschamps, A.; Hello, Y. [Geoazur, UCA, CNRS, IRD, Observatoire de la Cote d' Azur, Sophia Antipolis (France); De Bonis, G. [Dipartimento di Fisica dell' Universita La Sapienza, Rome (Italy); Domi, A.; Hugon, C.; Sanguineti, M.; Taiuti, M. [INFN-Sezione di Genova, Genoa (Italy); Dipartimento di Fisica dell' Universita, Genoa (Italy); Donzaud, C. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (France); Universite Paris-Sud, Orsay (France); El Bojaddaini, I.; Moussa, A. [University Mohammed I, Laboratory of Physics of Matter and Radiations, Oujda (Morocco); Elsaesser, D.; Kadler, M.; Kreter, M. [Institut fuer Theoretische Physik und Astrophysik, Universitaet Wuerzburg, Wuerzburg (Germany); Fusco, L.A.; Margiotta, A.; Pellegrino, C.; Spurio, M.; Versari, F. [INFN-Sezione di Bologna, Bologna (Italy); Dipartimento di Fisica e Astronomia dell' Universita, Bologna (Italy); Gay, P. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (France); Clermont Universite, Universite Blaise Pascal, Laboratoire de Physique Corpusculaire, CNRS/IN2P3, Clermont-Ferrand (France); Giordano, V. [INFN-Sezione di Catania, Catania (Italy); Glotin, H. [LSIS, Aix Marseille Universite CNRS ENSAM LSIS UMR 7296, Marseille (France); Universite de Toulon CNRS LSIS UMR 7296, La Garde (FR); Institut Universitaire de France, Paris (FR); Haren, H. van [Utrecht University, Royal Netherlands Institute for Sea Research (NIOZ), ' t Horntje (Texel) (NL); Kouchner, A.; Van Elewyck, V. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (FR); Institut Universitaire de France, Paris (FR); Kreykenbohm, I.; Wilms, J. [Universitaet Erlangen-Nuernberg, Dr. Remeis-Sternwarte and ECAP, Bamberg (DE); Kulikovskiy, V. [Aix Marseille Univ., CNRS/IN2P3, CPPM, Marseille (FR); Moscow State University, Skobeltsyn Institute of Nuclear Physics, Moscow (RU); Lefevre, D. [Aix-Marseille University, Mediterranean Institute of Oceanography (MIO), Marseille (FR); Universite du Sud Toulon-Var, CNRS-INSU/IRD UM 110, La Garde (FR); Leonora, E. [INFN-Sezione di Catania, Catania (IT); Dipartimento di Fisica e Astronomia dell' Universita, Catania (IT); Loucatos, S.; Vallage, B. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (FR); Direction des Sciences de la Matiere-Institut de Recherche sur les Lois Fondamentales de l' Univers-Service de Physique des Particules, CEA Saclay, Gif-sur-Yvette (FR); Marinelli, A. [INFN-Sezione di Pisa, Pisa (IT); Dipartimento di Fisica dell' Universita, Pisa (IT); Mele, R.; Vivolo, D. [INFN-Sezione di Napoli, Naples (IT); Dipartimento di Fisica dell' Universita Federico II di Napoli, Naples (IT); Migliozzi, P. [INFN-Sezione di Napoli, Naples (IT); Navas, S. [University of Granada, Dept. de Fisica Teorica y del Cosmos y C.A.F.P.E., Granada (ES); Organokov, M.; Pradier, T. [Universite de Strasbourg, CNRS, Strasbourg (FR); Schuessler, F.; Stolarczyk, T. [Direction des Sciences de la Matiere-Institut de Recherche sur les Lois Fondamentales de l' Univers-Service de Physique des Particules, CEA Saclay, Gif-sur-Yvette (FR); Collaboration: The ANTARES Collaboration

    2017-12-15

    Advanced LIGO detected a significant gravitational wave signal (GW170104) originating from the coalescence of two black holes during the second observation run on January 4th, 2017. An all-sky high-energy neutrino follow-up search has been made using data from the Antares neutrino telescope, including both upgoing and downgoing events in two separate analyses. No neutrino candidates were found within ±500 s around the GW event time nor any time clustering of events over an extended time window of ±3 months. The non-detection is used to constrain isotropic-equivalent high-energy neutrino emission from GW170104 to less than ∝ 1.2 x 10{sup 55} erg for a E{sup -2} spectrum. This constraint is valid in the energy range corresponding to the 5-95% quantiles of the neutrino flux [3.2 TeV; 3.6 PeV], if the GW emitter was below the Antares horizon at the alert time. (orig.)

  12. A catalogue of clusters of galaxies identified from all sky surveys of 2MASS, WISE, and SuperCOSMOS

    Science.gov (United States)

    Wen, Z. L.; Han, J. L.; Yang, F.

    2018-03-01

    We identify 47 600 clusters of galaxies from photometric data of Two Micron All Sky Survey (2MASS), Wide-field Infrared Survey Explorer (WISE), and SuperCOSMOS, among which 26 125 clusters are recognized for the first time and mostly in the sky outside the Sloan Digital Sky Survey (SDSS) area. About 90 per cent of massive clusters of M500 > 3 × 1014 M⊙ in the redshift range of 0.025 < z < 0.3 have been detected from such survey data, and the detection rate drops down to 50 per cent for clusters with a mass of M500 ˜ 1 × 1014 M⊙. Monte Carlo simulations show that the false detection rate for the whole cluster sample is less than 5 per cent. By cross-matching with ROSAT and XMM-Newton sources, we get 779 new X-ray cluster candidates which have X-ray counterparts within a projected offset of 0.2 Mpc.

  13. The role of the eROSITA all-sky survey in searches for sterile neutrino dark matter

    Energy Technology Data Exchange (ETDEWEB)

    Zandanel, Fabio; Weniger, Christoph; Ando, Shin' ichiro, E-mail: f.zandanel@uva.nl, E-mail: c.weniger@uva.nl, E-mail: s.ando@uva.nl [GRAPPA Institute, University of Amsterdam, 1098 XH Amsterdam (Netherlands)

    2015-09-01

    We investigate for the first time the potential of angular auto- and cross-correlation power spectra in identifying sterile neutrino dark matter in the cosmic X-ray background. We take as reference the performance of the soon-to-be-launched eROSITA satellite. The main astrophysical background sources against sterile neutrino decays are active galactic nuclei, galaxies powered by X-ray binaries, and clusters of galaxies. While sterile neutrino decays are always subdominant in the auto-correlation power spectra, they can be efficiently enhanced when cross-correlating with tracers of the dark matter distribution such as galaxies in the 2MASS catalogues. We show that the planned four-years eROSITA all-sky survey will provide a large enough photon statistics to potentially yield very stringent constraints on the decay lifetime, enabling to firmly test the recently claimed 3.56-keV X-ray line found towards several clusters and galaxies and its decaying dark matter interpretation. However, we also show that in order to fully exploit the potential of eROSITA for dark matter searches, it is vital to overcome the shot-noise limitations inherent to galaxy catalogues as tracers for the dark matter distribution.

  14. All-sky search for gravitational-wave bursts in the first joint LIGO-GEO-Virgo run

    International Nuclear Information System (INIS)

    Abadie, J.; Abbott, B. P.; Abbott, R.; Adhikari, R.; Ajith, P.; Anderson, S. B.; Araya, M.; Aso, Y.; Ballmer, S.; Betzwieser, J.; Billingsley, G.; Black, E.; Blackburn, J. K.; Bork, R.; Brooks, A. F.; Cannon, K. C.; Cardenas, L.; Cepeda, C.; Chalermsongsak, T.; Chatterji, S.

    2010-01-01

    We present results from an all-sky search for unmodeled gravitational-wave bursts in the data collected by the LIGO, GEO 600 and Virgo detectors between November 2006 and October 2007. The search is performed by three different analysis algorithms over the frequency band 50-6000 Hz. Data are analyzed for times with at least two of the four LIGO-Virgo detectors in coincident operation, with a total live time of 266 days. No events produced by the search algorithms survive the selection cuts. We set a frequentist upper limit on the rate of gravitational-wave bursts impinging on our network of detectors. When combined with the previous LIGO search of the data collected between November 2005 and November 2006, the upper limit on the rate of detectable gravitational-wave bursts in the 64-2048 Hz band is 2.0 events per year at 90% confidence. We also present event rate versus strength exclusion plots for several types of plausible burst waveforms. The sensitivity of the combined search is expressed in terms of the root-sum-squared strain amplitude for a variety of simulated waveforms and lies in the range 6x10 -22 Hz -1/2 to 2x10 -20 Hz -1/2 . This is the first untriggered burst search to use data from the LIGO and Virgo detectors together, and the most sensitive untriggered burst search performed so far.

  15. Intermittency of gravity wave momentum flux in the mesopause region observed with an all-sky airglow imager

    Science.gov (United States)

    Cao, Bing; Liu, Alan Z.

    2016-01-01

    The intermittency of gravity wave momentum flux (MF) near the OH airglow layer (˜87 km) in the mesopause region is investigated for the first time using observation of all-sky airglow imager over Maui, Hawaii (20.7°N, 156.3°W), and Cerro Pachón, Chile (30.3°S, 70.7°W). At both sites, the probability density function (pdf) of gravity wave MF shows two distinct distributions depending on the magnitude of the MF. For MF smaller (larger) than ˜16 m2 s-2 (0.091 mPa), the pdf follows a lognormal (power law) distribution. The intermittency represented by the Bernoulli proxy and the percentile ratio shows that gravity waves have higher intermittency at Maui than at Cerro Pachón, suggesting more intermittent background variation above Maui. It is found that most of the MF is contributed by waves that occur very infrequently. But waves that individually contribute little MF are also important because of their higher occurrence frequencies. The peak contribution is from waves with MF around ˜2.2 m2 s-2 at Cerro Pachón and ˜5.5 m2 s-2 at Maui. Seasonal variations of the pdf and intermittency imply that the background atmosphere has larger influence on the observed intermittency in the mesopause region.

  16. Cloud Screening and Quality Control Algorithm for Star Photometer Data: Assessment with Lidar Measurements and with All-sky Images

    Science.gov (United States)

    Ramirez, Daniel Perez; Lyamani, H.; Olmo, F. J.; Whiteman, D. N.; Navas-Guzman, F.; Alados-Arboledas, L.

    2012-01-01

    This paper presents the development and set up of a cloud screening and data quality control algorithm for a star photometer based on CCD camera as detector. These algorithms are necessary for passive remote sensing techniques to retrieve the columnar aerosol optical depth, delta Ae(lambda), and precipitable water vapor content, W, at nighttime. This cloud screening procedure consists of calculating moving averages of delta Ae() and W under different time-windows combined with a procedure for detecting outliers. Additionally, to avoid undesirable Ae(lambda) and W fluctuations caused by the atmospheric turbulence, the data are averaged on 30 min. The algorithm is applied to the star photometer deployed in the city of Granada (37.16 N, 3.60 W, 680 ma.s.l.; South-East of Spain) for the measurements acquired between March 2007 and September 2009. The algorithm is evaluated with correlative measurements registered by a lidar system and also with all-sky images obtained at the sunset and sunrise of the previous and following days. Promising results are obtained detecting cloud-affected data. Additionally, the cloud screening algorithm has been evaluated under different aerosol conditions including Saharan dust intrusion, biomass burning and pollution events.

  17. AMSR2 all-sky radiance assimilation and its impact on the analysis and forecast of Hurricane Sandy with a limited-area data assimilation system

    Directory of Open Access Journals (Sweden)

    Chun Yang

    2016-06-01

    Full Text Available A method to assimilate all-sky radiances from the Advanced Microwave Scanning Radiometer 2 (AMSR2 was developed within the Weather Research and Forecasting (WRF model's data assimilation (WRFDA system. The four essential elements are: (1 extending the community radiative transform model's (CRTM interface to include hydrometeor profiles; (2 using total water Qt as the moisture control variable; (3 using a warm-rain physics scheme for partitioning the Qt increment into individual increments of water vapour, cloud liquid water and rain; and (4 adopting a symmetric observation error model for all-sky radiance assimilation.Compared to a benchmark experiment with no AMSR2 data, the impact of assimilating clear-sky or all-sky AMSR2 radiances on the analysis and forecast of Hurricane Sandy (2012 was assessed through analysis/forecast cycling experiments using WRF and WRFDA's three-dimensional variational (3DVAR data assimilation scheme. With more cloud/precipitation-affected data being assimilated around tropical cyclone (TC core areas in the all-sky AMSR2 assimilation experiment, better analyses were obtained in terms of the TC's central sea level pressure (CSLP, warm-core structure and cloud distribution. Substantial (>20 % error reduction in track and CSLP forecasts was achieved from both clear-sky and all-sky AMSR2 assimilation experiments, and this improvement was consistent from the analysis time to 72-h forecasts. Moreover, the all-sky assimilation experiment consistently yielded better track and CSLP forecasts than the clear-sky did for all forecast lead times, due to a better analysis in the TC core areas. Positive forecast impact from assimilating AMSR2 radiances is also seen when verified against the European Center for Medium-Range Weather Forecasts (ECMWF analysis and the Stage IV precipitation analysis, with an overall larger positive impact from the all-sky assimilation experiment.

  18. Seasonal Variations of Mesospheric Gravity Waves Observed with an Airglow All-sky Camera at Mt. Bohyun, Korea (36° N

    Directory of Open Access Journals (Sweden)

    Yong Ha Kim

    2010-09-01

    Full Text Available We have carried out all-sky imaging of OH Meinel, O2 atmospheric and OI 557.7 nm airglow layers in the period from July of 2001 through September of 2005 at Mt. Bohyun, Korea (36.2° N, 128.9° E, Alt = 1,124 m. We analyzed the images observed during a total of 153 clear moonless nights and found 97 events of band-type waves. The characteristics of the observed waves (wavelengths, periods, and phase speeds are consistent with internal gravity waves. The wave occurrence shows an approximately semi-annual variation, with maxima near solstices and minima near equinoxes, which is consistent with other studies of airglow wave observations, but not with those of mesospheric radar/lidar observations. The observed waves tended to propagate westward during fall and winter, and eastward during spring and summer. Our ray tracing study of the observed waves shows that majority of the observed waves seemed to originate from mesospheric altitudes. The preferential directions and the apparent source altitudes can be explained if the observed waves are secondary waves generated from primary waves that have been selected by the filtering process and break up at the mesospheric altitudes.

  19. The 60 Month All-Sky Burst Alert Telescope Survey of Active Galactic Nucleus and the Anisotropy of Nearby AGNs

    Science.gov (United States)

    Ajello, M.; Alexander, D. M.; Greiner, J.; Madejeski, G. M.; Gehrels, N.; Burlon, D.

    2014-01-01

    Surveys above 10 keV represent one of the best resources to provide an unbiased census of the population of active galactic nuclei (AGNs). We present the results of 60 months of observation of the hard X-ray sky with Swift/Burst Alert Telescope (BAT). In this time frame, BAT-detected (in the 15-55 keV band) 720 sources in an all-sky survey of which 428 are associated with AGNs, most of which are nearby. Our sample has negligible incompleteness and statistics a factor of approx. 2 larger over similarly complete sets of AGNs. Our sample contains (at least) 15 bona fide Compton-thick AGNs and 3 likely candidates. Compton-thick AGNs represent approx. 5% of AGN samples detected above 15 keV. We use the BAT data set to refine the determination of the log N-log S of AGNs which is extremely important, now that NuSTAR prepares for launch, toward assessing the AGN contribution to the cosmic X-ray background. We show that the log N-log S of AGNs selected above 10 keV is now established to approx. 10% precision. We derive the luminosity function of Compton-thick AGNs and measure a space density of 7.9(+4.1/-2.9)× 10(exp -5)/cubic Mpc for objects with a de-absorbed luminosity larger than 2 × 10(exp 42) erg / s. As the BAT AGNs are all mostly local, they allow us to investigate the spatial distribution of AGNs in the nearby universe regardless of absorption. We find concentrations of AGNs that coincide spatially with the largest congregations of matter in the local (much < 85 Mpc) universe. There is some evidence that the fraction of Seyfert 2 objects is larger than average in the direction of these dense regions..

  20. Dust Abundance Variations in the Magellanic Clouds: Probing the Life-cycle of Metals with All-sky Surveys

    Science.gov (United States)

    Roman-Duval, Julia; Bot, Caroline; Chastenet, Jeremy; Gordon, Karl

    2017-06-01

    Observations and modeling suggest that dust abundance (gas-to-dust ratio, G/D) depends on (surface) density. Variations of the G/D provide timescale constraints for the different processes involved in the life cycle of metals in galaxies. Recent G/D measurements based on Herschel data suggest a factor of 5-10 decrease in dust abundance between the dense and diffuse interstellar media (ISM) in the Magellanic Clouds. However, the relative nature of the Herschel measurements precludes definitive conclusions as to the magnitude of those variations. We investigate variations of the dust abundance in the LMC and SMC using all-sky far-infrared surveys, which do not suffer from the limitations of Herschel on their zero-point calibration. We stack the dust spectral energy distribution (SED) at 100, 350, 550, and 850 microns from IRAS and Planck in intervals of gas surface density, model the stacked SEDs to derive the dust surface density, and constrain the relation between G/D and gas surface density in the range 10-100 M ⊙ pc-2 on ˜80 pc scales. We find that G/D decreases by factors of 3 (from 1500 to 500) in the LMC and 7 (from 1.5× {10}4 to 2000) in the SMC between the diffuse and dense ISM. The surface-density-dependence of G/D is consistent with elemental depletions, and with simple modeling of the accretion of gas-phase metals onto dust grains. This result has important implications for the sub-grid modeling of galaxy evolution, and for the calibration of dust-based gas-mass estimates, both locally and at high redshift.

  1. INFRARED SPECTRA AND PHOTOMETRY OF COMPLETE SAMPLES OF PALOMAR-GREEN AND TWO MICRON ALL SKY SURVEY QUASARS

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Yong [School of Astronomy and Space Science, Nanjing University, Nanjing 210093 (China); Rieke, G. H.; Su, K. Y. L. [Department of Astronomy And Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Ogle, P. M. [Infrared Processing and Analysis Center, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Balog, Z., E-mail: yshipku@gmail.com [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany)

    2014-10-01

    As a step toward a comprehensive overview of the infrared (IR) diagnostics of the central engines and host galaxies of quasars at low redshift, we present Spitzer Space Telescope spectroscopic (5-40 μm) and photometric (24, 70, and 160 μm) measurements of all Palomar-Green (PG) quasars at z < 0.5 and Two Micron All Sky Survey (2MASS) quasars at z < 0.3. We supplement these data with Herschel measurements at 160 μm. The sample is composed of 87 optically selected PG quasars and 52 near-IR-selected 2MASS quasars. Here we present the data, measure the prominent spectral features, and separate emission due to star formation from that emitted by the dusty circumnuclear torus. We find that the mid-IR (5-30 μm) spectral shape for the torus is largely independent of quasar IR luminosity with scatter in the spectral energy distribution (SED) shape of ≲0.2 dex. Except for the silicate features, no large difference is observed between PG (unobscured—silicate emission) and 2MASS (obscured—silicate absorption) quasars. Only mild silicate features are observed in both cases. When in emission, the peak wavelength of the silicate feature tends to be longer than 9.7 μm, possibly indicating effects on grain properties near the active galactic nucleus. The IR color is shown to correlate with the equivalent width of the aromatic features, indicating that the slope of the quasar mid- to far-IR SED is to first order driven by the fraction of radiation from star formation in the IR bands.

  2. The first all-sky view of the Milky Way stellar halo with Gaia+2MASS RR Lyrae

    Science.gov (United States)

    Iorio, G.; Belokurov, V.; Erkal, D.; Koposov, S. E.; Nipoti, C.; Fraternali, F.

    2018-02-01

    We exploit the first Gaia data release to study the properties of the Galactic stellar halo as traced by RR Lyrae. We demonstrate that it is possible to select a pure sample of RR Lyrae using only photometric information available in the Gaia+2MASS catalogue. The final sample contains about 21 600 RR Lyrae covering an unprecedented fraction ( ˜ 60 per cent) of the volume of the Galactic inner halo (R < 28 kpc). We study the morphology of the stellar halo by analysing the RR Lyrae distribution with parametric and non-parametric techniques. Taking advantage of the uniform all-sky coverage, we test halo models more sophisticated than usually considered in the literature, such as those with varying flattening, tilts and/or offset of the halo with respect to the Galactic disc. A consistent picture emerges: the inner halo is well reproduced by a smooth distribution of stars settled on triaxial density ellipsoids. The shortest axis is perpendicular to the Milky Way's disc, while the longest axis forms an angle of ˜70° with the axis connecting the Sun and the Galactic Centre. The elongation along the major axis is mild (p = 1.27), and the vertical flattening is shown to evolve from a squashed state with q ≈ 0.57 in the centre to a more spherical q ≈ 0.75 at the outer edge of our data set. Within the radial range probed, the density profile of the stellar halo is well approximated by a single power law with exponent α = -2.96. We do not find evidence of tilt or offset of the halo with respect to the Galaxy's disc.

  3. CONSTRUCTION OF A CALIBRATED PROBABILISTIC CLASSIFICATION CATALOG: APPLICATION TO 50k VARIABLE SOURCES IN THE ALL-SKY AUTOMATED SURVEY

    International Nuclear Information System (INIS)

    Richards, Joseph W.; Starr, Dan L.; Miller, Adam A.; Bloom, Joshua S.; Brink, Henrik; Crellin-Quick, Arien; Butler, Nathaniel R.

    2012-01-01

    With growing data volumes from synoptic surveys, astronomers necessarily must become more abstracted from the discovery and introspection processes. Given the scarcity of follow-up resources, there is a particularly sharp onus on the frameworks that replace these human roles to provide accurate and well-calibrated probabilistic classification catalogs. Such catalogs inform the subsequent follow-up, allowing consumers to optimize the selection of specific sources for further study and permitting rigorous treatment of classification purities and efficiencies for population studies. Here, we describe a process to produce a probabilistic classification catalog of variability with machine learning from a multi-epoch photometric survey. In addition to producing accurate classifications, we show how to estimate calibrated class probabilities and motivate the importance of probability calibration. We also introduce a methodology for feature-based anomaly detection, which allows discovery of objects in the survey that do not fit within the predefined class taxonomy. Finally, we apply these methods to sources observed by the All-Sky Automated Survey (ASAS), and release the Machine-learned ASAS Classification Catalog (MACC), a 28 class probabilistic classification catalog of 50,124 ASAS sources in the ASAS Catalog of Variable Stars. We estimate that MACC achieves a sub-20% classification error rate and demonstrate that the class posterior probabilities are reasonably calibrated. MACC classifications compare favorably to the classifications of several previous domain-specific ASAS papers and to the ASAS Catalog of Variable Stars, which had classified only 24% of those sources into one of 12 science classes.

  4. CONSTRUCTION OF A CALIBRATED PROBABILISTIC CLASSIFICATION CATALOG: APPLICATION TO 50k VARIABLE SOURCES IN THE ALL-SKY AUTOMATED SURVEY

    Energy Technology Data Exchange (ETDEWEB)

    Richards, Joseph W.; Starr, Dan L.; Miller, Adam A.; Bloom, Joshua S.; Brink, Henrik; Crellin-Quick, Arien [Astronomy Department, University of California, Berkeley, CA 94720-3411 (United States); Butler, Nathaniel R., E-mail: jwrichar@stat.berkeley.edu [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States)

    2012-12-15

    With growing data volumes from synoptic surveys, astronomers necessarily must become more abstracted from the discovery and introspection processes. Given the scarcity of follow-up resources, there is a particularly sharp onus on the frameworks that replace these human roles to provide accurate and well-calibrated probabilistic classification catalogs. Such catalogs inform the subsequent follow-up, allowing consumers to optimize the selection of specific sources for further study and permitting rigorous treatment of classification purities and efficiencies for population studies. Here, we describe a process to produce a probabilistic classification catalog of variability with machine learning from a multi-epoch photometric survey. In addition to producing accurate classifications, we show how to estimate calibrated class probabilities and motivate the importance of probability calibration. We also introduce a methodology for feature-based anomaly detection, which allows discovery of objects in the survey that do not fit within the predefined class taxonomy. Finally, we apply these methods to sources observed by the All-Sky Automated Survey (ASAS), and release the Machine-learned ASAS Classification Catalog (MACC), a 28 class probabilistic classification catalog of 50,124 ASAS sources in the ASAS Catalog of Variable Stars. We estimate that MACC achieves a sub-20% classification error rate and demonstrate that the class posterior probabilities are reasonably calibrated. MACC classifications compare favorably to the classifications of several previous domain-specific ASAS papers and to the ASAS Catalog of Variable Stars, which had classified only 24% of those sources into one of 12 science classes.

  5. SPIDERS: selection of spectroscopic targets using AGN candidates detected in all-sky X-ray surveys

    Science.gov (United States)

    Dwelly, T.; Salvato, M.; Merloni, A.; Brusa, M.; Buchner, J.; Anderson, S. F.; Boller, Th.; Brandt, W. N.; Budavári, T.; Clerc, N.; Coffey, D.; Del Moro, A.; Georgakakis, A.; Green, P. J.; Jin, C.; Menzel, M.-L.; Myers, A. D.; Nandra, K.; Nichol, R. C.; Ridl, J.; Schwope, A. D.; Simm, T.

    2017-07-01

    SPIDERS (SPectroscopic IDentification of eROSITA Sources) is a Sloan Digital Sky Survey IV (SDSS-IV) survey running in parallel to the Extended Baryon Oscillation Spectroscopic Survey (eBOSS) cosmology project. SPIDERS will obtain optical spectroscopy for large numbers of X-ray-selected active galactic nuclei (AGN) and galaxy cluster members detected in wide-area eROSITA, XMM-Newton and ROSAT surveys. We describe the methods used to choose spectroscopic targets for two sub-programmes of SPIDERS X-ray selected AGN candidates detected in the ROSAT All Sky and the XMM-Newton Slew surveys. We have exploited a Bayesian cross-matching algorithm, guided by priors based on mid-IR colour-magnitude information from the Wide-field Infrared Survey Explorer survey, to select the most probable optical counterpart to each X-ray detection. We empirically demonstrate the high fidelity of our counterpart selection method using a reference sample of bright well-localized X-ray sources collated from XMM-Newton, Chandra and Swift-XRT serendipitous catalogues, and also by examining blank-sky locations. We describe the down-selection steps which resulted in the final set of SPIDERS-AGN targets put forward for spectroscopy within the eBOSS/TDSS/SPIDERS survey, and present catalogues of these targets. We also present catalogues of ˜12 000 ROSAT and ˜1500 XMM-Newton Slew survey sources that have existing optical spectroscopy from SDSS-DR12, including the results of our visual inspections. On completion of the SPIDERS programme, we expect to have collected homogeneous spectroscopic redshift information over a footprint of ˜7500 deg2 for >85 per cent of the ROSAT and XMM-Newton Slew survey sources having optical counterparts in the magnitude range 17 < r < 22.5, producing a large and highly complete sample of bright X-ray-selected AGN suitable for statistical studies of AGN evolution and clustering.

  6. Temporal-spatial structure of magnetic merging at the magnetopause inferred from 557.7-nm all-sky images

    Directory of Open Access Journals (Sweden)

    N. C. Maynard

    2004-09-01

    Full Text Available We demonstrate that high-resolution 557.7-nm all-sky images are useful tools for investigating the spatial and temporal evolution of merging on the dayside magnetopause. Analysis of ground and satellite measurements leads us to conclude that high-latitude merging events can occur at multiple sites simultaneously and vary asynchronously on time scales of 30s to 3min. Variations of 557.7nm emissions were observed at a 10s cadence at Ny-Ålesund on 19 December 2001, while significant changes in the IMF clock angle were reaching the magnetopause. The optical patterns are consistent with a scenario in which merging occurs around the rim of the high-latitude cusp at positions dictated by the IMF clock angle. Electrons energized at merging sites represent plausible sources for 557.7nm emissions in the cusp. Polar observations at the magnetopause have directly linked enhanced fluxes of ≥0.5keV electrons with merging. Spectra of electrons responsible for some of the emissions, measured during a DMSP F15 overflight, exhibit "inverted-V" features, indicating further acceleration above the ionosphere. SuperDARN spectral width boundaries, characteristic of open-closed field line transitions, are located at the equatorward edge of the 557.7nm emissions. Optical data suggest that with IMF BY>0, the Northern Hemisphere cusp divides into three source regions. When the IMF clock angle was ~150° structured 557.7-nm emissions came from east of the 13:00 MLT meridian. At larger clock angles the emissions appeared between 12:00 and 13:00 MLT. No significant 557.7-nm emissions were detected in the prenoon MLT sector. MHD simulations corroborate our scenario, showing that with the observed large dipole-tilt and IMF clock angles, merging sites develop near the front and eastern portions of the high-altitude cusp rim in the Northern Hemisphere and near the western part of the cusp rim in the Southern Hemisphere.

  7. Results of the deepest all-sky survey for continuous gravitational waves on LIGO S6 data running on the Einstein@Home volunteer distributed computing project

    NARCIS (Netherlands)

    Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acemese, F.; Ackley, K.; Adams, C.; Phythian-Adams, A.T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwa, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allocca, A.; Altin, P. A.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Babak, S.; Bacon, P.; Bader, M. K. M.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Arker, Bd.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Bejger, M.; Be, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Birch, M.J.; Birney, R.; Biscans, S.; Bisht, A.; Bitoss, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Boer, M.; Bogaert, J.G.; Bogan, C.; Bohe, A.; Bond, C.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Boutfanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, A.D.; Brown, D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, O.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, C.; Cahillane, C.; Bustillo, J. Calderon; Callister, T. A.; Calloni, E.; Camp, J. B.; Cannon, K. C.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, D. S.; Charlton, P.; Chassande-Mottin, E.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y; Cheng, C.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, S. S. Y.; Chung, S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Cominsky, L.; Constancio, M., Jr.; Conte, A.; Conti, L.; Cook, D.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cumming, A.; Cunningham, Laura; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Darman, N. S.; Dasgupta, A.; Costa, C. F. Da Silva; Dattilo, V.; Dave, I.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; De, S.; DeBra, D.; Debreczeni, G.; Degallaix, J.; De laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.A.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devine, R. C.; Dhurandhar, S.; Diaz, M. C.; Di Fiore, L.; Giovanni, M. Di; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Virgilio, A.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Douglas, R.; Downes, T. P.; Drago, M.; Dreyer, R. W. P.; Driggers, J. C.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Egizenstein, H. -B.; Ehrens, P.; Eichholel, J.; Eikenberry, S. S.; Engels, W.; Essick, R. C.; Etzel, T.; Evans, M.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, O.; Fair, H.; Fairhurst, S.; Fan, X.; Fang, Q.; Farinon, S.; Farr, B.; Far, W. M.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Fenyvesi, E.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.M.; Fournier, J. -D.; Frasca, J. -D; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fritsche, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H. A. G.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garuti, F.; Gaur, G.; Gehrels, N.; Gemme, G.; Geng, P.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gi, K.; Glaetke, A.; Goetz, E.; Goetz, R.; Gondan, L.; Gonzalez, Idelmis G.; Castro, J. M. Gonzalez; Gopakumar, A.; Gordon, N. A.; Gorodetsky, M. L.; Gossan, S. E.; Lee-Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Graff, P. B.; Granata, M.; Granta, A.; Gras, S.; Cray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C. -J.; Haughian, K.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, S.; Hennig, J.; Henry, J.A.; Heptonsta, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Hough, J.; Houston, E. A.; Howel, E. J.; Hu, Y. M.; Huang, O.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J. -M.; Isi, M.; Isogai, T.; Lyer, B. R.; Fzumi, K.; Jaccimin, T.; Jang, D.H.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jian, L.; Jimenez-Forteza, F.; Johnson, W.; Jones, I.D.; Jones, R.; Jones, R.; Jonker, R. J. G.; Ju, L.; Wads, k; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Kapadia, S. J.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kefelian, F.; Keh, M. S.; Keite, D.; Kelley, D. B.; Kells, W.; Kennedy, R.E.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chi-Woong; Kim, Chunglee; Kim, J.; Kim, K.; Kim, Namjun; Kim, W.; Kimbre, S. J.; King, E. J.; King, P. J.; Kisse, J. S.; Klein, B.; Kleybolte, L.; Klimenko, S.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kringe, V.; Krishnan, B.; Krolak, A.; Krueger, C.; Kuehn, G.; Kumar, P.; Kumar, R.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lange, J.; Lantz, B.; Lasky, P. D.; Laxen, M.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C. H.; Lee, K.H.; Lee, M.H.; Lee, K.; Lenon, A.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Lewis, J. B.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Lockerbie, N. A.; Lombardi, A. L.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Liick, H.; Lundgren, A. P.; Lynch, R.; Ivia, Y.; Machenschalk, B.; Maclnnis, M.; Macleod, D. M.; Magafia-Sandoval, F.; Zertuche, L. Magafia; Magee, R. M.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandic, V.; Mangano, V.; Manse, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Marka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matiehard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mende, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Miche, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B.C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, S.D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Murphy, D. J.; Murray, P.G.; Mytidis, A.; Nardecehia, I.; Naticchioni, L.; Nayak, R. K.; Nedkova, K.; Nelemans, G.; Nelson, T. J. N.; Gutierrez-Neri, M.; Neunzert, A.; Newton, G.; Nguyen, T. T.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Hang, S.; Ohme, F.; Oliver, M.; Oppermann, P.; Ram, Richard J.; O'Reilly, B.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.S; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Patrick, Z.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perreca, A.; Perri, L. M.; Phelps, M.; Piccinni, . J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poe, M.; Poggiani, R.; Popolizio, P.; Post, A.; Powel, J.; Prasad, J.; Predoi, V.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, .; Punturo, M.; Purrer, PuppoM.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Reed, C. M.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romanov, G.; Romie, J. H.; Rowan, RosiliskaS.; Ruggi, RiidigerP.; Ryan, K.; Sachdev, Perminder S; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Saulson, P. R.; Sauter, E. S.; Savage, R. L.; Sawadsky, A.; Schale, P.; Schilling, R.; Schmidt, J; Schmidt, P.; Schnabe, R.; Schofield, R. M. S.; Schonbeck, A.; Schreiber, K.E.C.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, S. M.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Setyawati, Y.; Shaddock, D. A.; Shaffer, T. J.; Shahriar, M. S.; Shaltev, M.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Sielleez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, António Dias da; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, R. J. E.; Smith, N.D.; Smith, R. J. E.; Son, E. J.; Sorazus, B.; Sorrentino, F.; Souradeep, T.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strauss, N. A.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sunil, Suns; Sutton, P. J.; Swinkels, B. L.; Szczepariczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tapai, M.; Tarabrin, S. P.; Taracchini, A.; Taylor, W.R.; Theeg, T.; Thirugnanasambandam, M. P.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tomlinson, C.; Tonelli, M.; Tomasi, Z.; Torres, C. V.; Tome, C.; Tot, D.; Travasso, F.; Traylor, G.; Trifire, D.; Tringali, M. C.; Trozz, L.; Tse, M.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Valente, G.; Valdes, G.; van Bake, N.; Van Beuzekom, Martin; Van den Brand, J. F. J.; Van Den Broeck, C.F.F.; Vander-Hyde, D. C.; van der Schaaf, L.; Van Heilningen, J. V.; Van Vegge, A. A.; Vardaro, M.; Vass, S.; Vaslith, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P.J.; Venkateswara, K.; Verkindt, D.; Vetrano, F.; Vicere, A.; Vinciguerra, S.; Vine, D. J.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, MT; Walker, M.; Wallace, L.; Walsh, S.; Vvang, G.; Wang, O.; Wang, X.; Wiang, Y.; Ward, R. L.; Wiarner, J.; Was, M.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Weliels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Williams, D.R.; Williamson, A. R.; Willis, J. L.; WilIke, B.; Wimmer, M. H.; Whinkler, W.; Wipf, C. C.; De Witte, H.; Woan, G.; Woehler, J.; Worden, J.; Wright, J.L.; Wu, D. S.; Wu, G.; Yablon, J.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yu, H.; Yvert, M.; Zadrozny, A.; Zangrando, L.; Zanolin, M.; Zendri, J. P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S.J.; Zhu, X.; Zucker, M. E.; Zuraw, S. E.; Zweizig, J.

    2016-01-01

    We report results of a deep all-sky search for periodic gravitational waves from isolated neutron stars in data from the S6 LIGO science run. The search was possible thanks to the computing power provided by the volunteers of the Einstein@Home distributed computing project. We find no significant

  8. All-sky search for high-energy neutrinos from gravitational wave event GW170104 with the Antares neutrino telescope

    NARCIS (Netherlands)

    Albert, A.; André, M.; Anghinolfi, M.; Anton, G.; Ardid, M.; Aubert, J.-J.; Avgitas, T.; Baret, B.; Barrios-Martí, J.; Basa, S.; Belhorma, B.; Bertin, V.; Biagi, S.; Bormuth, R.; Bourret, S.; Bouwhuis, M.C.; Brânzas, H.; Bruijn, R.; Brunner, J.; Busto, J.; Capone, A.; Caramete, L.; Carr, J.; Celli, S.; Cherkaoui El Moursli, R.; Chiarusi, T.; Circella, M.; Coelho, J.A.B.; Coleiro, A.; Coniglione, R.; Costantini, H.; Coyle, P.; Creusot, A.; Díaz, A.F.; Deschamps, A.; De Bonis, G.; Distefano, C.; Di Palma, I.; Domi, A.; Donzaud, C.; Dornic, D.; Drouhin, D.; Eberl, T.; El Bojaddaini, I.; El Khayati, N.; Elsässer, D.; Enzenhöfer, A.; Ettahiri, A.; Fassi, F.; Felis, I.; Fusco, L.A.; Gay, P.; Giordano, V.; Glotin, H.; Grégoire, T.; Gracia-Ruiz, R.; Graf, K.; Hallmann, S.; van Haren, H.; Heijboer, A.J.; Hello, Y.; Hernandez-Rey, J.J.; Hößl, J.; Hofestädt, J.; Hugon, C.; Illuminati, G.; James, C.W.; de Jong, M.; Jongen, M.; Kadler, M.; Kalekin, O.; Katz, U.; Kießling, D.; Kouchner, A.; Kreter, M.; Kreykenbohm, I.; Kulikovskiy, V.; Lachaud, C.; Lahmann, R.; Lefèvre, D.; Leonora, E.; Lotze, M.; Loucatos, S.; Marcelin, M.; Margiotta, A.; Marinelli, A.; Martínez-Mora, J.A.; Mele, R.; Melis, K.; Michael, T.; Migliozzi, P.; Moussa, A.; Navas, S.; Nezri, E.; Organokov, M.; Pavalas, G.E.; Pellegrino, C.; Perrina, C.; Piattelli, P.; Popa, V.; Pradier, T.; Quinn, L.; Racca, C.; Riccobene, G.; Sánchez-Losa, A.; Saldaña, M.; Salvadori, I.; Samtleben, D.F.E.; Sanguineti, M.; Sapienza, P.; Schüssler, F.; Sieger, C.; Spurio, M.; Stolarczyk, Th.; Taiuti, M.; Tayalati, Y.; Trovato, A.; Turpin, D.; Tönnis, C.; Vallage, B.; Van Elewyck, V.; Versari, F.; Vivolo, D.; Vizzoca, A.; Wilms, J.; Zornoza, J.D.; Zúñiga, J.

    2017-01-01

    Advanced LIGO detected a significant gravitational wave signal (GW170104) originating from the coalescence of two black holes during the second observation run on January 4th, 2017. An all-sky high-energy neutrino follow-up search has been made using data from the Antares neutrino telescope,

  9. Planck early results. XIX. All-sky temperature and dust optical depth from Planck and IRAS. Constraints on the "dark gas" in our Galaxy

    DEFF Research Database (Denmark)

    Poutanen, T.; Natoli, P.; Polenta, G.

    2011-01-01

    An all sky map of the apparent temperature and optical depth of thermal dust emission is constructed using the Planck-HFI (350μm to 2 mm) andIRAS(100μm) data. The optical depth maps are correlated with tracers of the atomic (Hi) and molecular gas traced by CO. The correlation with the column dens...

  10. Dwarfs Cooler Than M: The Definition of Spectral Type L Using Discoveries from the 2-Micron All-Sky Survey (2MASS)

    Science.gov (United States)

    Kirkpatrick, J.; Reid, I.; Liebert, J.; Cutri, R.; Nelson, B.; Beichman, C.; Dahn, C.; Monet, D.; Gizis, J.; Skrutskie, M.

    1998-01-01

    Before the 2-Micron All-Sky Survey (2MASS) began, only six objects were known with spectral types later than M9.5 V. In the first 371 sq. deg. of actual 2MASS survey data, we have identified another twenty such objects spectroscopically confirmed using the Low Resolution Imaging Spectrograph (LRIS) at the W.M. Keck Observatory.

  11. Early warning for VHE gamma-ray flares with the ARGO-YBJ detector

    Energy Technology Data Exchange (ETDEWEB)

    Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others

    2011-12-11

    Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.

  12. THE PPMXL CATALOG OF POSITIONS AND PROPER MOTIONS ON THE ICRS. COMBINING USNO-B1.0 AND THE TWO MICRON ALL SKY SURVEY (2MASS)

    International Nuclear Information System (INIS)

    Roeser, S.; Demleitner, M.; Schilbach, E.

    2010-01-01

    USNO-B1.0 and the Two Micron All Sky Survey (2MASS) are the most widely used all-sky surveys. However, 2MASS has no proper motions at all, and USNO-B1.0 published only relative, not absolute (i.e., on the International Celestial Reference Frame (ICRS), proper motions. We performed a new determination of mean positions and proper motions on the ICRS system by combining USNO-B1.0 and 2MASS astrometry. This catalog is called PPMXL (VO access to the catalog is possible via http://vo.uni-hd.de/ppmxl), and it aims to be completed from the brightest stars down to about V ∼ 20 all sky. PPMXL contains about 900 million objects, some 410 million with 2MASS photometry, and is the largest collection of ICRS proper motions at present. As representative for the ICRS, we chose PPMX. The recently released UCAC3 could not be used because we found plate-dependent distortions in its proper motion system north of -20 0 declination. UCAC3 served as an intermediate system for δ ≤ -20 0 . The resulting typical individual mean errors of the proper motions range from 4 mas yr -1 to more than 10 mas yr -1 depending on observational history. The mean errors of positions at epoch 2000.0 are 80-120 mas, if 2MASS astrometry could be used, 150-300 mas else. We also give correction tables to convert USNO-B1.0 observations of, e.g., minor planets to the ICRS system.

  13. BANYAN. V. A SYSTEMATIC ALL-SKY SURVEY FOR NEW VERY LATE-TYPE LOW-MASS STARS AND BROWN DWARFS IN NEARBY YOUNG MOVING GROUPS

    Energy Technology Data Exchange (ETDEWEB)

    Gagné, Jonathan; Lafrenière, David; Doyon, René; Malo, Lison; Artigau, Étienne [Département de Physique, Université de Montréal, C.P. 6128 Succ. Centre-ville, Montréal, QC H3C 3J7 (Canada)

    2015-01-10

    We present the BANYAN All-Sky Survey (BASS) catalog, consisting of 228 new late-type (M4-L6) candidate members of nearby young moving groups (YMGs) with an expected false-positive rate of ∼13%. This sample includes 79 new candidate young brown dwarfs and 22 planetary-mass objects. These candidates were identified through the first systematic all-sky survey for late-type low-mass stars and brown dwarfs in YMGs. We cross-matched the Two Micron All Sky Survey and AllWISE catalogs outside of the galactic plane to build a sample of 98,970 potential ≥M5 dwarfs in the solar neighborhood and calculated their proper motions with typical precisions of 5-15 mas yr{sup –1}. We selected highly probable candidate members of several YMGs from this sample using the Bayesian Analysis for Nearby Young AssociatioNs II tool (BANYAN II). We used the most probable statistical distances inferred from BANYAN II to estimate the spectral type and mass of these candidate YMG members. We used this unique sample to show tentative signs of mass segregation in the AB Doradus moving group and the Tucana-Horologium and Columba associations. The BASS sample has already been successful in identifying several new young brown dwarfs in earlier publications, and will be of great interest in studying the initial mass function of YMGs and for the search of exoplanets by direct imaging; the input sample of potential close-by ≥M5 dwarfs will be useful to study the kinematics of low-mass stars and brown dwarfs and search for new proper motion pairs.

  14. On the influence of cloud fraction diurnal cycle and sub-grid cloud optical thickness variability on all-sky direct aerosol radiative forcing

    International Nuclear Information System (INIS)

    Min, Min; Zhang, Zhibo

    2014-01-01

    The objective of this study is to understand how cloud fraction diurnal cycle and sub-grid cloud optical thickness variability influence the all-sky direct aerosol radiative forcing (DARF). We focus on the southeast Atlantic region where transported smoke is often observed above low-level water clouds during burning seasons. We use the CALIOP observations to derive the optical properties of aerosols. We developed two diurnal cloud fraction variation models. One is based on sinusoidal fitting of MODIS observations from Terra and Aqua satellites. The other is based on high-temporal frequency diurnal cloud fraction observations from SEVIRI on board of geostationary satellite. Both models indicate a strong cloud fraction diurnal cycle over the southeast Atlantic region. Sensitivity studies indicate that using a constant cloud fraction corresponding to Aqua local equatorial crossing time (1:30 PM) generally leads to an underestimated (less positive) diurnal mean DARF even if solar diurnal variation is considered. Using cloud fraction corresponding to Terra local equatorial crossing time (10:30 AM) generally leads overestimation. The biases are a typically around 10–20%, but up to more than 50%. The influence of sub-grid cloud optical thickness variability on DARF is studied utilizing the cloud optical thickness histogram available in MODIS Level-3 daily data. Similar to previous studies, we found the above-cloud smoke in the southeast Atlantic region has a strong warming effect at the top of the atmosphere. However, because of the plane-parallel albedo bias the warming effect of above-cloud smoke could be significantly overestimated if the grid-mean, instead of the full histogram, of cloud optical thickness is used in the computation. This bias generally increases with increasing above-cloud aerosol optical thickness and sub-grid cloud optical thickness inhomogeneity. Our results suggest that the cloud diurnal cycle and sub-grid cloud variability are important factors

  15. Five years of Project META - An all-sky narrow-band radio search for extraterrestrial signals

    Science.gov (United States)

    Horowitz, Paul; Sagan, Carl

    1993-01-01

    We have conducted a five-year search of the northern sky (delta between 30 and 60 deg) for narrow-band radio signals near the 1420 MHz line of neutral hydrogen, and its second harmonic, using an 8.4 x 10 exp 6 channel Fourier spectrometer of 0.05 Hz resolution and 400 kHz instantaneous bandwidth. The observing frequency was corrected both for motions with respect to three astronomical inertial frames, and for the effect of Earth's rotation, which provides a characteristic changing Doppler signature for narrow-band signals of extraterrestrial origin. Among the 6 x 10 exp 13 spectral channels searched, we have found 37 candidate events exceeding the average detection threshold of 1.7 x 10 exp -23 W/sq m, none of which was detected upon reobservation. The strongest of these appear to be dominated by rare processor errors. However, the strongest signals that survive culling for terrestrial interference lie in or near the Galactic plane. We describe the search and candidate events, and set limits on the prevalence of supercivilizations transmitting Doppler-precompensated beacons at H I or its second harmonic. We conclude with recommendations for future searches, based upon these findings, and a description of our next-generation search system.

  16. The Fermi All-Sky Variability Analysis: A List of Flaring Gamma-Ray Sources and the Search for Transients in our Galaxy

    Science.gov (United States)

    Ackermann, M.; Ajello, M.; Albert, A.; Allafort, A.; Antolini, E.; Baldini, L.; Ballet, J.; Barbiellini, G; Bastieri, D.; Bechtol, K.; hide

    2013-01-01

    In this paper, we present the Fermi All-sky Variability Analysis (FAVA), a tool to systematically study the variability of the gamma-ray sky measured by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope.For each direction on the sky, FAVA compares the number of gamma-rays observed in a given time window to the number of gamma-rays expected for the average emission detected from that direction. This method is used in weekly time intervals to derive a list of 215 flaring gamma-ray sources. We proceed to discuss the 27 sources found at Galactic latitudes smaller than 10 and show that, despite their low latitudes, most of them are likely of extragalactic origin.

  17. THE FERMI ALL-SKY VARIABILITY ANALYSIS: A LIST OF FLARING GAMMA-RAY SOURCES AND THE SEARCH FOR TRANSIENTS IN OUR GALAXY

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M. [Deutsches Elektronen Synchrotron DESY, D-15738 Zeuthen (Germany); Ajello, M. [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720-7450 (United States); Albert, A. [Department of Physics, Center for Cosmology and Astro-Particle Physics, The Ohio State University, Columbus, OH 43210 (United States); Allafort, A.; Bechtol, K.; Blandford, R. D.; Bloom, E. D.; Bottacini, E. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Antolini, E.; Bonamente, E. [Dipartimento di Fisica, Universita degli Studi di Perugia, I-06123 Perugia (Italy); Baldini, L. [Universita di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Universite Paris Diderot, Service d' Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Bastieri, D. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Bellazzini, R.; Bregeon, J. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bouvier, A. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Brandt, T. J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Brigida, M. [Dipartimento di Fisica ' ' M. Merlin' ' dell' Universita e del Politecnico di Bari, I-70126 Bari (Italy); Bruel, P., E-mail: majello@slac.stanford.edu, E-mail: allafort@stanford.edu, E-mail: rolf.buehler@desy.de [Laboratoire Leprince-Ringuet, Ecole polytechnique, CNRS/IN2P3, Palaiseau (France); and others

    2013-07-01

    In this paper, we present the Fermi All-sky Variability Analysis (FAVA), a tool to systematically study the variability of the gamma-ray sky measured by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. For each direction on the sky, FAVA compares the number of gamma-rays observed in a given time window to the number of gamma-rays expected for the average emission detected from that direction. This method is used in weekly time intervals to derive a list of 215 flaring gamma-ray sources. We proceed to discuss the 27 sources found at Galactic latitudes smaller than 10 Degree-Sign and show that, despite their low latitudes, most of them are likely of extragalactic origin.

  18. PROBING THE DARK AGES AT z ∼ 20: THE SCI-HI 21 cm ALL-SKY SPECTRUM EXPERIMENT

    Energy Technology Data Exchange (ETDEWEB)

    Voytek, Tabitha C.; Natarajan, Aravind; Peterson, Jeffrey B. [McWilliams Center for Cosmology, Department of Physics, Carnegie Mellon University, 5000 Forbes Ave., Pittsburgh, PA 15213 (United States); Jáuregui García, José Miguel; López-Cruz, Omar, E-mail: tcv@andrew.cmu.edu [Instituto Nacional de Astrofísica, Optica y Electrónica (INAOE), Coordinación de Astrofísica, Luis Enrique Erro No. 1 Sta. Ma. Tonantzintla, Puebla, 72840 Mexico (Mexico)

    2014-02-10

    We present first results from the SCI-HI experiment, which we used to measure the all-sky-averaged 21 cm brightness temperature in the redshift range 14.8 < z < 22.7. The instrument consists of a single broadband sub-wavelength size antenna and a sampling system for real-time data processing and recording. Preliminary observations were completed in 2013 June at Isla Guadalupe, a Mexican biosphere reserve located in the Pacific Ocean. The data was cleaned to excise channels contaminated by radio frequency interference, and the system response was calibrated by comparing the measured brightness temperature to the Global Sky Model of the Galaxy and by independent measurement of Johnson noise from a calibration terminator. We present our results, discuss the cosmological implications, and describe plans for future work.

  19. THE FERMI ALL-SKY VARIABILITY ANALYSIS: A LIST OF FLARING GAMMA-RAY SOURCES AND THE SEARCH FOR TRANSIENTS IN OUR GALAXY

    International Nuclear Information System (INIS)

    Ackermann, M.; Ajello, M.; Albert, A.; Allafort, A.; Bechtol, K.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Antolini, E.; Bonamente, E.; Baldini, L.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bellazzini, R.; Bregeon, J.; Bouvier, A.; Brandt, T. J.; Brigida, M.; Bruel, P.

    2013-01-01

    In this paper, we present the Fermi All-sky Variability Analysis (FAVA), a tool to systematically study the variability of the gamma-ray sky measured by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. For each direction on the sky, FAVA compares the number of gamma-rays observed in a given time window to the number of gamma-rays expected for the average emission detected from that direction. This method is used in weekly time intervals to derive a list of 215 flaring gamma-ray sources. We proceed to discuss the 27 sources found at Galactic latitudes smaller than 10° and show that, despite their low latitudes, most of them are likely of extragalactic origin.

  20. First Study on the Occurrence Frequency of Equatorial Plasma Bubbles over West Africa Using an All-Sky Airglow Imager and GNSS Receivers

    Science.gov (United States)

    Okoh, Daniel; Rabiu, Babatunde; Shiokawa, Kazuo; Otsuka, Yuichi; Segun, Bolaji; Falayi, Elijah; Onwuneme, Sylvester; Kaka, Rafiat

    2017-12-01

    This is the first paper that reports the occurrence frequency of equatorial plasma bubbles and their dependences of local time, season, and geomagnetic activity based on airglow imaging observations at West Africa. The all-sky imager, situated in Abuja (Geographic: 8.99°N, 7.38°E; Geomagnetic: 1.60°S), has a 180° fisheye view covering almost the entire airspace of Nigeria. Plasma bubbles are observed for 70 nights of the 147 clear-sky nights from 9 June 2015 to 31 January 2017. Differences between nighttime and daytime ROTIs were also computed as a proxy of plasma bubbles using Global Navigation Satellite Systems (GNSS) receivers within the coverage of the all-sky imager. Most plasma bubble occurrences are found during equinoxes and least occurrences during solstices. The occurrence rate of plasma bubbles was highest around local midnight and lower for hours farther away. Most of the postmidnight plasma bubbles were observed around the months of December to March, a period that coincides with the harmattan period in Nigeria. The on/off status of plasma bubble in airglow and GNSS observations were in agreement for 67.2% of the total 768 h, while we suggest several reasons responsible for the remaining 32.8% when the airglow and GNSS bubble status are inconsistent. A majority of the plasma bubbles were observed under relatively quiet geomagnetic conditions (Dst ≥ -40 and Kp ≤ 3), but there was no significant pattern observed in the occurrence rate of plasma bubbles as a function of geomagnetic activity. We suggest that geomagnetic activities could have either suppressed or promoted the occurrence of plasma bubbles.

  1. A-Train Aerosol Observations Preliminary Comparisons with AeroCom Models and Pathways to Observationally Based All-Sky Estimates

    Science.gov (United States)

    Redemann, J.; Livingston, J.; Shinozuka, Y.; Kacenelenbogen, M.; Russell, P.; LeBlanc, S.; Vaughan, M.; Ferrare, R.; Hostetler, C.; Rogers, R.; hide

    2014-01-01

    We have developed a technique for combining CALIOP aerosol backscatter, MODIS spectral AOD (aerosol optical depth), and OMI AAOD (absorption aerosol optical depth) retrievals for the purpose of estimating full spectral sets of aerosol radiative properties, and ultimately for calculating the 3-D distribution of direct aerosol radiative forcing. We present results using one year of data collected in 2007 and show comparisons of the aerosol radiative property estimates to collocated AERONET retrievals. Use of the recently released MODIS Collection 6 data for aerosol optical depths derived with the dark target and deep blue algorithms has extended the coverage of the multi-sensor estimates towards higher latitudes. We compare the spatio-temporal distribution of our multi-sensor aerosol retrievals and calculations of seasonal clear-sky aerosol radiative forcing based on the aerosol retrievals to values derived from four models that participated in the latest AeroCom model intercomparison initiative. We find significant inter-model differences, in particular for the aerosol single scattering albedo, which can be evaluated using the multi-sensor A-Train retrievals. We discuss the major challenges that exist in extending our clear-sky results to all-sky conditions. On the basis of comparisons to suborbital measurements, we present some of the limitations of the MODIS and CALIOP retrievals in the presence of adjacent or underlying clouds. Strategies for meeting these challenges are discussed.

  2. VizieR Online Data Catalog: Wisconsin soft X-ray diffuse background all-sky Survey (McCammon+ 1983)

    Science.gov (United States)

    McCammon, D.; Burrows, D. N.; Sanders, W. T.; Kraushaar, W. L.

    1997-10-01

    The catalog contains all-sky survey of the soft X-ray diffuse background and the count-rate data from which the maps were made for the ten flights included in the survey. It contains 40 files in the machine-readable version and includes documentation and utility subroutines. The data files contain different band maps (B, C, M, M1, M2, I, J, 2-6 keV) in a 0 degree-centered Aitoff projection, in a 180-degree-centered Aitoff projection, in a north polar projection, and in a south polar projection. Lookup tables in the form of FITS images are provided for conversion between pixel coordinates and Galactic coordinates for the various projections. The bands are: B = 130-188eV C = 160-284eV M1 = 440-930eV M2 = 600-1100eV I = 770-1500eV J = 1100-2200eV 2-6keV = 1800-6300eV (51 data files).

  3. AN EXTENDED AND MORE SENSITIVE SEARCH FOR PERIODICITIES IN ROSSI X-RAY TIMING EXPLORER/ALL-SKY MONITOR X-RAY LIGHT CURVES

    International Nuclear Information System (INIS)

    Levine, Alan M.; Bradt, Hale V.; Chakrabarty, Deepto; Corbet, Robin H. D.; Harris, Robert J.

    2011-01-01

    We present the results of a systematic search in ∼14 years of Rossi X-ray Timing Explorer All-Sky Monitor (ASM) data for evidence of periodicities. Two variations of the commonly used Fourier analysis search method have been employed to significantly improve upon the sensitivity achieved by Wen et al. in 2006, who also searched for periodicities in ASM data. In addition, the present search is comprehensive in terms of sources studied and frequency range covered, and has yielded the detection of the signatures of the orbital periods of eight low-mass X-ray binary systems and of ten high-mass X-ray binaries not listed in the tables of Wen et al. Orbital periods, epochs, signal amplitudes, modulation fractions, and folded light curves are given for each of these systems. Seven of the orbital periods are the most precise reported to date. In the course of this work, the 18.545 day orbital period of IGR J18483-0311 was co-discovered, and the first detections in X-rays were made of the ∼3.9 day orbital period of LMC X-1 and the ∼3.79 hr orbital period of 4U 1636-536. The results inform future searches for orbital and other periodicities in X-ray binaries.

  4. Direct Aerosol Radiative Forcing from Combined A-Train Observations - Preliminary Comparisons with AeroCom Models and Pathways to Observationally Based All-sky Estimates

    Science.gov (United States)

    Redemann, J.; Livingston, J. M.; Shinozuka, Y.; Kacenelenbogen, M. S.; Russell, P. B.; LeBlanc, S. E.; Vaughan, M.; Ferrare, R. A.; Hostetler, C. A.; Rogers, R. R.; Burton, S. P.; Torres, O.; Remer, L. A.; Stier, P.; Schutgens, N.

    2014-12-01

    We describe a technique for combining CALIOP aerosol backscatter, MODIS spectral AOD (aerosol optical depth), and OMI AAOD (absorption aerosol optical depth) retrievals for the purpose of estimating full spectral sets of aerosol radiative properties, and ultimately for calculating the 3-D distribution of direct aerosol radiative forcing. We present results using one year of data collected in 2007 and show comparisons of the aerosol radiative property estimates to collocated AERONET retrievals. Use of the recently released MODIS Collection 6 data for aerosol optical depths derived with the dark target and deep blue algorithms has extended the coverage of the multi-sensor estimates towards higher latitudes. Initial calculations of seasonal clear-sky aerosol radiative forcing based on our multi-sensor aerosol retrievals compare well with over-ocean and top of the atmosphere IPCC-2007 model-based results, and with more recent assessments in the "Climate Change Science Program Report: Atmospheric Aerosol Properties and Climate Impacts" (2009). For the first time, we present comparisons of our multi-sensor aerosol direct radiative forcing estimates to values derived from a subset of models that participated in the latest AeroCom initiative. We discuss the major challenges that exist in extending our clear-sky results to all-sky conditions. On the basis of comparisons to suborbital measurements, we present some of the limitations of the MODIS and CALIOP retrievals in the presence of adjacent or underlying clouds. Strategies for meeting these challenges are discussed.

  5. The All Sky Automated Survey. The Catalog of Bright Variable Stars in the I-band, South of Declination +28o

    Science.gov (United States)

    Sitek, M.; Pojmański, G.

    2014-06-01

    This paper presents the results of our extensive search for the bright variable stars in approximately 30 000 square degrees of the south sky in the I-band data collected by 9o×9o camera of the All Sky Automated Survey between 2002 and 2009. Lists of over 27 000 variable stars brighter than 9 mag at maximum light, with amplitudes ranging from 0.02 mag to 7 mag and variability time-scales from hours to years, as well as corresponding light curves are provided. Automated classification algorithm based on stellar properties (period, Fourier coefficients, 2MASS J, H, K, colors, ASAS V-band data) was used to roughly classify objects. Despite low spatial resolution of the ASAS data (≍15'') we cross-identified all objects with other available data sources. Coordinates of the most probable 2MASS counterparts are provided. 27 705 stars brighter than I=9 mag were found to be variable, of which 7842 objects were detected to be variable for the first time. Brief statistics and discussion of the presented data is provided. All the photometric data is available over the Internet at http://www.astrouw.edu.pl/ gp/asas/AsasBrightI.html

  6. Ground-based search for the brightest transiting planets with the Multi-site All-Sky CAmeRA: MASCARA

    Science.gov (United States)

    Snellen, Ignas A. G.; Stuik, Remko; Navarro, Ramon; Bettonvil, Felix; Kenworthy, Matthew; de Mooij, Ernst; Otten, Gilles; ter Horst, Rik; le Poole, Rudolf

    2012-09-01

    The Multi-site All-sky CAmeRA MASCARA is an instrument concept consisting of several stations across the globe, with each station containing a battery of low-cost cameras to monitor the near-entire sky at each location. Once all stations have been installed, MASCARA will be able to provide a nearly 24-hr coverage of the complete dark sky, down to magnitude 8, at sub-minute cadence. Its purpose is to find the brightest transiting exoplanet systems, expected in the V=4-8 magnitude range - currently not probed by space- or ground-based surveys. The bright/nearby transiting planet systems, which MASCARA will discover, will be the key targets for detailed planet atmosphere observations. We present studies on the initial design of a MASCARA station, including the camera housing, domes, and computer equipment, and on the photometric stability of low-cost cameras showing that a precision of 0.3-1% per hour can be readily achieved. We plan to roll out the first MASCARA station before the end of 2013. A 5-station MASCARA can within two years discover up to a dozen of the brightest transiting planet systems in the sky.

  7. Candidate isolated neutron stars and other optically blank x-ray fields identified from the rosat all-sky and sloan digital sky surveys

    Energy Technology Data Exchange (ETDEWEB)

    Agueros, Marcel A.; Anderson, Scott F.; /Washington U., Seattle, Astron. Dept.; Margon, Bruce; /Baltimore, Space Telescope Sci.; Haberl, Frank; Voges, Wolfgang; /Garching,; Annis, James; /Fermilab; Schneider, Donald P.; /Penn State U., Astron. Astrophys.; Brinkmann, Jonathan; /Apache Point Observ.

    2005-11-01

    Only seven radio-quiet isolated neutron stars (INSs) emitting thermal X rays are known, a sample that has yet to definitively address such fundamental issues as the equation of state of degenerate neutron matter. We describe a selection algorithm based on a cross-correlation of the ROSAT All-Sky Survey (RASS) and the Sloan Digital Sky Survey (SDSS) that identifies X-ray error circles devoid of plausible optical counterparts to the SDSS g {approx} 22 magnitudes limit. We quantitatively characterize these error circles as optically blank; they may host INSs or other similarly exotic X-ray sources such as radio-quiet BL Lacs, obscured AGN, etc. Our search is an order of magnitude more selective than previous searches for optically blank RASS error circles, and excludes the 99.9% of error circles that contain more common X-ray-emitting subclasses. We find 11 candidates, nine of which are new. While our search is designed to find the best INS candidates and not to produce a complete list of INSs in the RASS, it is reassuring that our number of candidates is consistent with predictions from INS population models. Further X-ray observations will obtain pinpoint positions and determine whether these sources are entirely optically blank at g {approx} 22, supporting the presence of likely isolated neutron stars and perhaps enabling detailed follow-up studies of neutron star physics.

  8. Single-footprint retrievals for AIRS using a fast TwoSlab cloud-representation model and the SARTA all-sky infrared radiative transfer algorithm

    Science.gov (United States)

    DeSouza-Machado, Sergio; Larrabee Strow, L.; Tangborn, Andrew; Huang, Xianglei; Chen, Xiuhong; Liu, Xu; Wu, Wan; Yang, Qiguang

    2018-01-01

    One-dimensional variational retrievals of temperature and moisture fields from hyperspectral infrared (IR) satellite sounders use cloud-cleared radiances (CCRs) as their observation. These derived observations allow the use of clear-sky-only radiative transfer in the inversion for geophysical variables but at reduced spatial resolution compared to the native sounder observations. Cloud clearing can introduce various errors, although scenes with large errors can be identified and ignored. Information content studies show that, when using multilayer cloud liquid and ice profiles in infrared hyperspectral radiative transfer codes, there are typically only 2-4 degrees of freedom (DOFs) of cloud signal. This implies a simplified cloud representation is sufficient for some applications which need accurate radiative transfer. Here we describe a single-footprint retrieval approach for clear and cloudy conditions, which uses the thermodynamic and cloud fields from numerical weather prediction (NWP) models as a first guess, together with a simple cloud-representation model coupled to a fast scattering radiative transfer algorithm (RTA). The NWP model thermodynamic and cloud profiles are first co-located to the observations, after which the N-level cloud profiles are converted to two slab clouds (TwoSlab; typically one for ice and one for water clouds). From these, one run of our fast cloud-representation model allows an improvement of the a priori cloud state by comparing the observed and model-simulated radiances in the thermal window channels. The retrieval yield is over 90 %, while the degrees of freedom correlate with the observed window channel brightness temperature (BT) which itself depends on the cloud optical depth. The cloud-representation and scattering package is benchmarked against radiances computed using a maximum random overlap (RMO) cloud scheme. All-sky infrared radiances measured by NASA's Atmospheric Infrared Sounder (AIRS) and NWP thermodynamic and cloud

  9. Single-footprint retrievals for AIRS using a fast TwoSlab cloud-representation model and the SARTA all-sky infrared radiative transfer algorithm

    Directory of Open Access Journals (Sweden)

    S. DeSouza-Machado

    2018-01-01

    Full Text Available One-dimensional variational retrievals of temperature and moisture fields from hyperspectral infrared (IR satellite sounders use cloud-cleared radiances (CCRs as their observation. These derived observations allow the use of clear-sky-only radiative transfer in the inversion for geophysical variables but at reduced spatial resolution compared to the native sounder observations. Cloud clearing can introduce various errors, although scenes with large errors can be identified and ignored. Information content studies show that, when using multilayer cloud liquid and ice profiles in infrared hyperspectral radiative transfer codes, there are typically only 2–4 degrees of freedom (DOFs of cloud signal. This implies a simplified cloud representation is sufficient for some applications which need accurate radiative transfer. Here we describe a single-footprint retrieval approach for clear and cloudy conditions, which uses the thermodynamic and cloud fields from numerical weather prediction (NWP models as a first guess, together with a simple cloud-representation model coupled to a fast scattering radiative transfer algorithm (RTA. The NWP model thermodynamic and cloud profiles are first co-located to the observations, after which the N-level cloud profiles are converted to two slab clouds (TwoSlab; typically one for ice and one for water clouds. From these, one run of our fast cloud-representation model allows an improvement of the a priori cloud state by comparing the observed and model-simulated radiances in the thermal window channels. The retrieval yield is over 90 %, while the degrees of freedom correlate with the observed window channel brightness temperature (BT which itself depends on the cloud optical depth. The cloud-representation and scattering package is benchmarked against radiances computed using a maximum random overlap (RMO cloud scheme. All-sky infrared radiances measured by NASA's Atmospheric Infrared Sounder (AIRS and NWP

  10. Anthropogenic changes in the surface all-sky UV-B radiation through 1850-2005 simulated by an Earth system model

    Science.gov (United States)

    Watanabe, S.; Takemura, T.; Sudo, K.; Yokohata, T.; Kawase, H.

    2012-06-01

    The historical anthropogenic change in the surface all-sky UV-B (solar ultraviolet: 280-315 nm) radiation through 1850-2005 is evaluated using an Earth system model. Responses of UV-B dose to anthropogenic changes in ozone and aerosols are separately evaluated using a series of historical simulations including/excluding these changes. Increases in these air pollutants cause reductions in UV-B transmittance, which occur gradually/rapidly before/after 1950 in and downwind of industrial and deforestation regions. Furthermore, changes in ozone transport in the lower stratosphere, which is induced by increasing greenhouse gas concentrations, increase ozone concentration in the extratropical upper troposphere and lower stratosphere. These transient changes work to decrease the amount of UV-B reaching the Earth's surface, counteracting the well-known effect increasing UV-B due to stratospheric ozone depletion, which developed rapidly after ca. 1980. As a consequence, the surface UV-B radiation change between 1850 and 2000 is negative in the tropics and NH extratropics and positive in the SH extratropics. Comparing the contributions of ozone and aerosol changes to the UV-B change, the transient change in ozone absorption of UV-B mainly determines the total change in the surface UV-B radiation at most locations. On the other hand, the aerosol direct and indirect effects on UV-B play an equally important role to that of ozone in the NH mid-latitudes and tropics. A typical example is East Asia (25° N-60° N and 120° E-150° E), where the effect of aerosols (ca. 70%) dominates the total UV-B change.

  11. Imaging Polarimeter for a Sub-MeV Gamma-Ray All-sky Survey Using an Electron-tracking Compton Camera

    Energy Technology Data Exchange (ETDEWEB)

    Komura, S.; Takada, A.; Mizumura, Y.; Miyamoto, S.; Takemura, T.; Kishimoto, T.; Kubo, H.; Matsuoka, Y.; Mizumoto, T.; Nakamasu, Y.; Nakamura, K.; Oda, M.; Parker, J. D.; Sonoda, S.; Tanimori, T.; Tomono, D.; Yoshikawa, K. [Graduate School of Science, Kyoto University, Sakyo, Kyoto 606-8502 (Japan); Kurosawa, S. [New Industry Creation Hatchery Center (NICHe), Tohoku University, Sendai, Miyagi, 980-8579 (Japan); Miuchi, K. [Department of Physics, Kobe University, Kobe, Hyogo, 658-8501 (Japan); Sawano, T., E-mail: komura@cr.scphys.kyoto-u.ac.jp [College of Science and Engineering, School of Mathematics and Physics, Kanazawa University, Kanazawa, Ishikawa, 920-1192 (Japan)

    2017-04-10

    X-ray and gamma-ray polarimetry is a promising tool to study the geometry and the magnetic configuration of various celestial objects, such as binary black holes or gamma-ray bursts (GRBs). However, statistically significant polarizations have been detected in few of the brightest objects. Even though future polarimeters using X-ray telescopes are expected to observe weak persistent sources, there are no effective approaches to survey transient and serendipitous sources with a wide field of view (FoV). Here we present an electron-tracking Compton camera (ETCC) as a highly sensitive gamma-ray imaging polarimeter. The ETCC provides powerful background rejection and a high modulation factor over an FoV of up to 2 π sr thanks to its excellent imaging based on a well-defined point-spread function. Importantly, we demonstrated for the first time the stability of the modulation factor under realistic conditions of off-axis incidence and huge backgrounds using the SPring-8 polarized X-ray beam. The measured modulation factor of the ETCC was 0.65 ± 0.01 at 150 keV for an off-axis incidence with an oblique angle of 30° and was not degraded compared to the 0.58 ± 0.02 at 130 keV for on-axis incidence. These measured results are consistent with the simulation results. Consequently, we found that the satellite-ETCC proposed in Tanimori et al. would provide all-sky surveys of weak persistent sources of 13 mCrab with 10% polarization for a 10{sup 7} s exposure and over 20 GRBs down to a 6 × 10{sup −6} erg cm{sup −2} fluence and 10% polarization during a one-year observation.

  12. Finding counterparts for all-sky X-ray surveys with NWAY: a Bayesian algorithm for cross-matching multiple catalogues

    Science.gov (United States)

    Salvato, M.; Buchner, J.; Budavári, T.; Dwelly, T.; Merloni, A.; Brusa, M.; Rau, A.; Fotopoulou, S.; Nandra, K.

    2018-02-01

    We release the AllWISE counterparts and Gaia matches to 106 573 and 17 665 X-ray sources detected in the ROSAT 2RXS and XMMSL2 surveys with |b| > 15°. These are the brightest X-ray sources in the sky, but their position uncertainties and the sparse multi-wavelength coverage until now rendered the identification of their counterparts a demanding task with uncertain results. New all-sky multi-wavelength surveys of sufficient depth, like AllWISE and Gaia, and a new Bayesian statistics based algorithm, NWAY, allow us, for the first time, to provide reliable counterpart associations. NWAY extends previous distance and sky density based association methods and, using one or more priors (e.g. colours, magnitudes), weights the probability that sources from two or more catalogues are simultaneously associated on the basis of their observable characteristics. Here, counterparts have been determined using a Wide-field Infrared Survey Explorer (WISE) colour-magnitude prior. A reference sample of 4524 XMM/Chandra and Swift X-ray sources demonstrates a reliability of ∼94.7 per cent (2RXS) and 97.4 per cent (XMMSL2). Combining our results with Chandra-COSMOS data, we propose a new separation between stars and AGN in the X-ray/WISE flux-magnitude plane, valid over six orders of magnitude. We also release the NWAY code and its user manual. NWAY was extensively tested with XMM-COSMOS data. Using two different sets of priors, we find an agreement of 96 per cent and 99 per cent with published Likelihood Ratio methods. Our results were achieved faster and without any follow-up visual inspection. With the advent of deep and wide area surveys in X-rays (e.g. SRG/eROSITA, Athena/WFI) and radio (ASKAP/EMU, LOFAR, APERTIF, etc.) NWAY will provide a powerful and reliable counterpart identification tool.

  13. Discovery of the hard spectrum VHE γ-ray source HESS J1641-463

    International Nuclear Information System (INIS)

    Abramowski, A.; Ait Benkhali, F.

    2014-10-01

    This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  14. Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar

    Science.gov (United States)

    Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.

    2018-05-01

    The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.

  15. AN XMM-NEWTON SURVEY OF THE SOFT X-RAY BACKGROUND. II. AN ALL-SKY CATALOG OF DIFFUSE O VII AND O VIII EMISSION INTENSITIES

    International Nuclear Information System (INIS)

    Henley, David B.; Shelton, Robin L.

    2012-01-01

    We present an all-sky catalog of diffuse O VII and O VIII line intensities, extracted from archival XMM-Newton observations. This catalog supersedes our previous catalog, which covered the sky between l = 120° and l = 240°. We attempted to reduce the contamination from near-Earth solar wind charge exchange (SWCX) emission by excluding times of high solar wind proton flux from the data. Without this filtering, we were able to extract measurements from 1868 observations. With this filtering, nearly half of the observations became unusable, and only 1003 observations yielded measurements. The O VII and O VIII intensities are typically ∼2-11 and ∼ –2 s –1 sr –1 (line unit, L.U.), respectively, although much brighter intensities were also recorded. Our data set includes 217 directions that have been observed multiple times by XMM-Newton. The time variation of the intensities from such directions may be used to constrain SWCX models. The O VII and O VIII intensities typically vary by ∼ 10 L.U. were observed. We compared our measurements with models of the heliospheric and geocoronal SWCX. The heliospheric SWCX intensity is expected to vary with ecliptic latitude and solar cycle. We found that the observed oxygen intensities generally decrease from solar maximum to solar minimum, both at high ecliptic latitudes (which is as expected) and at low ecliptic latitudes (which is not as expected). The geocoronal SWCX intensity is expected to depend on the solar wind proton flux incident on the Earth and on the sightline's path through the magnetosheath. The intensity variations seen in directions that have been observed multiple times are in poor agreement with the predictions of a geocoronal SWCX model. We found that the oxygen lines account for ∼40%-50% of the 3/4 keV X-ray background that is not due to unresolved active galactic nuclei, in good agreement with a previous measurement. However, we found that this fraction is not easily explainable by a

  16. DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others

    2014-10-10

    This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  17. PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

    2010-02-01

    Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

  18. Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3

    Science.gov (United States)

    HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.

    2018-03-01

    Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.

  19. Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes

    International Nuclear Information System (INIS)

    Mirzoyan, R.

    2000-01-01

    The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV

  20. Imprint of the Sun’s Evolving Polar Winds on IBEX Energetic Neutral Atom All-sky Observations of the Heliosphere

    Energy Technology Data Exchange (ETDEWEB)

    Zirnstein, E. J.; McComas, D. J. [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Dayeh, M. A. [Southwest Research Institute, San Antonio, TX 78228 (United States); Sokół, J. M., E-mail: ejz@princeton.edu [Space Research Centre of the Polish Academy of Sciences, 00-716 Warsaw (Poland)

    2017-09-01

    With 7 years of Interstellar Boundary Explorer ( IBEX ) measurements of energetic neutral atoms (ENAs), IBEX has shown a clear correlation between dynamic changes in the solar wind and the heliosphere’s response in the formation of ENAs. In this paper, we investigate temporal variations in the latitudinal-dependent ENA spectrum from IBEX and their relationship to the solar wind speed observed at 1 au. We find that the variation in latitude of the transition in ENA spectral indices between low (≲1.8) and high (≳1.8) values, as well as the distribution of ENA spectral indices at high and low latitudes, correlates well with the evolution of the fast and slow solar wind latitudinal structure observed near 1 au. This correlation includes a delay due to the time it takes the solar wind to propagate to the termination shock and into the inner heliosheath, and for ENAs to be generated via charge-exchange and travel back toward 1 au. Moreover, we observe a temporal asymmetry in the steepening of the ENA spectrum in the northern and southern hemispheres, consistent with asymmetries observed in the solar wind and polar coronal holes. While this asymmetry is observed near the upwind direction of the heliosphere, it is not yet observed in the tail direction, suggesting a longer line-of-sight integration distance or different processing of the solar wind plasma downstream of the termination shock.

  1. The Einstein All-Sky Slew Survey

    Science.gov (United States)

    Elvis, Martin S.

    1992-01-01

    The First Einstein IPC Slew Survey produced a list of 819 x-ray sources, with f(sub x) approximately 10(exp -12) - 10(exp -10) erg/sq cm s and positional accuracy of approximately 1.2 feet (90 percent radius). The aim of this program was to identify these x-ray sources.

  2. An accuracy assessment of an empirical sine model, a novel sine model and an artificial neural network model for forecasting illuminance/irradiance on horizontal plane of all sky types at Mahasarakham, Thailand

    International Nuclear Information System (INIS)

    Pattanasethanon, Singthong; Lertsatitthanakorn, Charoenporn; Atthajariyakul, Surat; Soponronnarit, Somchart

    2008-01-01

    The results of a study on all sky modeling and forecasting daylight availability for the tropical climate found in the central region of the northeastern part of Thailand (16 deg. 14' N, 103 deg. 15' E) is presented. The required components of sky quantities, namely, global and diffuse horizontal irradiance and global horizontal illuminance for saving energy used in buildings are estimated. The empirical sinusoidal models are validated. A and B values of the empirical sinusoidal model for all sky conditions are determined and developed to become a form of the sky conditions. In addition, a novel sinusoidal model, which consists of polynomial or exponential functions, is validated. A and B values of the empirical sinusoidal model for all sky conditions are determined and developed to become a new function in the polynomial or exponential form of the sky conditions. Novelettes, an artificial intelligent agent, namely, artificial neural network (ANN) model is also identified. Back propagation learning algorithms were used in the networks. Moreover, a one year data set and a next half year data set were used in order to train and test the neural network, respectively. Observation results from one year's round data indicate that luminosity and energy from the sky on horizontal in the area around Mahasarakham are frequently brighter than those of Bangkok. The accuracy of the validated model is determined in terms of the mean bias deviation (MBD), the root-mean-square-deviation (RMSD) and the coefficient of correlation (R 2 ) values. A comparison of the estimated solar irradiation values and the observed values revealed a small error slide in the empirical sinusoidal model as well. In addition, some results of the sky quantity forecast by the ANN model indicate that the ANN model is more accurate than the empirical models and the novel sinusoidal models. This study confirms the ability of the ANN to predict highly accurate solar radiance/illuminance values. We believe

  3. Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S.

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    The diffuse very high-energy (VHE; >100 GeV) γ-ray emission observed in the central 200 pc of the Milky Way by H.E.S.S. was found to follow dense matter distribution in the central molecular zone (CMZ) up to a longitudinal distance of about 130 pc to the Galactic centre (GC), where the flux rapidly decreases. This was initially interpreted as the result of a burst-like injection of energetic particles 104 yr ago, but a recent more sensitive H.E.S.S. analysis revealed that the cosmic-ray (CR) density profile drops with the distance to the centre, making data compatible with a steady cosmic PeVatron at the GC. In this paper, we extend this analysis to obtain, for the first time, a detailed characterisation of the correlation with matter and to search for additional features and individual γ-ray sources in the inner 200 pc. Taking advantage of 250 h of H.E.S.S. data and improved analysis techniques, we perform a detailed morphology study of the diffuse VHE emission observed from the GC ridge and reconstruct its total spectrum. To test the various contributions to the total γ-ray emission, we used an iterative 2D maximum-likelihood approach that allows us to build a phenomenological model of the emission by summing a number of different spatial components. We show that the emission correlated with dense matter covers the full CMZ and that its flux is about half the total diffuse emission flux. We also detect some emission at higher latitude that is likely produced by hadronic collisions of CRs in less dense regions of the GC interstellar medium. We detect an additional emission component centred on the GC and extending over about 15 pc that is consistent with the existence of a strong CR density gradient and confirms the presence of a CR accelerator at the very centre of our Galaxy. We show that the spectrum of full ridge diffuse emission is compatible with that previously derived from the central regions, suggesting that a single population of particles fills the

  4. Measuring the color and brightness of artificial sky glow from cities using an all-sky imaging system calibrated with astronomical methods in the Johnson-Cousins B and V photometric systems

    Science.gov (United States)

    Pipkin, Ashley; Duriscoe, Dan M.; Lughinbuhl, Christian

    2017-01-01

    Artificial light at night, when observed at some distance from a city, results in a dome of sky glow, brightest at the horizon. The spectral power distribution of electric light utilized will determine its color of the light dome and the amount of light will determine its brightness. Recent outdoor lighting technologies have included blue-rich light emitting diode (LED) sources that may increase the relative amount of blue to green light in sky glow compared to typical high pressure sodium (HPS) sources with warmer spectra. Measuring and monitoring this effect is important to the preservation of night sky visual quality as seen from undeveloped areas outside the city, such as parks or other protected areas, since the dark-adapted human eye is more sensitive to blue and green. We present a method using a wide field CCD camera which images the entire sky in both Johnson V and B photometric bands. Standard stars within the images are used for calibration. The resulting all-sky brightness maps, and a derived B-V color index map, provide a means to assess and track the impact of specific outdoor lighting practices. We also present example data from several cities, including Las Vegas, Nevada, Flagstaff, Arizona, and Cheyenne, Wyoming.

  5. Proton irradiation experiment for x-ray charge-coupled devices of the monitor of all-sky x-ray image mission onboard the international space station. 2. Degradation of dark current and identification of electron trap level

    CERN Document Server

    Miyata, E; Kamiyama, D

    2003-01-01

    We have investigated the radiation damage effects on a charge-coupled device (CCD) to be used for the Japanese X-ray mission, the monitor of all-sky X-ray image (MAXI), onboard the international space station (ISS). A temperature dependence of the dark current as a function of incremental dose is studied. We found that the protons having energy of >292 keV seriously increased the dark current of the devices. In order to improve the radiation tolerance of the devices, we have developed various device architectures to minimize the radiation damage in orbit. Among them, nitride oxide enables us to reduce the dark current significantly and therefore we adopted nitride oxide for the flight devices. We also compared the dark current of a device in operation and that out of operation during the proton irradiation. The dark current of the device in operation became twofold that out of operation, and we thus determined that devices would be turned off during the passage of the radiation belt. The temperature dependenc...

  6. Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.

  7. Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)

    2010-07-01

    The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.

  8. All-Sky Monitoring of Variable Sources with Fermi GBM

    Science.gov (United States)

    Wilson-Hodge, Colleen A.; Cherry, Michael L.; Case, Gary L.; Camero-Arranz, Ascension; Chaplin, Vandiver; Connaughton, Valerie; Finger, Mark H.; Jenke, Pater; Rodi, James C.; Baumgartner, Wayne H.; hide

    2011-01-01

    This slide presentation reviews the monitoring of variable sources with the Fermi Gamma Ray Burst Monitor (GBM). It reviews the use of the Earth Occultation technique, the observations of the Crab Nebula with the GBM, and the comparison with other satellite's observations. The instruments on board the four satellites indicate a decline in the Crab from 2008-2010.

  9. Measuring Overcast Colors with All-Sky Imaging

    Science.gov (United States)

    2008-04-01

    NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) United States Naval Academy (USNA),Mathematics...Science Department,Annapolis,MD,21402 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR...are vestigial (29 No- vember 2006 curve). A few overcasts are bluest near the horizon, and this causes particularly large colori- metric excursions

  10. All-Sky Cataloging and Analysis of Interstellar Clouds

    Science.gov (United States)

    Hojaev, Alisher S.

    2015-08-01

    Recent quick instrumental progress provides possibilities to careful study the interstellar medium (ISM) in the Galaxy and in the nearest galaxies (M31, LMC, SMC, etc.). Significant enough baryon mass of the galactic and extragalactic ISM is concentrated in the clouds with molecular content in the densest parts. The molecular clouds (MoC) are closely related to cold dust-gas clouds, particularly HI ones and should play a key-role in the star forming processes as well as in the dynamics of the Galaxy. These arguments show the importance of counting and surveying of the MoC populations. In order to attempt to solve at least some problems of the physics and evolution of the MoC system in the Galaxy (as well as in other galaxies), its impact on the dynamics and evolution of the Galaxy itself, and to extend the results to the MoC systems in other galaxies we drafted a consolidated composite catalog of molecular and dust-gas clouds based on the recent data. Online data banks and services such as VizieR, SIMBAD at CDS as well as original publications were used. In our Galaxy there are about 200 large molecular clouds, more than 2500 smaller cold dark clouds (including clumps and cores this value exceeds approximately 5000 objects) observed in 11 kpc Solar neighborhood. The general catalog has been divided into 3 sub-catalogs: 1)large and giant MoC; 2) MoC with moderate masses and sizes; 3) small MoC including the clumps and cores. All main catalogs and subcatalogs contain the coordinates, sizes, distances, masses and other physical parameters (density, temperature, radial velocity, etc.) that are available for the different clouds. Statistical and correlation analyses of the data has been performed, the spatial distribution is drawn and the total number is estimated, the dynamic model of formation and evolution of MoC system is proposed. Our results are compared and discussed with data of other investigations as well as the ways to complete and improve the catalog data are also proposed. We prepared the complex program for further observations of MoC using the Suffa radio telescope and other large facilities to cover the gaps in observed physical parameters of MoC.

  11. ATLAS: A High-cadence All-sky Survey System

    Science.gov (United States)

    Tonry, J. L.; Denneau, L.; Heinze, A. N.; Stalder, B.; Smith, K. W.; Smartt, S. J.; Stubbs, C. W.; Weiland, H. J.; Rest, A.

    2018-06-01

    Technology has advanced to the point that it is possible to image the entire sky every night and process the data in real time. The sky is hardly static: many interesting phenomena occur, including variable stationary objects such as stars or QSOs, transient stationary objects such as supernovae or M dwarf flares, and moving objects such as asteroids and the stars themselves. Funded by NASA, we have designed and built a sky survey system for the purpose of finding dangerous near-Earth asteroids (NEAs). This system, the “Asteroid Terrestrial-impact Last Alert System” (ATLAS), has been optimized to produce the best survey capability per unit cost, and therefore is an efficient and competitive system for finding potentially hazardous asteroids (PHAs) but also for tracking variables and finding transients. While carrying out its NASA mission, ATLAS now discovers more bright (m day cadence. ATLAS discovered the afterglow of a gamma-ray burst independent of the high energy trigger and has released a variable star catalog of 5 × 106 sources. This is the first of a series of articles describing ATLAS, devoted to the design and performance of the ATLAS system. Subsequent articles will describe in more detail the software, the survey strategy, ATLAS-derived NEA population statistics, transient detections, and the first data release of variable stars and transient light curves.

  12. Automated Meteor Detection by All-Sky Digital Camera Systems

    Czech Academy of Sciences Publication Activity Database

    Suk, Tomáš; Šimberová, Stanislava

    2017-01-01

    Roč. 120, č. 3 (2017), s. 189-215 ISSN 0167-9295 R&D Projects: GA ČR GA15-16928S Institutional support: RVO:67985815 ; RVO:67985556 Keywords : meteor detection * autonomous fireball observatories * fish-eye camera * Hough transformation Subject RIV: IN - Informatics, Computer Science; BN - Astronomy, Celestial Mechanics, Astrophysics (ASU-R) OBOR OECD: Computer sciences, information science, bioinformathics (hardware development to be 2.2, social aspect to be 5.8); Astronomy (including astrophysics,space science) (ASU-R) Impact factor: 0.875, year: 2016

  13. Search for VHE γ-ray emission from the direction of the two millisecond pulsars PSR J0437-4715 and PSR J1824-2452 and the composite supernova remnant Kes 75 with H.E.S.S

    International Nuclear Information System (INIS)

    Fuessling, Matthias

    2012-01-01

    This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.

  14. The Crab pulsar at VHE

    Directory of Open Access Journals (Sweden)

    Zanin Roberta

    2017-01-01

    Full Text Available The last six years have witnessed major revisions of our knowledge about the Crab Pulsar. The consensus scenario for the origin of the high-energy pulsed emission has been challenged with the discovery of a very-high-energy power law tail extending up to ~400 GeV, above the expected spectral cut off at a few GeV. Now, new measurements obtained by the MAGIC collaboration extend the energy spectrum of the Crab Pulsar even further, on the TeV regime. Above ~400 GeV the pulsed emission comes mainly from the interpulse, which becomes more prominent with energy due to a harder spectral index. These findings require γ -ray production via inverse Compton scattering close to or beyond the light cylinder radius by an underlying particle population with Lorentz factors greater than 5 × 106. We will present those new results and discuss the implications in our current knowledge concerning pulsar environments.

  15. Seroprevalence for hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná , Brazil Soroprevalência da infecção pelo virus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    André Luiz Bortoliero

    2006-04-01

    Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari

  16. A Survey of Variable Extragalactic Sources with XTE's All Sky Monitor (ASM)

    Science.gov (United States)

    Jernigan, Garrett

    1998-01-01

    The original goal of the project was the near real-time detection of AGN utilizing the SSC 3 of the ASM on XTE which does a deep integration on one 100 square degree region of the sky. While the SSC never performed sufficiently well to allow the success of this goal, the work on the project has led to the development of a new analysis method for coded aperture systems which has now been applied to ASM data for mapping regions near clusters of galaxies such as the Perseus Cluster and the Coma Cluster. Publications are in preparation that describe both the new method and the results from mapping clusters of galaxies.

  17. The First Data Release of the All-sky NOAO Source Catalog

    Science.gov (United States)

    Nidever, David L.; NOAO Data Lab

    2018-06-01

    Roughly three quarters of the sky has been imaged with NOAO's telescopes from both hemispheres. While the large majority of these data were obtained for PI-led projects and surveys only a fraction have been released to the community via well-calibrated and easily accessible catalogs. We have remedied this by creating a catalog of sources from most of the public data taken on CTIO-4m+DECam as well as KPNO 4m+Mosaic3. The first data release (DR1) of this catalog, called the NOAO Source Catalog (NSC), contains 2.9 billion unique objects, 34 billion individual measurements, covers ~30,000 square degrees, has depths of ~23rd magnitude in most broadband filters with ~1-2% photometric accuracy and astrometric accuracy of ~2 mas. The NSC will be useful for exploring stellar streams, dwarf satellite galaxies, distant galaxies as well as variable stars and other transients. DR1 is now available through the NOAO Data Lab (datalab.noao.edu).

  18. All-sky Meteor Orbit System AMOS and preliminary analysis of three unusual meteor showers

    Czech Academy of Sciences Publication Activity Database

    Tóth, J.; Kornoš, L.; Zigo, P.; Gajdoš, Š.; Kalmančok, D.; Világi, J.; Šimon, J.; Vereš, P.; Šilha, J.; Buček, M.; Galád, Adrián; Rusňák, P.; Hrábek, P.; Ďuriš, F.; Rudawska, R.

    2015-01-01

    Roč. 118, December (2015), s. 102-106 ISSN 0032-0633 Institutional support: RVO:67985815 Keywords : meteor * meteorite * meteoroid streams Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.942, year: 2015

  19. The GMRT 150 MHz all-sky radio survey. First alternative data release TGSS ADR1

    Science.gov (United States)

    Intema, H. T.; Jagannathan, P.; Mooley, K. P.; Frail, D. A.

    2017-02-01

    We present the first full release of a survey of the 150 MHz radio sky, observed with the Giant Metrewave Radio Telescope (GMRT) between April 2010 and March 2012 as part of the TIFR GMRT Sky Survey (TGSS) project. Aimed at producing a reliable compact source survey, our automated data reduction pipeline efficiently processed more than 2000 h of observations with minimal human interaction. Through application of innovative techniques such as image-based flagging, direction-dependent calibration of ionospheric phase errors, correcting for systematic offsets in antenna pointing, and improving the primary beam model, we created good quality images for over 95 percent of the 5336 pointings. Our data release covers 36 900 deg2 (or 3.6 π steradians) of the sky between -53° and +90° declination (Dec), which is 90 percent of the total sky. The majority of pointing images have a noise level below 5 mJy beam-1 with an approximate resolution of 25''×25'' (or 25''×25''/ cos(Dec-19°) for pointings south of 19° declination). We have produced a catalog of 0.62 Million radio sources derived from an initial, high reliability source extraction at the seven sigma level. For the bulk of the survey, the measured overall astrometric accuracy is better than two arcseconds in right ascension and declination, while the flux density accuracy is estimated at approximately ten percent. Within the scope of the TGSS alternative data release (TGSS ADR) project, the source catalog, as well as 5336 mosaic images (5°×5°) and an image cutout service, are made publicly available at the CDS as a service to the astronomical community. Next to enabling a wide range of different scientific investigations, we anticipate that these survey products will provide a solid reference for various new low-frequency radio aperture array telescopes (LOFAR, LWA, MWA, SKA-low), and can play an important role in characterizing the epoch-of-reionisation (EoR) foreground. The TGSS ADR project aims at continuously improving the quality of the survey data products. Near-future improvements include replacement of bright source snapshot images with archival targeted observations, using new observations to fill the holes in sky coverage and replace very poor quality observational data, and an improved flux calibration strategy for less severely affected observational data. Full Table 3 is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/598/A78

  20. Inferences of all-sky solar irradiance using Terra and Aqua MODIS satellite data

    DEFF Research Database (Denmark)

    Houborg, Rasmus Møller; Søgaard, Henrik; Emmerich, W.

    2007-01-01

    -sky solar irradiance components, which links a physically based clear-sky model with a neural network version of a rigorous radiative transfer model. The scheme exploits the improved cloud characterization and retrieval capabilities of the MODerate resolution Imaging Spectroradiometer (MODIS) onboard...... contrasting climates and cloud environments. Information on the atmospheric state was provided by MODIS data products and verifications against AErosol RObotic NETwork (AERONET) data demonstrated usefulness of MODIS aerosol optical depth and total precipitable water vapour retrievals for the delineation...... and become unusable above approximately 60° latitude. However, in principle, the scheme can be applied anywhere on the globe, and a synergistic use of MODIS and geostationary satellite datasets may be envisaged for some applications....

  1. Machine learning in infrared object classification - an all-sky selection of YSO candidates

    Science.gov (United States)

    Marton, Gabor; Zahorecz, Sarolta; Toth, L. Viktor; Magnus McGehee, Peregrine; Kun, Maria

    2015-08-01

    Object classification is a fundamental and challenging problem in the era of big data. I will discuss up-to-date methods and their application to classify infrared point sources.We analysed the ALLWISE catalogue, the most recent public source catalogue of the Wide-field Infrared Survey Explorer (WISE) to compile a reliable list of Young Stellar Object (YSO) candidates. We tested and compared classical and up-to-date statistical methods as well, to discriminate source types like extragalactic objects, evolved stars, main sequence stars, objects related to the interstellar medium and YSO candidates by using their mid-IR WISE properties and associated near-IR 2MASS data.In the particular classification problem the Support Vector Machines (SVM), a class of supervised learning algorithm turned out to be the best tool. As a result we classify Class I and II YSOs with >90% accuracy while the fraction of contaminating extragalactic objects remains well below 1%, based on the number of known objects listed in the SIMBAD and VizieR databases. We compare our results to other classification schemes from the literature and show that the SVM outperforms methods that apply linear cuts on the colour-colour and colour-magnitude space. Our homogenous YSO candidate catalog can serve as an excellent pathfinder for future detailed observations of individual objects and a starting point of statistical studies that aim to add pieces to the big picture of star formation theory.

  2. All-sky x-ray ampersand gamma-ray monitor (AXGAM)

    International Nuclear Information System (INIS)

    Tuemer, T.O.; O'Neill, T.J.; Hurley, K.

    1996-01-01

    A wide field-of-view, arcsecond imaging, high energy resolution x-ray and low energy gamma ray detector is proposed for a future space mission. It is specifically designed to detect and find counterparts at other wavelengths for Gamma Ray Bursts (GRBs). Detection of GRBs require wide field-of-view (π to 2 π field-of-view) and high sensitivity. This will be achieved by using high quantum efficiency CdZnTe pixel detectors, low energy threshold (few keV) to observe larger flux levels that may be possible at lower energies and large effective area (625 to 1,000 cd) per coded aperture imaging module. Counterpart searches can only be done with ultra high angular resolution (10 to 30 arcsecond FWHM) which gives 1 to 5 arcsecond position determination especially for strong GRBs. A few arcsecond resolution error box is expected to contain only one counterpart observed at another wavelength. This will be achieved by using ultra high spatial resolution pixel detectors (50 x 50 to 100 X 100 micron) and a similar resolution coded aperture to achieve the required angular resolution. AXGAM also has two other important advantages over similar detectors: (1) excellent low energy response (> 1 keV) and (2) high energy resolution (<6% at sign 5.9 keV, <3% at sign 14 keV, <4% at sign 122 keV). The low energy range may provide important new information on their cause and the high energy resolution is expected to help in the observation and identification of emission and absorption lines in the GRB spectrum. The effective energy range is planned to be 2 to 200 keV which is exceptionally wide for such a detector. AXGAM will be built in the form of a open-quotes Bucky Ballclose quotes using a coded aperture mask in a semi geodesic dome arrangement placed over a two-dimensional, high resolution CdZnTe pixel detector array using newly developed p-i-n detector technology. The p-i-n structure decreases the electron and hole trapping effect and increases energy resolution significantly

  3. The History of the CONCAM Project: All Sky Monitors in the Digital Age

    Science.gov (United States)

    Nemiroff, Robert; Shamir, Lior; Pereira, Wellesley

    2018-01-01

    The CONtinuous CAMera (CONCAM) project, which ran from 2000 to (about) 2008, consisted of real-time, Internet-connected, fisheye cameras located at major astronomical observatories. At its peak, eleven CONCAMs around the globe monitored most of the night sky, most of the time. Initially designed to search for transients and stellar variability, CONCAMs gained initial notoriety as cloud monitors. As such, CONCAMs made -- and its successors continue to make -- ground-based astronomy more efficient. The original, compact, fisheye-observatory-in-a-suitcase design underwent several iterations, starting with CONCAM0 and with the last version dubbed CONCAM3. Although the CONCAM project itself concluded after centralized funding diminished, today more locally-operated, commercially-designed, CONCAM-like devices operate than ever before. It has even been shown that modern smartphones can operate in a CONCAM-like mode. It is speculated that the re-instatement of better global coordination of current wide-angle sky monitors could lead to better variability monitoring of the brightest stars and transients.

  4. Search for neutrino point sources with an all-sky autocorrelation analysis in IceCube

    Energy Technology Data Exchange (ETDEWEB)

    Turcati, Andrea; Bernhard, Anna; Coenders, Stefan [TU, Munich (Germany); Collaboration: IceCube-Collaboration

    2016-07-01

    The IceCube Neutrino Observatory is a cubic kilometre scale neutrino telescope located in the Antarctic ice. Its full-sky field of view gives unique opportunities to study the neutrino emission from the Galactic and extragalactic sky. Recently, IceCube found the first signal of astrophysical neutrinos with energies up to the PeV scale, but the origin of these particles still remains unresolved. Given the observed flux, the absence of observations of bright point-sources is explainable with the presence of numerous weak sources. This scenario can be tested using autocorrelation methods. We present here the sensitivities and discovery potentials of a two-point angular correlation analysis performed on seven years of IceCube data, taken between 2008 and 2015. The test is applied on the northern and southern skies separately, using the neutrino energy information to improve the effectiveness of the method.

  5. Star formation rates in isolated galaxies selected from the Two-Micron All-Sky Survey

    Science.gov (United States)

    Melnyk, O.; Karachentseva, V.; Karachentsev, I.

    2015-08-01

    We have considered the star formation properties of 1616 isolated galaxies from the 2MASS XSC (Extended Source Catalog) selected sample (2MIG) with the far-ultraviolet GALEX magnitudes. This sample was then compared with corresponding properties of isolated galaxies from the Local Orphan Galaxies (LOG) catalogue and paired galaxies. We found that different selection algorithms define different populations of isolated galaxies. The population of the LOG catalogue, selected from non-clustered galaxies in the Local Supercluster volume, mostly consists of low-mass spiral and late-type galaxies. The specific star formation rate (SSFR) upper limit in isolated and paired galaxies does not exceed the value of ˜dex(-9.4). This is probably common for galaxies of differing activity and environment (at least at z processes is the galaxy mass. However, the environmental influence is notable: paired massive galaxies with logM* > 11.5 have higher (S)SFR than isolated galaxies. Our results suggest that the environment helps to trigger the star formation in the highest mass galaxies. We found that the fraction of AGN in the paired sample is only a little higher than in our isolated galaxy sample. We assume that AGN phenomenon is probably defined by secular galaxy evolution.

  6. First low frequency all-sky search for continuous gravitational wave signals

    NARCIS (Netherlands)

    Aasi, J.; Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Phythian-Adams, A.T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.T.; Aguiar, O. D.; Ain, A.; Ajith, P.; Allen, B.; Allocca, A.; Amariutei, D. V.; Andersen, M.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C. C.; Areeda, J. S.; Arnaud, N.; Ashton, G.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Babak, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, R.D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Bartlett, J.; Barton, M. A.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Behnke, B.; Bejger, M.; Belczynski, C.; Bell, A. S.; Berger, B. K.; Bergman, J.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Birch, M.J.; Birney, R.; Biscans, S.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blair, C. D.; Blair, C. D.; Bloemen, A.L.S.; Bock, O.; Bodiya, T. P.; Boer, M.; Bogaert, J.G.; Bojtos, P.; Bond, T.C; Bondu, F.; Bonnand, R.; Bork, R.; Born, M.; Boschi, V.; Bose, Sukanta; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Branco, V.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Brooks, A. F.; Brown, A.D.; Brown, D.; Brown, D.; Brown, N. M.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cadonati, L.; Cagnoli, G.; Bustillo, J. Calderon; Calloni, E.; Camp, J. B.; Cannon, K. C.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Celerier, C.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chakraborty, R.; Chalermsongsak, T.; Chamberlin, S. J.; Chao, D. S.; Charlton, P.; Chassande-Mottin, E.; Chen, X.; Chen, Y; Cheng, C.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Qian; Chua, S. E.; Chung, E.S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Colombini, M.; Constancio, M., Jr.; Conte, A.; Conti, L.; Cook, D.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Costa, A.C.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Cripe, J.; Crowder, S. G.; Cumming, A.; Cunningham, A.L.; Cuoco, E.; Dal Canton, T.; Damjanic, M. D.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Darman, N. S.; Dattilo, V.; Dave, I.; Daveloza, H. P.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; Debra, D.; Debreczeni, G.; Degallaix, J.; De laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dereli, H.; Dergachev, V.A.; Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Dhurandhar, S.; Dia, M. C.; Di Fiore, L.; Giovanni, M.G.; Di Lieto, A.; Di Palma, I.; Di Virgilio, A.; Dojcinoski, G.; Dolique, V.; Dominguez, E.; Donovan, F.; Dooley, K. L.; Doravari, S.; Douglas, R.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Edwards, M.; Effler, A.; Eggenstein, H. -B.; Ehrens, P.; Eichholz, J. M.; Eikenberry, S. S.; Essick, R. C.; Etzel, T.; Evans, T. M.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, V.; Fairhurst, S.; Fang, Q.; Farinon, S.; Farr, B.; Farr, W. M.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Feldbaum, D.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fisher, R. P.; Flaminio, R.; Fournier, J. -D.; Franco, S; Frasca, S.; Frasconi, F.; Frede, M.; Frei, Z.; Freise, A.; Frey, R.; Fricke, T. T.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H. A. G.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garufi, F.; Gatto, A.; Gehrels, N.; Gemme, G.; Gendre, B.; Genin, E.; Gennai, A.; Gergely, L. A.; Germain, V.; Ghosh, A.; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gleason, J. R.; Goetz, E.; Goetz, R.; Gondan, L.; Gonzalez, Idelmis G.; Gonzalez, J.; Gopakumar, A.; Gordon, N. A.; Gorodetsky, M. L.; Gossan, S. E.; Lee-Gosselin, M.; Gossler, S.; Gouaty, R.; Graef, C.; Graff, P. B.; Granata, M.; Grant, A.; Gras, S.; Gray, C.M.; Greco, G.; Groot, P.; Grote, H.; Grover, K.; Grunewald, S.; Guidi, G. M.; Guido, C. J.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Buffoni-Hall, R.; Hall, E. D.; Hammer, D. X.; Hammond, G.L.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hanson, P.J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C. -J.; Haughian, K.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Hoelscher-Obermaier, J.; Hofman, D.; Hollitt, S. E.; Holt, K.; Hopkins, P.; Hosken, D. J.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huang, S.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh, M.; Huynh-Dinh, T.; Idrisy, A.; Indik, N.; Ingram, D. R.; Inta, R.; Islas, G.; Isler, J. C.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacobson, M. B.; Jang, D.H.; Jaranowski, P.; Jawahar, S.; Ji, Y.; Jimenez-Forteza, F.; Johnson, W.; Jones, I.D.; Jones, R.; Jonker, R. J. G.; Ju, L.; Haris, K.; Kalogera, V.; Kandhasamy, S.; Kang, G.H.; Kanner, J. B.; Karki, S.; Karlen, J. L.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kawazoe, F.; Kefelian, F.; Kehl, M. S.; Keitel, D.; Kelley, D. B.; Kells, W.; Kerrigan, J.; Key, J. S.; Khalili, F. Y.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, C.; Kim, K.; Kim, Nam-Gyu; Kim, Namjun; Kim, Y.M.; King, E. J.; King, P. J.; Kinzel, D. L.; Kissel, J. S.; Klimenko, S.; Kline, J. T.; Koehlenbeck, S. M.; Kokeyama, K.; Koley, S.; Kondrashov, V.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kringel, V.; Krishnan, B.; Krolak, A.; Krueger, C.; Kuehn, G.; Kumar, A.; Kumar, P.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lantz, B.; Lasky, P. D.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C.H.; Lee, K.H.; Lee, M.H.; Lee, J. P.; Lee, J. P.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Levine, B. M.; Lewis, J. B.; Li, T. G. F.; Libson, A.; Lin, A. C.; Littenberg, T. B.; Lockerbie, N. A.; Lockett, V.; Lodhia, D.; Logue, J.; Lombardi, A. L.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lubinski, M. J.; Luck, H.; Lundgren, A. P.; Luo, J.; Lynch, R.; Ma, Y.; Macarthur, J.; Macdonald, E. P.; MacDonald, T.T.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Madden-Fong, D. X.; Magana-Sandoval, F.; Magee, R. M.; Mageswaran, M.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandel, I.; Mandic, V.; Mangano, V.; Mangini, N. M.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Ma, H.Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martin, R.M.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Mastrogiovanni, S.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGuire, S. C.; McIntyre, G.; McIver, J.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Mehmet, M.; Meidam, J.; Meinders, M.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moe, B.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B.C.; Moraru, D.; Gutierrez Moreno, M.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Mukherjee, A.; Mukherjee, S.; Mullavey, A.; Munch, J.; Murphy, D. J.; Murray, P.G.; Mytidis, A.; Nagy, M. F.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Necula, V.; Nedkova, K.; Nelemans, G.; Gutierrez-Neri, M.; Newton-Howes, G.; Nguyen, T. T.; Nielsen, A. B.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J.; Oh, S. H.; Ohme, F.; Okounkova, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ortega, W. E.; O'Shaughnessy, R.; Ott, C. D.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Padilla, C. T.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pan, Y.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Papa, M. A.; Paris, H. R.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patrick, Z.; Pedraza, M.; Pekowsky, L.; Pele, A.; Penn, S.; Perreca, A.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Pickenpack, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poeld, J. H.; Poggiani, R.; Post, A.; Powell, J.; Prasad, J.; Predoi, V.; Premachandra, S. S.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Purrer, M.; Qin, J.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Racz, I.; Radkins, H.; Raffai, P.; Raja, S.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Reed, C. M.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Ricci, F.; Riles, K.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rodger, A. S.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, J. D.; Romano, R.; Romanov, G.; Romie, J. H.; Rosins, D.; Rowan, S.; Rud, A.; Ruggi, P.; Ryan, K.A.; Sachdev, P.S.; Sadecki, T.; Sadeghian, L.; Saleem, M.; Salemi, F.; Sammut, L.; Sanchez, E.; Sandberg, V.; Sanders, J. R.; Santiago-Prieto, I.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Savage, R. L.; Sawadsky, A.; Schale, P.; Schilling, R.; Schmidt, P.; Schnabel, R.B.; Schofield, R. M. S.; Schonbeck, A.; Schreiber, K.E.C.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, M.S.; Sellers, D.; Sentenac, D.; Sequino, V.; Sergeev, A.; Serna, G.; Sevigny, A.; Shaddock, D. A.; Shaffery, P.; Shah, S.; Shahriar, M. S.; Shaltev, M.; Shao, Z.M.; Shapiro, B.; Shawhan, P.; Shoemaker, D. H.; Sidery, T. L.; Siellez, K.; Siemens, X.; Sigg, D.; Silva, António Dias da; Simakov, D.; Singer, A; Singer, L. P.; Singh, R.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, R. J. E.; Smith, N.D.; Smith, R. J. E.; Son, E. J.; Sorazu, B.; Souradeep, T.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Steplewski, S.; Stevenson-Moore, P.; Stone, J.R.; Strain, K. A.; Straniero, N.; Strauss, N. A.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sutton, P. J.; Swinkels, B. L.; Szczepanczyk, M. J.; Tacca, M.D.; Talukder, D.; Tanner, D. B.; Tap, M.; Tarabrin, S. P.; Taracchini, A.; Taylor, W.R.; Theeg, T.; Thirugnanasambandam, M. P.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Tomlinson, C.; Tonelli, M.; Torres, C. V.; Torrie, C. I.; Travasso, F.; Traylor, G.; Trifiro, D.; Tringali, M. C.; Tse, M.; Turconi, M.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; Van Bakel, N.; Van Beuzekom, Martin; Van den Brand, J. F. J.; Van Den Broeck, C.F.F.; van der Schaaf, L.; van der Sluys, M. V.; Eijningen, J. V.; Eggel, A. A. V.; Vardaro, M.; Vass, S.; Vasuth, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P.J.; Venkateswara, K.; Verkindt, D.; Vetrano, F.; Vicere, A.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, MT; Wade, L. E.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, M.; Wang, X.; Ward, R. L.; Warner, J.; Was, M.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Welborn, T.; Wen, L.M.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whitcomb, S. E.; White, D. J.; Whiting, B. F.; Williams, K. J.; Williams, L.; Williams, D.R.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Worden, J.; Yablon, J.; Yakushin, I.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yvert, M.; Zadrozny, A.; Zangrando, L.; Zanolin, M.; Zendri, J. -P.; Zhang, Fan; Zhang, L.; Zhang, M.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhu, X. J.; Zucker, M. E.; Zuraw, S. E.; Zweizig, J.

    2016-01-01

    Following a major upgrade, the two advanced detectors of the Laser Interferometer Gravitational-wave Observatory (LIGO) held their first observation run between September 2015 and January 2016. With a strain sensitivity of 10−23/√Hz at 100 Hz, the product of observable volume and measurement time

  7. All-sky search for long-duration gravitational wave transients with initial LIGO

    NARCIS (Netherlands)

    Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Phythian-Adams, A.T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.T.; Aguiar, O. D.; Ain, A.; Ajith, P.; Allen, B.; Allocca, A.; Amariutei, D. V.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Babak, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, R.D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Behnke, B.; Bejger, M.; Belczynski, C.; Bell, A. S.; Bell, J.; Berger, B. K.; Bergman, J.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Birch, M.J.; Birney, R.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blair, C. D.; Blair, C. D.; Blair, R. M.; Bloemen, A.L.S.; Bock, O.; Bodiya, T. P.; Boer, M.; Bogaert, J.G.; Bogan, C.; Bohe, A.; Bojtos, P.; Bond, T.C; Bondu, F.; Bonnand, R.; Bork, R.; Boschi, V.; Bose, S.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Brooks, A. F.; Brown, A.D.; Brown, D.; Brown, D.; Brown, N. M.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderon Bustillo, J.; Callister, T. A.; Calloni, E.; Camp, J. B.; Cannon, K. C.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chakraborty, R.; Chalermsongsak, T.; Chamberlin, S. J.; Chan, M.; Chao, D. S.; Charlton, P.; Chassande-Mottin, E.; Chen, H. Y.; Chen, Y; Cheng, C.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Qian; Chua, S. E.; Chung, E.S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Constancio, M., Jr.; Conte, A.; Conti, L.; Cook, D.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, A.C.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Cripe, J.; Crowder, S. G.; Cumming, A.; Cunningham, A.L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Darman, N. S.; Dattilo, V.; Dave, I.; Daveloza, H. P.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; Debra, D.; Debreczeni, G.; Degallaix, J.; De laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dereli, H.; Dergachev, V.A.; DeRosa, R. T.; Rosa, R.; DeSalvo, R.; Dhurandhar, S.; Diaz, M. C.; Di Fiore, L.; Giovanni, M.G.; Di Lieto, A.; Di Palma, I.; Di Virgilio, A.; Dojcinoski, G.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Douglas, R.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H. -B.; Ehrens, P.; Eichholz, J. M.; Eikenberry, S. S.; Engels, W.; Essick, R. C.; Etzel, T.; Evans, T. M.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.M.; Fang, Q.; Farinon, S.; Farr, B.; Farr, W. M.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fisher, R. P.; Flaminio, R.; Fletcher, M; Fournier, J. -D.; Franco, S; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fricke, T. T.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H. A. G.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garufi, F.; Gatto, A.; Gaur, G.; Gehrels, N.; Gemme, G.; Gendre, B.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghosh, A.; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.P.; Glaefke, A.; Goetz, E.; Goetz, R.; Gondan, L.; Gonzalez, Idelmis G.; Castro, J. M. Gonzalez; Gopakumar, A.; Gordon, N. A.; Gorodetsky, M. L.; Gossan, S. E.; Lee-Gosselin, M.; Gouaty, R.; Graef, C.; Graff, P. B.; Granata, M.; Grant, A.; Gras, S.; Gray, C.M.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunwald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Buffoni-Hall, R.; Hall, E. D.; Hammond, G.L.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hanson, P.J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C. -J.; Haughian, K.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Hofman, D.; Hollitt, S. E.; Holt, K.; Holz, D. E.; Hopkins, P.; Hosken, D. J.; Hough, J.; Houston, E. A.; Howell, J.; Hu, Y. M.; Huang, S.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Idrisy, A.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J. -M.; Isi, M.; Islas, G.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jang, D.H.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jimenez-Forteza, F.; Johnson, W.; Jones, I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Haris, K.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.H.; Kanner, J. B.; Karki, S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kawazoe, F.; Kefelian, F.; Kehl, M. S.; Keitel, D.; Kelley, D. B.; Kells, W.; Kennedy, R.E.; Key, J. S.; Khalaidovski, A.; Khalili, F. Y.; Khan., S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, C.; Kim, J.; Kim, K.; Kim, Namjun; Kim, Namjun; Kim, Y.M.; King, E. J.; King, P. J.; Kinzel, D. L.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koehlenbeck, S. M.; Kokeyama, K.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kringel, V.; Krishnan, B.; Krolak, A.; Krueger, C.; Kuehn, G.; Kumar, P.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lange, J.; Lantz, B.; Lasky, P. D.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C.H.; Lee, K.H.; Lee, M.H.; Lee, K.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Levine, B. M.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Lockerbie, N. A.; Logue, J.; Lombardi, A. L.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lueck, H.; Lundgren, A. P.; Luo, J.; Lynch, R.; Ma, Y.; MacDonald, T.T.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magana-Sandoval, F.; Magee, R. M.; Mageswaran, M.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandel, I.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Marka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martin, R.M.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGuire, S. C.; McIntyre, G.; McIver, J.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mendell, G.; Mendoza-Gandara, D.; Mercer, R. A.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohapatra, S. R. P.; Montani, M.; Moore, B.C.; Moore, J.C.; Moraru, D.; Gutierrez Moreno, M.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, S.D.; Mukherjee, S.; Mullavey, A.; Munch, J.; Murphy, D. J.; Murray, P.G.; Mytidis, A.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Necula, V.; Nedkova, K.; Nelemans, G.; Gutierrez-Neri, M.; Neunzert, A.; Newton-Howes, G.; Nguyen, T. T.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J.; Oh, S. H.; Ohme, F.; Oliver, M. B.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; O'Shaughnessy, R.; Ott, C. D.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.S; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patrick, Z.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Pereira, R.R.; Perreca, A.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, M.; Pitkin, M.; Poggiani, R.; Post, A.; Powell, J.; Prasad, J.; Predoi, V.; Premachandra, S. S.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L. G.; Punturo, M.; Puppo, P.; Puerrer, M.; Qi, H.; Qin, J.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Reed, C. M.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Ricci, F.; Riles, K.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, J. D.; Romano, R.; Romanov, G.; Romie, J. H.; Rosinska, D.; Rowan, S.; Ruediger, A.; Ruggi, P.; Ryan, K.A.; Sachdev, P.S.; Sadecki, T.; Sadeghian, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Schilling, R.; Schmidt, J; Schmidt, P.; Schnabel, R.B.; Schofield, R. M. S.; Schoenbeck, A.; Schreiber, K.E.C.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, M.S.; Sellers, D.; Sentenac, D.; Sequino, V.; Sergeev, A.; Serna, G.; Setyawati, Y.; Sevigny, A.; Shaddock, D. A.; Shah, S.; Shahriar, M. S.; Shaltev, M.; Shao, Z.M.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sigg, D.; Silva, António Dias da; Simakov, D.; Singer, A; Singer, L. P.; Singh, A.; Singh, R.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, R. J. E.; Smith, N.D.; Smith, R. J. E.; Son, E. J.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, J.R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strauss, N. A.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sutton, P. J.; Swinkels, B. L.; Szczepanczyk, M. J.; Tacca, M.D.; Talukder, D.; Tanner, D. B.; Tapai, M.; Tarabrin, S. P.; Taracchini, A.; Taylor, W.R.; Theeg, T.; Thirugnanasambandam, M. P.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tomlinson, C.; Tonelli, M.; Torres, C. V.; Torrie, C. I.; Toeyrae, D.; Travasso, F.; Traylor, G.; Trifiro, D.; Tringali, M. C.; Trozzo, L.; Tse, M.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; Van Beuzekom, Martin; van den Brand, J. F. J.; Van Den Broeck, C.F.F.; van der Schaaf, L.; van der Sluys, M. V.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Vass, S.; Vasuth, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, J.; Venkateswara, K.; Verkindt, D.; Vetrano, F.; Vicere, A.; Vinciguerra, S.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, MT; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, M.; Wang, X.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Welborn, T.; Wen, L.M.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; White, D. J.; Whiting, B. F.; Williams, D.R.; Williamson, R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Worden, J.; Wright, J.L.; Wu, G.; Yablon, J.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yu, H.; Yvert, M.; Zadrozny, A.; Zangrando, L.; Zanolin, M.; Zendri, J. -P.; Zevin, M.; Zhang, F.; Zhang, L.; Zhang, M.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, X. J.; Zucker, M. E.; Zuraw, S. E.; Zweizig, J.

    2016-01-01

    We present the results of a search for long-duration gravitational wave transients in two sets of data collected by the LIGO Hanford and LIGO Livingston detectors between November 5, 2005 and September 30, 2007, and July 7, 2009 and October 20, 2010, with a total observational time of 283.0 days and

  8. THE INFRARED PROPERTIES OF SOURCES MATCHED IN THE WISE ALL-SKY AND HERSCHEL ATLAS SURVEYS

    Energy Technology Data Exchange (ETDEWEB)

    Bond, Nicholas A.; Benford, Dominic J.; Gardner, Jonathan P. [Cosmology Laboratory (Code 665), NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Amblard, Alexandre [Astrophysics Branch, NASA/Ames Research Center, MS 245-6, Moffett Field, CA 94035 (United States); Fleuren, Simone [School of Mathematical Sciences, Queen Mary, University of London, Mile End Road, London E1 4NS (United Kingdom); Blain, Andrew W. [Department of Physics and Astronomy, University of Leicester, University Road, Leicester LE1 7RH (United Kingdom); Dunne, Loretta; Maddox, Steve J.; Hoyos, Carlos; Bourne, Nathan [School of Physics and Astronomy, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Smith, Daniel J. B.; Bonfield, David [Centre for Astrophysics Research, Science and Technology Research Institute, University of Hertfordshire, Hatfield, Herts AL10 9AB (United Kingdom); Baes, Maarten [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Bridge, Carrie [Division of Physics, Mathematics, and Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Buttiglione, Sara; De Zotti, Gianfranco [INAF-Osservatorio Astronomico di Padova, Vicolo Osservatorio 5, I-35122 Padova (Italy); Cava, Antonio [Departamento de Astrofisica, Facultad de CC. Fisicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Clements, David [Imperial College, Astrophysics Group, Blackett Lab, Prince Consort Road, London SW7 2AZ (United Kingdom); Cooray, Asantha [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Dariush, Ali [Physics Department, Imperial College London, South Kensington Campus, SW7 2AZ (United Kingdom); and others

    2012-05-01

    We describe the infrared properties of sources detected over {approx}36 deg{sup 2} of sky in the GAMA 15 hr equatorial field, using data from both the Herschel Astrophysical Terahertz Large-Area Survey (H-ATLAS) and Wide-field Infrared Survey (WISE). With 5{sigma} point-source depths of 34 and 0.048 mJy at 250 {mu}m and 3.4 {mu}m, respectively, we are able to identify 50.6% of the H-ATLAS sources in the WISE survey, corresponding to a surface density of {approx}630 deg{sup -2}. Approximately two-thirds of these sources have measured spectroscopic or optical/near-IR photometric redshifts of z < 1. For sources with spectroscopic redshifts at z < 0.3, we find a linear correlation between the infrared luminosity at 3.4 {mu}m and that at 250 {mu}m, with {+-}50% scatter over {approx}1.5 orders of magnitude in luminosity, {approx}10{sup 9}-10{sup 10.5} L{sub Sun }. By contrast, the matched sources without previously measured redshifts (r {approx}> 20.5) have 250-350 {mu}m flux density ratios which suggest either high-redshift galaxies (z {approx}> 1.5) or optically faint low-redshift galaxies with unusually low temperatures (T {approx}< 20). Their small 3.4-250 {mu}m flux ratios favor a high-redshift galaxy population, as only the most actively star-forming galaxies at low redshift (e.g., Arp 220) exhibit comparable flux density ratios. Furthermore, we find a relatively large active galactic nucleus fraction ({approx}30%) in a 12 {mu}m flux-limited subsample of H-ATLAS sources, also consistent with there being a significant population of high-redshift sources in the no-redshift sample.

  9. All-sky signals from recombination to reionization with the SKA

    NARCIS (Netherlands)

    Subrahmanyan, R.; Shankar, U. N.; Pritchard, J.; Vedantham, H. K.

    2015-01-01

    Cosmic evolution in the hydrogen content of the Universe through recombination and up to the end of reionization is expected to be revealed as subtle spectral features in the uniform extragalactic cosmic radio background. The redshift evolution in the excitation temperature of the 21-cm spin flip

  10. Light-pollution measurement with the Wide-field all-sky image analyzing monitoring system

    Science.gov (United States)

    Vítek, S.

    2017-07-01

    The purpose of this experiment was to measure light pollution in the capital of Czech Republic, Prague. As a measuring instrument is used calibrated consumer level digital single reflex camera with IR cut filter, therefore, the paper reports results of measuring and monitoring of the light pollution in the wavelength range of 390 - 700 nm, which most affects visual range astronomy. Combining frames of different exposure times made with a digital camera coupled with fish-eye lens allow to create high dynamic range images, contain meaningful values, so such a system can provide absolute values of the sky brightness.

  11. Retrieval of Garstang's emission function from all-sky camera images

    Science.gov (United States)

    Kocifaj, Miroslav; Solano Lamphar, Héctor Antonio; Kundracik, František

    2015-10-01

    The emission function from ground-based light sources predetermines the skyglow features to a large extent, while most mathematical models that are used to predict the night sky brightness require the information on this function. The radiant intensity distribution on a clear sky is experimentally determined as a function of zenith angle using the theoretical approach published only recently in MNRAS, 439, 3405-3413. We have made the experiments in two localities in Slovakia and Mexico by means of two digital single lens reflex professional cameras operating with different lenses that limit the system's field-of-view to either 180º or 167º. The purpose of using two cameras was to identify variances between two different apertures. Images are taken at different distances from an artificial light source (a city) with intention to determine the ratio of zenith radiance relative to horizontal irradiance. Subsequently, the information on the fraction of the light radiated directly into the upward hemisphere (F) is extracted. The results show that inexpensive devices can properly identify the upward emissions with adequate reliability as long as the clear sky radiance distribution is dominated by a largest ground-based light source. Highly unstable turbidity conditions can also make the parameter F difficult to find or even impossible to retrieve. The measurements at low elevation angles should be avoided due to a potentially parasitic effect of direct light emissions from luminaires surrounding the measuring site.

  12. VHE Gamma-ray Supernova Remnants

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /KIPAC, Menlo Park

    2007-01-22

    Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.

  13. THE WISE BLAZAR-LIKE RADIO-LOUD SOURCES: AN ALL-SKY CATALOG OF CANDIDATE γ-RAY BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    D' Abrusco, R.; Paggi, A.; Smith, H. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Masetti, N. [INAF/IASF di Bologna, via Gobetti 101, I-40129 Bologna (Italy); Landoni, M. [INAF/Osservatorio Astronomico di Brera, Via E. Bianchi 46, I-23807 Merate (Italy); Tosti, G. [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)

    2014-11-01

    We present a catalog of radio-loud candidate γ-ray emitting blazars with WISE mid-infrared colors similar to the colors of confirmed γ-ray blazars. The catalog is assembled from WISE sources detected in all four WISE filters, with colors compatible with the three-dimensional locus of the WISE γ-ray emitting blazars, and which can be spatially cross-matched with radio sources from one of the three radio surveys: NVSS, FIRST, and/or SUMSS. Our initial WISE selection uses a slightly modified version of previously successful algorithms. We then select only the radio-loud sources using a measure of the radio-to-IR flux, the q {sub 22} parameter, which is analogous to the q {sub 24} parameter known in the literature but which instead uses the WISE band-four flux at 22 μm. Our final catalog contains 7855 sources classified as BL Lacs, FSRQs, or mixed candidate blazars; 1295 of these sources can be spatially re-associated as confirmed blazars. We describe the properties of the final catalog of WISE blazar-like radio-loud sources and consider possible contaminants. Finally, we discuss why this large catalog of candidate γ-ray emitting blazars represents a new and useful resource to address the problem of finding low-energy counterparts to currently unidentified high-energy sources.

  14. An all-sky, three-flavor search for neutrinos from gamma-ray bursts with the icecube neutrino observatory

    Science.gov (United States)

    Hellauer, Robert Eugene, III

    Ultra high energy cosmic rays (UHECRs), defined by energy greater than 10. 18 eV, have been observed for decades, but their sources remain unknown. Protons and heavy ions, which comprise cosmic rays, interact with galactic and intergalactic magnetic fields and, consequently, do not point back to their sources upon measurement. Neutrinos, which are inevitably produced in photohadronic interactions, travel unimpeded through the universe and disclose the directions of their sources. Among the most plausible candidates for the origins of UHECRs is a class of astrophysical phenomena known as gamma-ray bursts (GRBs). GRBs are the most violent and energetic events witnessed in the observable universe. The IceCube Neutrino Observatory, located in the glacial ice 1450 m to 2450 m below the South Pole surface, is the largest neutrino detector in operation. IceCube detects charged particles, such as those emitted in high energy neutrino interactions in the ice, by the Cherenkov light radiated by these particles. The measurement of neutrinos of 100 TeV energy or greater in IceCube correlated with gamma-ray photons from GRBs, measured by spacecraft detectors, would provide evidence of hadronic interaction in these powerful phenomena and confirm their role in ultra high energy cosmic ray production. This work presents the first IceCube GRB-neutrino coincidence search optimized for charged-current interactions of electron and tau neutrinos as well as neutral-current interactions of all neutrino flavors, which produce nearly spherical Cherenkov light showers in the ice. These results for three years of data are combined with the results of previous searches over four years of data optimized for charged-current muon neutrino interactions, which produce extended Cherenkov light tracks. Several low significance events correlated with GRBs were detected, but are consistent with the background expectation from atmospheric muons and neutrinos. The combined results produce limits that place the strongest constraints thus far on models of neutrino and UHECR production in GRB fireballs.

  15. GOALS, STRATEGIES AND FIRST DISCOVERIES OF AO327, THE ARECIBO ALL-SKY 327 MHz DRIFT PULSAR SURVEY

    Energy Technology Data Exchange (ETDEWEB)

    Deneva, J. S. [Arecibo Observatory, HC3 Box 53995, Arecibo, PR 00612 (United States); Stovall, K.; Martinez, J. G.; Jenet, F. [Center for Advanced Radio Astronomy, Department of Physics and Astronomy, University of Texas at Brownsville, Brownsville, TX 78520 (United States); McLaughlin, M. A.; Bates, S. D.; Bagchi, M. [Department of Physics, West Virginia University, 111 White Hall, Morgantown, WV 26506 (United States); Freire, P. C. C. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany)

    2013-09-20

    We report initial results from AO327, a drift survey for pulsars with the Arecibo telescope at 327 MHz. The first phase of AO327 will cover the sky at declinations of –1° to 28°, excluding the region within 5° of the Galactic plane, where high scattering and dispersion make low-frequency surveys sub-optimal. We record data from a 57 MHz bandwidth with 1024 channels and 125 μs sampling time. The 60 s transit time through the AO327 beam means that the survey is sensitive to very tight relativistic binaries even with no acceleration searches. To date we have detected 44 known pulsars with periods ranging from 3 ms to 2.21 s and discovered 24 new pulsars. The new discoveries include 3 ms pulsars, three objects with periods of a few tens of milliseconds typical of young as well as mildly recycled pulsars, a nuller, and a rotating radio transient. Five of the new discoveries are in binary systems. The second phase of AO327 will cover the sky at declinations of 28°-38°. We compare the sensitivity and search volume of AO327 to the Green Bank North Celestial Cap survey and the GBT350 drift survey, both of which operate at 350 MHz.

  16. Optical Sky Brightness and Transparency during the Winter Season at Dome A Antarctica from the Gattini-All-Sky Camera

    Science.gov (United States)

    Yang, Yi; Moore, Anna M.; Krisciunas, Kevin; Wang, Lifan; Ashley, Michael C. B.; Fu, Jianning; Brown, Peter J.; Cui, Xiangqun; Feng, Long-Long; Gong, Xuefei; Hu, Zhongwen; Lawrence, Jon S.; Luong-Van, Daniel; Riddle, Reed L.; Shang, Zhaohui; Sims, Geoff; Storey, John W. V.; Suntzeff, Nicholas B.; Tothill, Nick; Travouillon, Tony; Yang, Huigen; Yang, Ji; Zhou, Xu; Zhu, Zhenxi

    2017-07-01

    The summit of the Antarctic plateau, Dome A, is proving to be an excellent site for optical, near-infrared, and terahertz astronomical observations. Gattini is a wide-field camera installed on the PLATO instrument module as part of the Chinese-led traverse to Dome A in 2009 January. We present here the measurements of sky brightness with the Gattini ultra-large field of view (90^\\circ × 90^\\circ ) in the photometric B-, V-, and R-bands; cloud cover statistics measured during the 2009 winter season; and an estimate of the sky transparency. A cumulative probability distribution indicates that the darkest 10% of the nights at Dome A have sky brightness of S B = 22.98, S V = 21.86, and S R = 21.68 mag arcsec-2. These values were obtained during the year 2009 with minimum aurora, and they are comparable to the faintest sky brightness at Maunakea and the best sites of northern Chile. Since every filter includes strong auroral lines that effectively contaminate the sky brightness measurements, for instruments working around the auroral lines, either with custom filters or with high spectral resolution instruments, these values could be easily obtained on a more routine basis. In addition, we present example light curves for bright targets to emphasize the unprecedented observational window function available from this ground-based site. These light curves will be published in a future paper.

  17. A long-term observation of 4U 1700-37 by the granat/watch all-sky monitor

    DEFF Research Database (Denmark)

    Sazonov, S.; Lapshov, I.; Sunyaev, R.

    1995-01-01

    with the help of Monte-Carlo simulations and derive the basic parameters of the stellar wind. We show that the wind in 4U 1700-37 well fits in the radiatively driven stellar wind theory. Our measurement of the mid-eclipse time together with the measurements of other experiments imply a decrease in the period...

  18. Ionospheric Response to St. Patrick's Day Storm of 2015 Over Indian Region: Ionosonde and All-Sky Imager Observations

    Science.gov (United States)

    Gupta, S.; Upadhayaya, A. K.; Taori, A. K.; Kotnala, R. K.

    2017-12-01

    The St. Patrick's Day Storm of 2015 was the first superstorm of 24th solar cycle, with Dst dipping down to -223 nT. The response of this severe (G4) storm is studied using ionosonde data at low-mid latitude Indian station, Delhi (28.6°N, 77.2°E), along with 630.0 nm night airglow observations from low latitude Indian station, Gadanki (13.5°N, 79.2°E). A peculiar occurrence of additional stratification, not observed before at this latitude, is found to be present between F1 and F2 layers before the SSC of the storm. This observed extra stratification in F layer (F1.5) is attributed to TIDs during vertically uplifted F region. Apart from this, additional stratification above F2 layer, lasting for about half an hour, was seen during this storm. A large variation in F2 layer critical parameters, showing both positive and negative phases, with electron density enhancement of 264% and depression of 65%, is observed during this storm. Contrary to the previous reports, Spread-F occurrence at Delhi do not follow anticorrelation with solar activity. The night airglow observations of 630.0 nm from Gadanki indicates towards the presence of external forcing which results in drifting of plasma in the opposite direction (westward) to that of normally seen, during this St. Patrick's Day storm of 2015. The variation in neutral composition (O/N2 taken from GUVI) is found during this storm. This result suggests O/N2 ratio to be a vital contributor, apart from the electric field and neutral wind, in determining the ionospheric response to such transient events.

  19. Luminosity and Intrinsic Color Calibration of Main-Sequence Stars With 2Mass Photometry: All Sky Local Extinction

    Directory of Open Access Journals (Sweden)

    Knude Jens

    2003-12-01

    Full Text Available We present a new color index vs. absolute magnitude calibration of 2MASS JHK photometry. For the A0 to ~G5 and M segments of the main sequence information on the amount of interstellar extinction and its location in space may be obtained.

  20. THE ALL-SKY GEOS RR Lyr SURVEY WITH THE TAROT TELESCOPES: ANALYSIS OF THE BLAZHKO EFFECT

    International Nuclear Information System (INIS)

    Le Borgne, J.-F.; Klotz, A.; Poretti, E.; Boër, M.; Butterworth, N.; Dvorak, S.; Dumont, M.; Hambsch, F.-J.; Vandenbroere, J.; Hund, F.; Kugel, F.; Vilalta, J. M.

    2012-01-01

    We used the GEOS database to study the Blazhko effect of galactic RRab stars. The database is continuously enriched by maxima supplied by amateur astronomers and by a dedicated survey by means of the two TAROT robotic telescopes. The same value of the Blazhko period is observed at different values of the pulsation periods and different values of the Blazhko periods are observed at the same value of the pulsation period. There are clues suggesting that the Blazhko effect is changing from one cycle to the next. The secular changes in the pulsation and Blazhko periods of Z CVn are anticorrelated. The diagrams of magnitudes against phases of the maxima clearly show that the light curves of Blazhko variables can be explained as modulated signals, both in amplitude and in frequency. The closed curves describing the Blazhko cycles in such diagrams have different shapes, reflecting the phase shifts between the epochs of the brightest maximum and the maximum O – C. Our sample shows that both clockwise and counterclockwise directions are possible for similar shapes. The improved observational knowledge of the Blazhko effect, in addition to some peculiarities of the light curves, has yet to be explained by a satisfactory physical mechanism.

  1. THE ALL-SKY GEOS RR Lyr SURVEY WITH THE TAROT TELESCOPES: ANALYSIS OF THE BLAZHKO EFFECT

    Energy Technology Data Exchange (ETDEWEB)

    Le Borgne, J.-F.; Klotz, A.; Poretti, E. [Universite de Toulouse, UPS-OMP, IRAP, 31400 Toulouse (France); Boeer, M. [ARTEMIS, Universite Nice Sophia-Antipolis, CNRS, Observatoire de la Cote d' Azur, Nice (France); Butterworth, N.; Dvorak, S. [American Association of Variable Star Observers (AAVSO), 49 Bay State Rd., Cambridge, MA 02138 (United States); Dumont, M.; Hambsch, F.-J.; Vandenbroere, J. [Groupe Europeen d' Observations Stellaires (GEOS), 23 Parc de Levesville, 28300 Bailleau l' Eveque (France); Hund, F. [Bundesdeutsche Arbeitsgemeinschaft fuer Veraenderliche Sterne e.V. (BAV), Munsterdamm 90, 12169 Berlin (Germany); Kugel, F. [Observatoire Chante-Perdrix, 04150 Banon (France); Vilalta, J. M. [Agrupacio Astronomica de Sabadell (AAS), Apartat de Correus, 50, 08200 Sabadell, Barcelona (Spain)

    2012-08-15

    We used the GEOS database to study the Blazhko effect of galactic RRab stars. The database is continuously enriched by maxima supplied by amateur astronomers and by a dedicated survey by means of the two TAROT robotic telescopes. The same value of the Blazhko period is observed at different values of the pulsation periods and different values of the Blazhko periods are observed at the same value of the pulsation period. There are clues suggesting that the Blazhko effect is changing from one cycle to the next. The secular changes in the pulsation and Blazhko periods of Z CVn are anticorrelated. The diagrams of magnitudes against phases of the maxima clearly show that the light curves of Blazhko variables can be explained as modulated signals, both in amplitude and in frequency. The closed curves describing the Blazhko cycles in such diagrams have different shapes, reflecting the phase shifts between the epochs of the brightest maximum and the maximum O - C. Our sample shows that both clockwise and counterclockwise directions are possible for similar shapes. The improved observational knowledge of the Blazhko effect, in addition to some peculiarities of the light curves, has yet to be explained by a satisfactory physical mechanism.

  2. Dicty_cDB: VHE361 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nsnnnqptnfnsstsspilsgnnnnnnnnnnnnn nninnnnnnnsnnnnnmntsnptnqqssviisddmddvqtnxnppnpqyplspnsvnrgn npsnismsgaqrsapliisp...nqptnfnsstsspilsgnnnnnnnnnnnnn nninnnnnnnsnnnnnmntsnptnqqssviisddmddvqtnxnppnpqyplspnsvnrgn npsnismsgaqrsapliisp

  3. VHE gamma-rays from radio pulsars and cataclysmic variables

    International Nuclear Information System (INIS)

    De Jager, O.C.; Brink, C.; Meintjies, P.J.; Nel, H.I.; North, A.R.; Raubenheimer, B.C.; Van der Walt, D.J.

    1990-01-01

    We present the results of observations (above 1 TeV) of radio pulsars and cataclysmic variables with the Potchefstroom air Cerenkov facility. We were able to confirm our previous detection of PSR 1509-58 and the final significance is 1.7x10 -5 . A DC enhancement at the 10 -3 significance level was seen from the L 4 Lagrange position in the PSR 1957+20 system. This result was confirmed by COS-B data. We were also able to detect the 5.4 ms pulsar PSR 1855+09 at a marginal significance level of 5%. However, the best and longest observation indicates non-uniformity at the 0.005 significance level. The TeV light curve resembles the radio light curve. The latter is also reminiscent of other millisecond pulsar observed above 1 TeV. The intermediate polar AEAQR (P = 33.08s) shows a period shift which is consistent with recent model predictions. However, the present significance of this results does not allow an unambiguous claim. (orig.)

  4. Dicty_cDB: VHE211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F143854.1 Sinantherina socialis 82 kD heat shock protein (hsp82) gene, partial cd...Naegleria gruberi strain ATCC 30224 heat shock protein 90 (HSP-90) gene, partial cds. 86 3e-46 7 AF143854 |A

  5. Dicty_cDB: VHE632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIFXFFFXKKK--- ---YKKLFINNIYIQWVTEHSKHTTVTT*aldtitsrpttvitiitltsisktteaklx* epiavntfqlvtinkftshttytvtnqxst*...tshttytvtnqxst*ntttvkxqskvittxtylltvtvmsxxpi ttiimlxskntsykqinkxkkk Homology vs CSM-cDNA Score E Sequences p

  6. Dicty_cDB: VHE841 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available niaqfvviq*kmkekkkil*llanivinqftix aikil*itlkmsxsfinvxivlvtsx*nxvgiigvveektpkkslgkrkkk Frame C: ---*n*merklym...l*xlffkrf**kikilpnl*sfnkr*rrrrrfynylpils*issrsl rskyyr*x*k*afhl*msxly**xanktx*e*l

  7. Dicty_cDB: VHE875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16 3 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL...4181, mRNA sequence. 72 1e-16 3 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle

  8. Dicty_cDB: VHE489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Value N EL477374 |EL477374.1 CHUL5577.b1_A04.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxuscDNA clone ...CHUL5577, mRNA sequence. 52 0.015 1 EL474819 |EL474819.1 CHUL2764.b1_G19.ab1 CHU(LMS) puzzle

  9. Dicty_cDB: VHE642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA clone GR__Ea43H12 3', mRNA sequence. 58 6e-17 4 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle s...unflower Helianthus paradoxus cDNA clone CHUX465, mRNA sequence. 72 2e-16 4 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle

  10. Dicty_cDB: VHE271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

  11. Dicty_cDB: VHE123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 4e-21 ...none) Micromonas sp. RCC299 chromosome... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 BC171956_1( BC17...1956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 AB006708_10( AB006708 |pid:none) Arabidopsis

  12. Dicty_cDB: VHE487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CNMS7844.b1_H17.ab1 CNM(LMS) spotted knapweed Centaurea maculosacDNA clone CNMS7844, mRNA sequence. 38 0.016... 2 EH740364 |EH740364.1 CNMS13648.b1_O04.ab1 CNM(LMS) spotted knapweed Centaurea maculosa cDNA clone CNMS136

  13. Dicty_cDB: VHE245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 71 4e-11 AY892312_1( AY892312 |p... reading fra... 70 8e-11 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 70 8e-11 prot

  14. Dicty_cDB: VHE759 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0

  15. Dicty_cDB: VHE244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms... Frame A: vgkvliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms

  16. Generating Units

    Data.gov (United States)

    Department of Homeland Security — Generating Units are any combination of physically connected generators, reactors, boilers, combustion turbines, and other prime movers operated together to produce...

  17. Generational diversity.

    Science.gov (United States)

    Kramer, Linda W

    2010-01-01

    Generational diversity has proven challenges for nurse leaders, and generational values may influence ideas about work and career planning. This article discusses generational gaps, influencing factors and support, and the various generational groups present in today's workplace as well as the consequences of need addressing these issues. The article ends with a discussion of possible solutions.

  18. Isotope generator

    International Nuclear Information System (INIS)

    1979-01-01

    The patent describes an isotope generator incorporating the possibility of stopping elution before the elution vessel is completely full. Sterile ventilation of the whole system can then occur, including of both generator reservoir and elution vessel. A sterile, and therefore pharmaceutically acceptable, elution fluid is thus obtained and the interior of the generator is not polluted with non-sterile air. (T.P.)

  19. Instant Generation

    Science.gov (United States)

    Loveland, Elaina

    2017-01-01

    Generation Z students (born between 1995-2010) have replaced millennials on college campuses. Generation Z students are entrepreneurial, desire practical skills with their education, and are concerned about the cost of college. This article presents what need to be known about this new generation of students.

  20. Optimising generators

    Energy Technology Data Exchange (ETDEWEB)

    Guerra, E.J.; Garcia, A.O.; Graffigna, F.M.; Verdu, C.A. (IMPSA (Argentina). Generators Div.)

    1994-11-01

    A new computer tool, the ARGEN program, has been developed for dimensioning large hydroelectric generators. This results in better designs, and reduces calculation time for engineers. ARGEN performs dimensional tailoring of salient pole synchronous machines in generators, synchronous condensers, and generator-motors. The operation and uses of ARGEN are explained and its advantages are listed in this article. (UK)

  1. Wind Generators

    Science.gov (United States)

    1989-01-01

    When Enerpro, Inc. president, Frank J. Bourbeau, attempted to file a patent on a system for synchronizing a wind generator to the electric utility grid, he discovered Marshall Space Flight Center's Frank Nola's power factor controller. Bourbeau advanced the technology and received a NASA license and a patent for his Auto Synchronous Controller (ASC). The ASC reduces generator "inrush current," which occurs when large generators are abruptly brought on line. It controls voltage so the generator is smoothly connected to the utility grid when it reaches its synchronous speed, protecting the components from inrush current damage. Generator efficiency is also increased in light winds by applying lower than rated voltage. Wind energy is utilized to drive turbines to generate electricity for utility companies.

  2. Generative Semantics.

    Science.gov (United States)

    King, Margaret

    The first section of this paper deals with the attempts within the framework of transformational grammar to make semantics a systematic part of linguistic description, and outlines the characteristics of the generative semantics position. The second section takes a critical look at generative semantics in its later manifestations, and makes a case…

  3. Generative Semantics

    Science.gov (United States)

    Bagha, Karim Nazari

    2011-01-01

    Generative semantics is (or perhaps was) a research program within linguistics, initiated by the work of George Lakoff, John R. Ross, Paul Postal and later McCawley. The approach developed out of transformational generative grammar in the mid 1960s, but stood largely in opposition to work by Noam Chomsky and his students. The nature and genesis of…

  4. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2008-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  5. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2010-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  6. Pulse Generator

    Science.gov (United States)

    Greer, Lawrence (Inventor)

    2017-01-01

    An apparatus and a computer-implemented method for generating pulses synchronized to a rising edge of a tachometer signal from rotating machinery are disclosed. For example, in one embodiment, a pulse state machine may be configured to generate a plurality of pulses, and a period state machine may be configured to determine a period for each of the plurality of pulses.

  7. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2007-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  8. Steam generator

    International Nuclear Information System (INIS)

    Fenet, J.-C.

    1980-01-01

    Steam generator particularly intended for use in the coolant system of a pressurized water reactor for vaporizing a secondary liquid, generally water, by the primary cooling liquid of the reactor and comprising special arrangements for drying the steam before it leaves the generator [fr

  9. Energy generation

    CSIR Research Space (South Africa)

    Osburn, L

    2009-02-01

    Full Text Available Current perceptions conjure images of photovoltaic panels and wind turbines when green building or sustainable development is discussed. How energy is used and how it is generated are core components of both green building and sustainable...

  10. Radionuclide generators

    International Nuclear Information System (INIS)

    Lambrecht, R.M.; Wollongong Univ.; Tomiyoshi, K.; Sekine, T.

    1997-01-01

    The present status and future directions of research and development on radionuclide generator technology are reported. The recent interest to develop double-neutron capture reactions for production of in vivo generators; neutron rich nuclides for radio-immunotherapeutic pharmaceuticals: and advances with ultra-short lived generators is highlighted. Emphasis is focused on: production of the parent radionuclide; the selection and the evaluation of support materials and eluents with respect to the resultant radiochemical yield of the daughter, and the breakthrough of the radionuclide parent: and, the uses of radionuclide generators in radiopharmaceutical chemistry, biomedical and industrial applications. The 62 Zn → 62 Cu, 66 Ni → 66 Cu, 103m Rh → 103 Rh, 188 W → 188 Re and the 225 Ac → 221 Fr → 213 Bi generators are predicted to be emphasized for future development. Coverage of the 99 Mo → 99m Tc generator was excluded, as it the subject of another review. The literature search ended June, 1996. (orig.)

  11. Radionuclide generators

    International Nuclear Information System (INIS)

    Lambrecht, R.M.

    1983-01-01

    The status of radionuclide generators for chemical research and applications related to the life sciences and biomedical research are reviewed. Emphasis is placed upon convenient, efficient and rapid separation of short-lived daughter radionuclides in a chemical form suitable for use without further chemical manipulation. The focus is on the production of the parent, the radiochemistry associated with processing the parent and daughter, the selection and the characteristic separation methods, and yields. Quality control considerations are briefly noted. The scope of this review includes selected references to applications of radionuclide generators in radiopharmaceutical chemistry, and the life sciences, particularly in diagnostic and therapeutic medicine. The 99 Mo-sup(99m)Tc generator was excluded. 202 references are cited. (orig.)

  12. Generation Next

    Science.gov (United States)

    Hawkins, B. Denise

    2010-01-01

    There is a shortage of accounting professors with Ph.D.s who can prepare the next generation. To help reverse the faculty deficit, the American Institute of Certified Public Accountants (CPAs) has created the new Accounting Doctoral Scholars program by pooling more than $17 million and soliciting commitments from more than 70 of the nation's…

  13. Generative Contexts

    Science.gov (United States)

    Lyles, Dan Allen

    Educational research has identified how science, technology, engineering, and mathematics (STEM) practice and education have underperforming metrics in racial and gender diversity, despite decades of intervention. These disparities are part of the construction of a culture of science that is alienating to these populations. Recent studies in a social science framework described as "Generative Justice" have suggested that the context of social and scientific practice might be modified to bring about more just and equitable relations among the disenfranchised by circulating the value they and their non-human allies create back to them in unalienated forms. What is not known are the underlying principles of social and material space that makes a system more or less generative. I employ an autoethnographic method at four sites: a high school science class; a farm committed to "Black and Brown liberation"; a summer program geared towards youth environmental mapping; and a summer workshop for Harlem middle school students. My findings suggest that by identifying instances where material affinity, participatory voice, and creative solidarity are mutually reinforcing, it is possible to create educational contexts that generate unalienated value, and circulate it back to the producers themselves. This cycle of generation may help explain how to create systems of justice that strengthen and grow themselves through successive iterations. The problem of lack of diversity in STEM may be addressed not merely by recruiting the best and the brightest from underrepresented populations, but by changing the context of STEM education to provide tools for its own systematic restructuring.

  14. Steam generators

    International Nuclear Information System (INIS)

    Hayden, R.L.J.

    1979-01-01

    Steam generators for nuclear reactors are designed so that deposition of solids on the surface of the inlet side of the tubesheet or the inlet header with the consequent danger of corrosion and eventual tube failure is obviated or substantially reduced. (U.K.)

  15. Thermoelectric generator

    International Nuclear Information System (INIS)

    Purdy, D.L.

    1978-01-01

    The main components of a thermoelectric generator are housed in an evacuated cylindrical vessel. In the middle of it there is the radioactive heat source, e.g. 90 Sr or 238 Pu, enclosed by a gamma radiation shield. This one is surrounded by a heat-insulating screen from getter material or indicidual sheets of titanium. In the bottom of the screen there are arranged several thermocouples on a circle. The thermocouples themselves are contained within casings sealed gas-tight and filled with an inert gas, e.g. argon. By separating the internal space of the generator vessel from the thermocouple casings, made of e.g. n- respectively p-doped lead telluride cylinders, for both the optimal gas state may be obtained. (DG) [de

  16. A TWO MICRON ALL SKY SURVEY VIEW OF THE SAGITTARIUS DWARF GALAXY. VI. s-PROCESS AND TITANIUM ABUNDANCE VARIATIONS ALONG THE SAGITTARIUS STREAM

    International Nuclear Information System (INIS)

    Chou, Mei-Yin; Majewski, Steven R.; Patterson, Richard J.; Cunha, Katia; Smith, Verne V.; Martinez-Delgado, David; Geisler, Doug

    2010-01-01

    We present high-resolution spectroscopic measurements of the abundances of the α element titanium (Ti) and s-process elements yttrium (Y) and lanthanum (La) for 59 candidate M giant members of the Sagittarius (Sgr) dwarf spheroidal (dSph) + tidal tail system pre-selected on the basis of position and radial velocity (RV). As expected, the majority of these stars show peculiar abundance patterns compared to those of nominal Milky Way (MW) stars, but as a group, the stars form a coherent picture of chemical enrichment of the Sgr dSph from [Fe/H] = -1.4 to solar abundance. This sample of spectra provides the largest number of Ti, La, and Y abundances yet measured for a dSph, and spans metallicities not typically probed by studies of the other, generally more metal-poor MW satellites. On the other hand, the overall [Ti/Fe], [Y/Fe], [La/Fe], and [La/Y] patterns with [Fe/H] of the Sgr stream plus Sgr core do, for the most part, resemble those seen in the Large Magellanic Cloud (LMC) and other dSphs, only shifted by Δ[Fe/H] ∼ +0.4 from the LMC and by ∼+1 dex from the other dSphs; these relative shifts reflect the faster and/or more efficient chemical evolution of Sgr compared to the other satellites, and show that Sgr has had an enrichment history more like the LMC than the other dSphs. By tracking the evolution of the abundance patterns along the Sgr stream we can follow the time variation of the chemical make-up of dSph stars donated to the Galactic halo by Sgr. This evolution demonstrates that while the bulk of the stars currently in the Sgr dSph is quite unlike those of the Galactic halo, an increasing number of stars farther along the Sgr stream have abundances like MW halo stars, a trend that shows clearly how the Galactic halo could have been contributed by present-day satellite galaxies even if the present chemistry of those satellites is now different from typical halo field stars. Finally, we analyze the chemical abundances of a moving group of M giants among the Sgr leading arm stars at the North Galactic Cap, but having RVs unlike the infalling Sgr leading arm debris there. Through use of 'chemical fingerprinting', we conclude that these mostly receding northern hemisphere M giants also are Sgr stars, likely trailing arm debris overlapping the Sgr leading arm in the north.

  17. Dwarfs Cooler Than M: The Definition of Spectral Type L Using Discoveries form the 2-Micron All-Sky Survey (2MASS)

    Science.gov (United States)

    Kirkpatrick, J.; Reid, I.; Liebert, J.; Cutri, R.; Nelson, B.; Beichan, C.; Dahn, C.; Monet, D.; Gizis, J.; Skrutskie, M.

    2000-01-01

    Because the TiO and VO bands, which dominate the far-optical portions of late-M spectra, disappear in these cooler dwarfs, we define a new spectral class L in wich metallic oxides are replaced by metallic hydrides and neutral alkali metals as the major spectroscopic signatures.

  18. All-Sky Spectrally Matched UBVRI - ZY and u‧ g‧ r‧ i‧ z‧ Magnitudes for Stars in the Tycho2 Catalog

    Science.gov (United States)

    Pickles, A.; Depagne, É.

    2010-12-01

    We present fitted UBVRI - ZY and u‧ g‧ r‧ i‧ z‧ magnitudes, spectral types, and distances for 2.4 million stars, derived from synthetic photometry of a library spectrum that best matches the Tycho2 BT VT, NOMAD RN, and 2MASS JHK2/S catalog magnitudes. We present similarly synthesized multifilter magnitudes, types, and distances for 4.8 million stars with 2MASS and SDSS photometry to g digital images with fields of view of 0.5° or more. Using several such standards per field, automatic flux calibration can be achieved to a few percent in any filter, at any air mass, in most workable observing conditions, to facilitate intercomparison of data from different sites, telescopes, and instruments.

  19. Cluster generator

    Science.gov (United States)

    Donchev, Todor I [Urbana, IL; Petrov, Ivan G [Champaign, IL

    2011-05-31

    Described herein is an apparatus and a method for producing atom clusters based on a gas discharge within a hollow cathode. The hollow cathode includes one or more walls. The one or more walls define a sputtering chamber within the hollow cathode and include a material to be sputtered. A hollow anode is positioned at an end of the sputtering chamber, and atom clusters are formed when a gas discharge is generated between the hollow anode and the hollow cathode.

  20. Photon generator

    Science.gov (United States)

    Srinivasan-Rao, Triveni

    2002-01-01

    A photon generator includes an electron gun for emitting an electron beam, a laser for emitting a laser beam, and an interaction ring wherein the laser beam repetitively collides with the electron beam for emitting a high energy photon beam therefrom in the exemplary form of x-rays. The interaction ring is a closed loop, sized and configured for circulating the electron beam with a period substantially equal to the period of the laser beam pulses for effecting repetitive collisions.

  1. Event generators

    International Nuclear Information System (INIS)

    Durand, D.; Gulminelli, F.; Lopez, O.; Vient, E.

    1998-01-01

    The results concerning the heavy ion collision simulations at Fermi energies by means of phenomenological models obtained in the last two years ar presented. The event generators are essentially following the phase of elaboration of analysis methods of data obtained by INDRA or NAUTILUS 4 π multidetectors. To identify and correctly quantify a phenomenon or a physical quantity it is necessary to verify by simulation the feasibility and validity of the analysis and also to estimate the bias introduced by the experimental filter. Many studies have shown this, for instance: the determination of the collision reaction plan for flow studies, determination of kinematical characteristics of the quasi-projectiles, and the excitation energy measurement stored in the hot nuclei. To Eugene, the currently utilised generator, several improvements were added: introduction of space-time correlations between the different products emitted in the decay of excited nuclei by calculating the trajectories of the particles in the final phase of the reaction; taking into account in the decay cascade of the discrete levels of the lighter fragments; the possibility of the schematically description of the explosion of the nucleus by simultaneous emission of multi-fragments. Thus, by comparing the calculations with the data relative to heavy systems studied with the NAUTILUS assembly it was possible to extract the time scales in the nuclear fragmentation. The utilisation of these event generators was extended to the analysis of INDRA data concerning the determination of the vaporization threshold in the collisions Ar + Ni and also the research of the expansion effects in the collisions Xe + Sn at 50 MeV/u

  2. GENERATIVE LEADERSHIP

    Directory of Open Access Journals (Sweden)

    Janina León

    2010-07-01

    Full Text Available This article presents the results of a research project that studied leadership from the standpoint of the personal conceptions that influence the behavior of local government leaders, as well as those conceptions desired to generate the social transformation processes required in communities. Qualitative methodology was used. Categories of analysis were created based on Pearson’s (1992 model of psychological archetypes. A relevant finding was the limited advance shown by interviewees regarding self-knowledge and a fragmented vision between the observer and the observee, which hinders their ability to take on the challenges that current reality demands from them.

  3. Power generation

    International Nuclear Information System (INIS)

    Nunez, Anibal D.

    2001-01-01

    In the second half of twentieth century, nuclear power became an industrial reality. Now the operating 433 power plants, the 37 plants under construction, near 9000 years/reactor with only one serious accident with emission of radioactive material to the environment (Chernobyl) show the maturity of this technology. Today nuclear power contribute a 17% to the global generation and an increase of 75 % of the demand of electricity is estimated for 2020 while this demand is expected to triplicate by 2050. How this requirement can be satisfied? All the indicators seems to demonstrate that nuclear power will be the solution because of the shortage of other sources, the increase of the prices of the non renewable fuels and the scarce contribution of the renewable ones. In addition, the climatic changes produced by the greenhouse effect make even more attractive nuclear power. The situation of Argentina is analyzed and compared with other countries. The convenience of an increase of nuclear power contribution to the total national generation seems clear and the conclusion of the construction of the Atucha II nuclear power plant is recommended

  4. Plasma generator

    International Nuclear Information System (INIS)

    Omichi, Takeo; Yamanaka, Toshiyuki.

    1976-01-01

    Object: To recycle a coolant in a sealed hollow portion formed interiorly of a plasma limiter itself to thereby to cause direct contact between the coolant and the plasma limiter and increase of contact area therebetween to cool the plasma limiter. Structure: The heat resulting from plasma generated during operation and applied to the body of the plasma limiter is transmitted to the coolant, which recycles through an inlet and outlet pipe, an inlet and outlet nozzle and a hollow portion to hold the plasma limiter at a level less than a predetermined temperature. On the other hand, the heater wire is, at the time of emergency operation, energized to heat the plasma limiter, but this heat is transmitted to the limiter body to increase the temperature thereof. However, the coolant recycling the hollow portion comes into direct contact with the limiter body, and since the plasma limiter surround the hollow portion, the heat amount transmitted from the limiter body to the coolant increases to sufficiently cool the plasma limiter. (Yoshihara, H.)

  5. Electrical generator

    International Nuclear Information System (INIS)

    Purdy, D.L.

    1976-01-01

    A nuclear heart pacer having a heat-to-electricity converter including a solid-state thermoelectric unit embedded in rubber which is compressed to impress hydrostatic precompression on the unit is described. The converter and the radioactive heat source are enclosed in a container which includes the electrical circuit components for producing and controlling the pulses; the converter and components being embedded in rubber. The portions of the rubber in the converter and in the container through which heat flows between the radioactive primary source and the hot junction and between the cold junction and the wall of the container are of thermally conducting silicone rubber. The 238 Pu primary radioactive source material is encapsuled in a refractory casing of WC-222 (T-222) which in turn is encapsuled in a corrosion-resistant casing of platinum rhodium, a diffusion barrier separating the WC-222 and the Pt--Rh casings. The Pt--Rh casing is in a closed basket of tantalum. The tantalum protects the Pt--Rh from reacting with other materials during cremation of the host, if any. The casings and basket suppress the transmission of hard x rays generated by the alpha particles from the 238 Pu. The outside casing of the pacer is typically of titanium but its surface is covered by an electrically insulating coating, typically epoxy resin, except over a relatively limited area for effective electrical grounding to the body of the host. It is contemplated that the pacer will be inserted in the host with the exposed titanium engaging a non-muscular region of the body

  6. Magnet Free Generators - 3rd Generation Wind Turbine Generators

    DEFF Research Database (Denmark)

    Jensen, Bogi Bech; Mijatovic, Nenad; Henriksen, Matthew Lee

    2013-01-01

    This paper presents an introduction to superconducting wind turbine generators, which are often referred to as 3rd generation wind turbine generators. Advantages and challenges of superconducting generators are presented with particular focus on possible weight and efficiency improvements. A comp...

  7. Trip generation characteristics of special generators

    Science.gov (United States)

    2010-03-01

    Special generators are introduced in the sequential four-step modeling procedure to represent certain types of facilities whose trip generation characteristics are not fully captured by the standard trip generation module. They are also used in the t...

  8. Self generation, small generation, and embedded generation issues

    International Nuclear Information System (INIS)

    2001-01-01

    The New Brunswick Market Design Committee for electric power restructuring has been directed to examine issues regarding cogeneration and small-scale, on-site generation and how they will fit within the framework of the bilateral contract market. The Committee will also have to deal with issues of generation embedded in a distribution system. The Committee has defined cogeneration as the simultaneous production of electricity and useful thermal energy. Self-generation has been defined as small-scale power generation by an end-user, while embedded generation has been defined as a generation facility that is located within a distribution utility but is not directly connected to the transmission system. The Committee has postponed its decision on whether embedded generation will be eligible to participate under the bilateral contract market for electricity. This report discusses general issues such as the physical support of generation, market support of generation, transition issues and policy issues. It also discusses generation support issues such as operating reserves, transmission tariff issues, and distribution tariffs. Market support issues such as transmission access for generation sales were also considered, along with market access for generation sales, and net metering for behind the meter generation. 7 refs., 1 tab

  9. Determination of circumsolar radiation from Meteosat Second Generation

    Science.gov (United States)

    Reinhardt, B.; Buras, R.; Bugliaro, L.; Wilbert, S.; Mayer, B.

    2014-03-01

    mixture with smooth and roughend particles, respectively. If measurements with sub-scale cumulus clouds within the relevant satellite pixels are manually excluded, the instantaneous agreement between satellite and ground measurements improves. For a 2-monthly time series, for which a manual screening of all-sky images was performed, MAD values of 0.08 and 0.07 were obtained for the two employed ice particle mixtures, respectively.

  10. Observations of polar patches generated by solar wind Alfvén wave coupling to the dayside magnetosphere

    Directory of Open Access Journals (Sweden)

    P. Prikryl

    1999-04-01

    Full Text Available A long series of polar patches was observed by ionosondes and an all-sky imager during a disturbed period (Kp = 7- and IMF Bz < 0. The ionosondes measured electron densities of up to 9 × 1011 m-3 in the patch center, an increase above the density minimum between patches by a factor of \\sim4.5. Bands of F-region irregularities generated at the equatorward edge of the patches were tracked by HF radars. The backscatter bands were swept northward and eastward across the polar cap in a fan-like formation as the afternoon convection cell expanded due to the IMF By > 0. Near the north magnetic pole, an all-sky imager observed the 630-nm emission patches of a distinctly band-like shape drifting northeastward to eastward. The 630-nm emission patches were associated with the density patches and backscatter bands. The patches originated in, or near, the cusp footprint where they were formed by convection bursts (flow channel events, FCEs structuring the solar EUV-produced photoionization and the particle-produced auroral/cusp ionization by segmenting it into elongated patches. Just equatorward of the cusp footprint Pc5 field line resonances (FLRs were observed by magnetometers, riometers and VHF/HF radars. The AC electric field associated with the FLRs resulted in a poleward-progressing zonal flow pattern and backscatter bands. The VHF radar Doppler spectra indicated the presence of steep electron density gradients which, through the gradient drift instability, can lead to the generation of the ionospheric irregularities found in patches. The FLRs and FCEs were associated with poleward-progressing DPY currents (Hall currents modulated by the IMF By and riometer absorption enhancements. The temporal and spatial characteristics of the VHF backscatter and associated riometer absorptions closely resembled those of poleward moving auroral forms (PMAFs. In the solar wind, IMP 8 observed large amplitude Alfvén waves that were correlated with Pc5 pulsations

  11. Leading Generation Y

    National Research Council Canada - National Science Library

    Newman, Jill M

    2008-01-01

    .... Whether referred to as the Millennial Generation, Generation Y or the Next Generation, the Army needs to consider the gap between Boomers, Generation X and the Soldiers that fill our junior ranks...

  12. Distributed generation induction and permanent magnet generators

    CERN Document Server

    Lai, L

    2007-01-01

    Distributed power generation is a technology that could help to enable efficient, renewable energy production both in the developed and developing world. It includes all use of small electric power generators, whether located on the utility system, at the site of a utility customer, or at an isolated site not connected to the power grid. Induction generators (IGs) are the cheapest and most commonly used technology, compatible with renewable energy resources. Permanent magnet (PM) generators have traditionally been avoided due to high fabrication costs; however, compared with IGs they are more reliable and productive. Distributed Generation thoroughly examines the principles, possibilities and limitations of creating energy with both IGs and PM generators. It takes an electrical engineering approach in the analysis and testing of these generators, and includes diagrams and extensive case study examples o better demonstrate how the integration of energy sources can be accomplished. The book also provides the ...

  13. Random pulse generator

    International Nuclear Information System (INIS)

    Guo Ya'nan; Jin Dapeng; Zhao Dixin; Liu Zhen'an; Qiao Qiao; Chinese Academy of Sciences, Beijing

    2007-01-01

    Due to the randomness of radioactive decay and nuclear reaction, the signals from detectors are random in time. But normal pulse generator generates periodical pulses. To measure the performances of nuclear electronic devices under random inputs, a random generator is necessary. Types of random pulse generator are reviewed, 2 digital random pulse generators are introduced. (authors)

  14. Power Generation for River and Tidal Generators

    Energy Technology Data Exchange (ETDEWEB)

    Muljadi, Eduard [National Renewable Energy Lab. (NREL), Golden, CO (United States); Wright, Alan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Gevorgian, Vahan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Donegan, James [Ocean Renewable Power Company (ORPC), Portland, ME (United States); Marnagh, Cian [Ocean Renewable Power Company (ORPC), Portland, ME (United States); McEntee, Jarlath [Ocean Renewable Power Company (ORPC), Portland, ME (United States)

    2016-06-01

    Renewable energy sources are the second largest contributor to global electricity production, after fossil fuels. The integration of renewable energy continued to grow in 2014 against a backdrop of increasing global energy consumption and a dramatic decline in oil prices during the second half of the year. As renewable generation has become less expensive during recent decades, and it becomes more accepted by the global population, the focus on renewable generation has expanded from primarily wind and solar to include new types with promising future applications, such as hydropower generation, including river and tidal generation. Today, hydropower is considered one of the most important renewable energy sources. In river and tidal generation, the input resource flow is slower but also steadier than it is in wind or solar generation, yet the level of water turbulent flow may vary from one place to another. This report focuses on hydrokinetic power conversion.

  15. Influence of spectral solar radiation to the generating power of photovoltaic module; Taiyo denchi shutsuryoku eno taiyoko supekutoru eno eikyo

    Energy Technology Data Exchange (ETDEWEB)

    Minaki, S.; Ishihara, Y.; Todaka, T.; Harada, K. [Doshisha University, Kyoto (Japan); Oshiro, T.; Nakamura, H. [Japan quality Assurance Organization, Tokyo (Japan)

    1997-11-25

    As to the influence of spectral solar radiation to generating power of solar cells, a study was conducted from the aspects of season, time zone, intensity of solar radiation, etc. In the study, spectral responsive variation correction coefficients were introduced as evaluation values expressing the influence of spectral solar radiation. For the spectral distribution, an all sky spectral pyranometer by wavelength was used, and data were used which were obtained in the measurement in experimental facilities of the solar techno center. Concerning solar cell relative spectral sensitivity values, used were relative spectral sensitivity values of monocrystal and amorphous standard solar cells to the short-circuit current. Spectral response variation correction coefficients are coefficients correcting variations in conversion efficiency of solar cells due to changes in the spectral distribution. The changes of spectral responsive variation correction coefficients were studied using data obtained during April 1994 and March 1996. As a result, it was found that the coefficients showed large changes in summer and small ones in winter and that amorphous solar cells indicate this trend conspicuously. 3 refs., 6 figs., 3 tabs.

  16. BULK FLOWS FROM GALAXY LUMINOSITIES: APPLICATION TO 2MASS REDSHIFT SURVEY AND FORECAST FOR NEXT-GENERATION DATA SETS

    International Nuclear Information System (INIS)

    Nusser, Adi; Branchini, Enzo; Davis, Marc

    2011-01-01

    We present a simple method for measuring cosmological bulk flows from large redshift surveys, based on the apparent dimming or brightening of galaxies due to their peculiar motion. It is aimed at estimating bulk flows of cosmological volumes containing large numbers of galaxies. Constraints on the bulk flow are obtained by minimizing systematic variations in galaxy luminosities with respect to a reference luminosity function measured from the whole survey. This method offers two advantages over more popular bulk flow estimators: it is independent of error-prone distance indicators and of the poorly known galaxy bias. We apply the method to the Two Micron All Sky Survey redshift survey to measure the local bulk flows of spherical shells centered on the Milky Way (MW). The result is consistent with that obtained by Nusser and Davis using the SFI++ catalogue of Tully-Fisher distance indicators. We also make an assessment of the ability of the method to constrain bulk flows at larger redshifts (z = 0.1-0.5) from next-generation data sets. As a case study we consider the planned EUCLID survey. Using this method we will be able to measure a bulk motion of ∼200 km s -1 of 10 6 galaxies with photometric redshifts, at the 3σ level for both z ∼ 0.15 and z ∼ 0.5. Thus, the method will allow us to put strong constraints on dark energy models as well as alternative theories for structure formation.

  17. Magnetohydrodynamic (MHD) power generation

    International Nuclear Information System (INIS)

    Chandra, Avinash

    1980-01-01

    The concept of MHD power generation, principles of operation of the MHD generator, its design, types, MHD generator cycles, technological problems to be overcome, the current state of the art in USA and USSR are described. Progress of India's experimental 5 Mw water-gas fired open cycle MHD power generator project is reported in brief. (M.G.B.)

  18. Talkin' 'bout My Generation

    Science.gov (United States)

    Rickes, Persis C.

    2010-01-01

    The monikers are many: (1) "Generation Y"; (2) "Echo Boomers"; (3) "GenMe"; (4) the "Net Generation"; (5) "RenGen"; and (6) "Generation Next". One name that appears to be gaining currency is "Millennials," perhaps as a way to better differentiate the current generation from its…

  19. Work Values across Generations

    Science.gov (United States)

    Hansen, Jo-Ida C.; Leuty, Melanie E.

    2012-01-01

    Mainstream publication discussions of differences in generational cohorts in the workplace suggest that individuals of more recent generations, such as Generation X and Y, have different work values than do individuals of the Silent and Baby Boom generations. Although extant research suggests that age may influence work values, few of the…

  20. Minding the Generation Gap

    Science.gov (United States)

    Field, John

    2011-01-01

    Generational conflict is back. After years of relative silence, and mutual ignorance, the young and old are once more at war. With youth unemployment high on the political agenda, the fortunes of the "jobless generation" are being contrasted with those of the "golden generation" of baby boomers, but is one generation really…

  1. Gamma ray generator

    Science.gov (United States)

    Firestone, Richard B; Reijonen, Jani

    2014-05-27

    An embodiment of a gamma ray generator includes a neutron generator and a moderator. The moderator is coupled to the neutron generator. The moderator includes a neutron capture material. In operation, the neutron generator produces neutrons and the neutron capture material captures at least some of the neutrons to produces gamma rays. An application of the gamma ray generator is as a source of gamma rays for calibration of gamma ray detectors.

  2. HTGR steam generator development

    International Nuclear Information System (INIS)

    Schuetzenduebel, W.G.; Hunt, P.S.; Weber, M.

    1976-01-01

    More than 40 gas-cooled reactor plants have produced in excess of 400 reactor years of operating experience which have proved a reasonably high rate of gas-cooled reactor steam generator availability. The steam generators used in these reactors include single U-tube and straight-tube steam generators as well as meander type and helically wound or involute tube steam generators. It appears that modern reactors are being equipped with helically wound steam generators of the once-through type as the end product of steam generator evolution in gas-cooled reactor plants. This paper provides a general overview of gas-cooled reactor steam generator evolution and operating experience and shows how design criteria and constraints, research and development, and experience data are factored into the design/development of modern helically wound tube steam generators for the present generation of gas-cooled reactors

  3. Cylindrical neutron generator

    Science.gov (United States)

    Leung, Ka-Ngo [Hercules, CA

    2008-04-22

    A cylindrical neutron generator is formed with a coaxial RF-driven plasma ion source and target. A deuterium (or deuterium and tritium) plasma is produced by RF excitation in a cylindrical plasma ion generator using an RF antenna. A cylindrical neutron generating target is coaxial with the ion generator, separated by plasma and extraction electrodes which contain many slots. The plasma generator emanates ions radially over 360.degree. and the cylindrical target is thus irradiated by ions over its entire circumference. The plasma generator and target may be as long as desired. The plasma generator may be in the center and the neutron target on the outside, or the plasma generator may be on the outside and the target on the inside. In a nested configuration, several concentric targets and plasma generating regions are nested to increase the neutron flux.

  4. Second harmonic generation and sum frequency generation

    International Nuclear Information System (INIS)

    Pellin, M.J.; Biwer, B.M.; Schauer, M.W.; Frye, J.M.; Gruen, D.M.

    1990-01-01

    Second harmonic generation and sum frequency generation are increasingly being used as in situ surface probes. These techniques are coherent and inherently surface sensitive by the nature of the mediums response to intense laser light. Here we will review these two techniques using aqueous corrosion as an example problem. Aqueous corrosion of technologically important materials such as Fe, Ni and Cr proceeds from a reduced metal surface with layer by layer growth of oxide films mitigated by compositional changes in the chemical makeup of the growing film. Passivation of the metal surface is achieved after growth of only a few tens of atomic layers of metal oxide. Surface Second Harmonic Generation and a related nonlinear laser technique, Sum Frequency Generation have demonstrated an ability to probe the surface composition of growing films even in the presence of aqueous solutions. 96 refs., 4 figs

  5. Refrigeration generation using expander-generator units

    Science.gov (United States)

    Klimenko, A. V.; Agababov, V. S.; Koryagin, A. V.; Baidakova, Yu. O.

    2016-05-01

    The problems of using the expander-generator unit (EGU) to generate refrigeration, along with electricity were considered. It is shown that, on the level of the temperatures of refrigeration flows using the EGU, one can provide the refrigeration supply of the different consumers: ventilation and air conditioning plants and industrial refrigerators and freezers. The analysis of influence of process parameters on the cooling power of the EGU, which depends on the parameters of the gas expansion process in the expander and temperatures of cooled environment, was carried out. The schematic diagram of refrigeration generation plant based on EGU is presented. The features and advantages of EGU to generate refrigeration compared with thermotransformer of steam compressive and absorption types were shown, namely: there is no need to use the energy generated by burning fuel to operate the EGU; beneficial use of the heat delivered to gas from the flow being cooled in equipment operating on gas; energy production along with refrigeration generation, which makes it possible to create, using EGU, the trigeneration plants without using the energy power equipment. It is shown that the level of the temperatures of refrigeration flows, which can be obtained by using the EGU on existing technological decompression stations of the transported gas, allows providing the refrigeration supply of various consumers. The information that the refrigeration capacity of an expander-generator unit not only depends on the parameters of the process of expansion of gas flowing in the expander (flow rate, temperatures and pressures at the inlet and outlet) but it is also determined by the temperature needed for a consumer and the initial temperature of the flow of the refrigeration-carrier being cooled. The conclusion was made that the expander-generator units can be used to create trigeneration plants both at major power plants and at small energy.

  6. Quantum random number generator

    Science.gov (United States)

    Pooser, Raphael C.

    2016-05-10

    A quantum random number generator (QRNG) and a photon generator for a QRNG are provided. The photon generator may be operated in a spontaneous mode below a lasing threshold to emit photons. Photons emitted from the photon generator may have at least one random characteristic, which may be monitored by the QRNG to generate a random number. In one embodiment, the photon generator may include a photon emitter and an amplifier coupled to the photon emitter. The amplifier may enable the photon generator to be used in the QRNG without introducing significant bias in the random number and may enable multiplexing of multiple random numbers. The amplifier may also desensitize the photon generator to fluctuations in power supplied thereto while operating in the spontaneous mode. In one embodiment, the photon emitter and amplifier may be a tapered diode amplifier.

  7. Steam generator tube extraction

    International Nuclear Information System (INIS)

    Delorme, H.

    1985-05-01

    To enable tube examination on steam generators in service, Framatome has now developed a process for removing sections of steam generator tubes. Tube sections can be removed without being damaged for treating the tube section expanded in the tube sheet

  8. Microwatt thermoelectric generator

    International Nuclear Information System (INIS)

    Goslee, D.E.; Bustard, T.S.

    1976-01-01

    A microwatt thermoelectric generator suitable for implanting in the body is described. The generator utilizes a nuclear energy source. Provision is made for temporary electrical connection to the generator for testing purposes, and for ensuring that the heat generated by the nuclear source does not bypass the pile. Also disclosed is a getter which is resistant to shrinkage during sintering, and a foil configuration for controlling the radiation of heat from the nuclear source to the hot plate of the pile

  9. Microwatt thermoelectric generator

    International Nuclear Information System (INIS)

    Goslee, D.E.

    1976-01-01

    A microwatt thermoelectric generator suitable for implanting in the body is described. The disclosed generator utilizes a nuclear energy source. Provision is made for temporary electrical connection to the generator for testing purposes, and for ensuring that the heat generated by the nuclear source does not bypass the pile. Also disclosed is a getter which is resistant to shrinkage during sintering, and a foil configuration for controlling the radiation of heat from the nuclear source to the hot plate of the pile

  10. Uniform random number generators

    Science.gov (United States)

    Farr, W. R.

    1971-01-01

    Methods are presented for the generation of random numbers with uniform and normal distributions. Subprogram listings of Fortran generators for the Univac 1108, SDS 930, and CDC 3200 digital computers are also included. The generators are of the mixed multiplicative type, and the mathematical method employed is that of Marsaglia and Bray.

  11. Generational Pension Plan Designs

    NARCIS (Netherlands)

    Huang, Xiaohong; Mahieu, Ronald

    2010-01-01

    We propose a generational plan for the occupational pension provision in which people from the same generation are pooled in a generational fund. Each fund can set its own policies independently. This plan provides the benefits of differentiation missing in the prevailing collective plan and the

  12. Consolidated nuclear steam generator

    International Nuclear Information System (INIS)

    Jabsen, F.S.; Schluderberg, D.C.; Paulson, A.E.

    1978-01-01

    An improved system of providing power has a unique generating means for nuclear reactors with a number of steam generators in the form of replaceable modular units of the expendable type to attain the optimum in effective and efficient vaporization of fluid during the generating power. The system is most adaptable to undrground power plants and marine usage

  13. Logarithmic-function generator

    Science.gov (United States)

    Caron, P. R.

    1975-01-01

    Solid-state logarithmic-function generator is compact and provides improved accuracy. Generator includes a stable multivibrator feeding into RC circuit. Resulting exponentially decaying voltage is compared with input signal. Generator output is proportional to time required for exponential voltage to decay from preset reference level to level of input signal.

  14. Generation and Context Memory

    Science.gov (United States)

    Mulligan, Neil W.; Lozito, Jeffrey P.; Rosner, Zachary A.

    2006-01-01

    Generation enhances memory for occurrence but may not enhance other aspects of memory. The present study further delineates the negative generation effect in context memory reported in N. W. Mulligan (2004). First, the negative generation effect occurred for perceptual attributes of the target item (its color and font) but not for extratarget…

  15. Radio-isotope generator

    International Nuclear Information System (INIS)

    Benjamins, H.M.

    1983-01-01

    A device is claimed for interrupting an elution process in a radioisotope generator before an elution vial is entirely filled. The generator is simultaneously exposed to sterile air both in the direction of the generator column and of the elution vial

  16. A method to measure the γ-ray content in VHE cosmic ray showers

    International Nuclear Information System (INIS)

    Cresti, M.; Peruzzo, L.; Pesci, A.; Saggion, A.; Sartori, G.; Angelini, F.; Bedeschi, F.; Bellazzini, R.; Bertolucci, E.; Chiarelli, G.; Mariotti, M.; Massai, M.M.; Menzione, A.; Smith, D.A.; Stefanini, A.; Zetti, F.; Scribano, A.; Bartoli, B.; Budinich, M.; Liello, F.; Milotti, E.; Biral, A.R.P.; Chinellato, J.A.; Turtelli, A.; Luksys, M.

    1991-01-01

    An experimental technique is presented to determine the effectiveness of methods to tag photon initiated air showers and reject hadron initiated ones. The technique is based on the rate reduction in the Moon direction. With a photon energy threshold below or equal to 1 TeV, with an angular resolution of a few mrad and being insensitive to visible light, the proposed CLUE detector allows a wide and original physics program. In particular the direct measurement of the fraction of primary photons in the continuum of the cosmic ray flux is feasible with adequate statistics in a few months of data taking. (orig.)

  17. Attenuation of VHE Gamma Rays by the Milky Way Interstellar Radiation Field

    Energy Technology Data Exchange (ETDEWEB)

    Moskalenko, Igor V.; /Stanford U., HEPL; Porter, Troy A.; /Louisiana State U.; Strong, Andrew W.; /Garching, Max Planck Inst., MPE

    2006-04-19

    The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the energy density of the Galactic interstellar radiation field is higher, particularly in the Galactic center, than previously thought. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, and is important for both Galactic and extragalactic sources.

  18. Observations of VHE γ-Ray Sources with the MAGIC Telescope

    Science.gov (United States)

    Bartko, H.

    2008-10-01

    The MAGIC telescope with its 17m diameter mirror is today the largest operating single-dish Imaging Air Cherenkov Telescope (IACT). It is located on the Canary Island La Palma, at an altitude of 2200m above sea level, as part of the Roque de los Muchachos European Northern Observatory. The MAGIC telescope detects celestial very high energy γ-radiation in the energy band between about 50 GeV and 10 TeV. Since Autumn of 2004 MAGIC has been taking data routinely, observing various objects like supernova remnants (SNRs), γ-ray binaries, Pulsars, Active Galactic Nuclei (AGN) and Gamma-ray Bursts (GRB). We briefly describe the observational strategy, the procedure implemented for the data analysis, and discuss the results for individual sources. An outlook to the construction of the second MAGIC telescope is given.

  19. Motor/generator

    Science.gov (United States)

    Hickam, Christopher Dale [Glasford, IL

    2008-05-13

    A motor/generator is provided for connecting between a transmission input shaft and an output shaft of a prime mover. The motor/generator may include a motor/generator housing, a stator mounted to the motor/generator housing, a rotor mounted at least partially within the motor/generator housing and rotatable about a rotor rotation axis, and a transmission-shaft coupler drivingly coupled to the rotor. The transmission-shaft coupler may include a clamp, which may include a base attached to the rotor and a plurality of adjustable jaws.

  20. Generator for radionuclide

    International Nuclear Information System (INIS)

    Weisner, P.S.; Forrest, T.R.F.

    1985-01-01

    This invention provides a radionuclide generator of the kind in which a parent radionuclide, adsorbed on a column of particulate material, generates a daughter radionuclide which is periodically removed from the column. This invention is particularly concerned with technetium generators using single collection vials. The generator comprises a column, a first reservoir for the eluent, a second reservoir to contain the volume of eluent required for a single elution, and means connecting the first reservoir to the second reservoir and the second reservoir to the column. Such a generator is particularly suitable for operation by vacuum elution

  1. Solar thermoelectric generator

    Science.gov (United States)

    Toberer, Eric S.; Baranowski, Lauryn L.; Warren, Emily L.

    2016-05-03

    Solar thermoelectric generators (STEGs) are solid state heat engines that generate electricity from concentrated sunlight. A novel detailed balance model for STEGs is provided and applied to both state-of-the-art and idealized materials. STEGs can produce electricity by using sunlight to heat one side of a thermoelectric generator. While concentrated sunlight can be used to achieve extremely high temperatures (and thus improved generator efficiency), the solar absorber also emits a significant amount of black body radiation. This emitted light is the dominant loss mechanism in these generators. In this invention, we propose a solution to this problem that eliminates virtually all of the emitted black body radiation. This enables solar thermoelectric generators to operate at higher efficiency and achieve said efficient with lower levels of optical concentration. The solution is suitable for both single and dual axis solar thermoelectric generators.

  2. Designing the next generation (fifth generation computers)

    International Nuclear Information System (INIS)

    Wallich, P.

    1983-01-01

    A description is given of the designs necessary to develop fifth generation computers. An analysis is offered of problems and developments in parallelism, VLSI, artificial intelligence, knowledge engineering and natural language processing. Software developments are outlined including logic programming, object-oriented programming and exploratory programming. Computer architecture is detailed including concurrent computer architecture

  3. Generational Accounting in Iran

    Directory of Open Access Journals (Sweden)

    Mahdi Salehi

    2013-09-01

    Full Text Available The aim of this paper is to study of the generation accounts for Iranian’s generation. We applied the method of Auerbach, Gokhale and Kotlihoff (1991 on the period 1967-2008 in Iran. Our calculation shows with compare to industrial countries, fiscal burden for Iranian’s population is very chip and that depend on fiscal system in Iran. Except the recent years the rate of tax in Iran has been very low. The generation account for the old people (40 olds is 2117 $ but the future generation (t+1 is 36985 $. The share of male and female, during the years, in this burden is similar. Fiscal burden for Iranian’s generation is low but this population should support other burden that calls inflation. Because when the government do not receive the tax income, a low generation account transfer to price general level.

  4. Distributed generation hits market

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    The pace at which vendors are developing and marketing gas turbines and reciprocating engines for small-scale applications may signal the widespread growth of distributed generation. Loosely defined to refer to applications in which power generation equipment is located close to end users who have near-term power capacity needs, distributed generation encompasses a broad range of technologies and load requirements. Disagreement is inevitable, but many industry observers associate distributed generation with applications anywhere from 25 kW to 25 MW. Ten years ago, distributed generation users only represented about 2% of the world market. Today, that figure has increased to about 4 or 5%, and probably could settle in the 20% range within a 3-to-5-year period, according to Michael Jones, San Diego, Calif.-based Solar Turbines Inc. power generation marketing manager. The US Energy Information Administration predicts about 175 GW of generation capacity will be added domestically by 2010. If 20% comes from smaller plants, distributed generation could account for about 35 GW. Even with more competition, it's highly unlikely distributed generation will totally replace current market structures and central stations. Distributed generation may be best suited for making market inroads when and where central systems need upgrading, and should prove its worth when the system can't handle peak demands. Typical applications include small reciprocating engine generators at remote customer sites or larger gas turbines to boost the grid. Additional market opportunities include standby capacity, peak shaving, power quality, cogeneration and capacity rental for immediate demand requirements. Integration of distributed generation systems--using gas-fueled engines, gas-fired combustion engines and fuel cells--can upgrade power quality for customers and reduce operating costs for electric utilities

  5. Third generation nuclear plants

    Science.gov (United States)

    Barré, Bertrand

    2012-05-01

    After the Chernobyl accident, a new generation of Light Water Reactors has been designed and is being built. Third generation nuclear plants are equipped with dedicated systems to insure that if the worst accident were to occur, i.e. total core meltdown, no matter how low the probability of such occurrence, radioactive releases in the environment would be minimal. This article describes the EPR, representative of this "Generation III" and a few of its competitors on the world market.

  6. Modular Stirling Radioisotope Generator

    Science.gov (United States)

    Schmitz, Paul C.; Mason, Lee S.; Schifer, Nicholas A.

    2016-01-01

    High-efficiency radioisotope power generators will play an important role in future NASA space exploration missions. Stirling Radioisotope Generators (SRGs) have been identified as a candidate generator technology capable of providing mission designers with an efficient, high-specific-power electrical generator. SRGs high conversion efficiency has the potential to extend the limited Pu-238 supply when compared with current Radioisotope Thermoelectric Generators (RTGs). Due to budgetary constraints, the Advanced Stirling Radioisotope Generator (ASRG) was canceled in the fall of 2013. Over the past year a joint study by NASA and the Department of Energy (DOE) called the Nuclear Power Assessment Study (NPAS) recommended that Stirling technologies continue to be explored. During the mission studies of the NPAS, spare SRGs were sometimes required to meet mission power system reliability requirements. This led to an additional mass penalty and increased isotope consumption levied on certain SRG-based missions. In an attempt to remove the spare power system, a new generator architecture is considered, which could increase the reliability of a Stirling generator and provide a more fault-tolerant power system. This new generator called the Modular Stirling Radioisotope Generator (MSRG) employs multiple parallel Stirling convertor/controller strings, all of which share the heat from the General Purpose Heat Source (GPHS) modules. For this design, generators utilizing one to eight GPHS modules were analyzed, which provided about 50 to 450 W of direct current (DC) to the spacecraft, respectively. Four Stirling convertors are arranged around each GPHS module resulting in from 4 to 32 Stirling/controller strings. The convertors are balanced either individually or in pairs, and are radiatively coupled to the GPHS modules. Heat is rejected through the housing/radiator, which is similar in construction to the ASRG. Mass and power analysis for these systems indicate that specific

  7. TFTR generator load assessment

    International Nuclear Information System (INIS)

    Heck, F.M.

    1975-10-01

    Typical experimental load demands on the TFTR generators are illustrated based on the electrical characteristics of the field coils, the coil leads, the main bus work, the various auxiliary bus work, the rectifiers, and transformers. The generator MW capacities are shown to be adequate for the proposed experimental operations with allowances made for variations in the final designs. The generator MVA capacities are shown to be adequate provided portions of the TF and EF rectifiers are freewheeled at selected times

  8. Solar fuels generator

    Science.gov (United States)

    Lewis, Nathan S.; Spurgeon, Joshua M.

    2016-10-25

    The solar fuels generator includes an ionically conductive separator between a gaseous first phase and a second phase. A photoanode uses one or more components of the first phase to generate cations during operation of the solar fuels generator. A cation conduit is positioned provides a pathway along which the cations travel from the photoanode to the separator. The separator conducts the cations. A second solid cation conduit conducts the cations from the separator to a photocathode.

  9. Microwatt thermoelectric generator

    International Nuclear Information System (INIS)

    Hittman, F.; Bustard, T.S.

    1976-01-01

    A microwatt thermoelectric generator suitable for implanting in the body is described. The generator utilizes a nuclear energy source. Provision is made for temporary electrical connection to the generator for testing purposes, and for ensuring that the heat generated by the nuclear source does not bypass the pile. Also disclosed is a getter which is resistant to shrinkage during sintering, and a foil configuration for controlling the radiation of heat from the nuclear source to the hot plate of the pile. 2 claims, 4 drawing figures

  10. Microwatt thermoelectric generator

    International Nuclear Information System (INIS)

    Barr, H.N.

    1978-01-01

    A microwatt thermoelectric generator suitable for implanting in the body is described. The disclosed generator utilizes a nuclear energy source. Provision is made for temporary electrical connection to the generator for testing purposes, and for ensuring that the heat generated by the nuclear source does not bypass the pile. Also disclosed is a getter which is resistant to shrinkage during sintering, and a foil configuration for controlling the radiation of heat from the nuclear source to the hot plate of the pile. 4 claims, 4 figures

  11. SMUG: Scientific Music Generator

    DEFF Research Database (Denmark)

    Scirea, Marco; A B Barros, Gabriella; Togelius, Julian

    2015-01-01

    Music is based on the real world. Composers use their day-to-day lives as inspiration to create rhythm and lyrics. Procedural music generators are capable of creating good quality pieces, and while some already use the world as inspiration, there is still much to be explored in this. We describe...... a system to generate lyrics and melodies from real-world data, in particular from academic papers. Through this we want to create a playful experience and establish a novel way of generating content (textual and musical) that could be applied to other domains, in particular to games. For melody generation...

  12. NEGATIVE GATE GENERATOR

    Science.gov (United States)

    Jones, C.S.; Eaton, T.E.

    1958-02-01

    This patent relates to pulse generating circuits and more particularly to rectangular pulse generators. The pulse generator of the present invention incorporates thyratrons as switching elements to discharge a first capacitor through a load resistor to initiate and provide the body of a Pulse, and subsequently dlscharge a second capacitor to impress the potential of its charge, with opposite potential polarity across the load resistor to terminate the pulse. Accurate rectangular pulses in the millimicrosecond range are produced across a low impedance by this generator.

  13. Third generation coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2014-01-01

    Third generation coaching unfolds a new universe for coaching and coaching psychology in the framework of current social research, new learning theories and discourses about personal leadership. Third generation coaching views coaching in a societal perspective. Coaching has become important...... transformation. Coaching thus facilitates new reflections and perspectives, as well as empowerment and support for self-Bildung processes. Third generation coaching focuses on the coach and the coachee in their narrative collaborative partnership. Unlike first generation coaching, where the goal is to help...

  14. Gearless wind power generator

    Energy Technology Data Exchange (ETDEWEB)

    Soederlund, L.; Ridanpaeae, P.; Vihriaelae, H.; Peraelae, R. [Tampere Univ. of Technology (Finland). Lab. of Electricity and Magnetism

    1998-12-31

    During the wind power generator project a design algorithm for a gearless permanent magnet generator with an axially orientated magnetic flux was developed and a 10 kW model machine was constructed. Utilising the test results a variable wind speed system of 100 kW was designed that incorporates a permanent magnet generator, a frequency converter and a fuzzy controller. This system produces about 5-15% more energy than existing types and stresses to the blades are minimised. The type of generator designed in the project represents in general a gearless solution for slow-speed electrical drives. (orig.)

  15. EPRI steam generator programs

    International Nuclear Information System (INIS)

    Martel, L.J.; Passell, T.O.; Bryant, P.E.C.; Rentler, R.M.

    1977-01-01

    The paper describes the current overall EPRI steam generator program plan and some of the ongoing projects. Because of the recent occurrence of a corrosion phenomenon called ''denting,'' which has affected a number of operating utilities, an expanded program plan is being developed which addresses the broad and urgent needs required to achieve improved steam generator reliability. The goal of improved steam generator reliability will require advances in various technologies and also a management philosophy that encourages conscientious efforts to apply the improved technologies to the design, procurement, and operation of plant systems and components that affect the full life reliability of steam generators

  16. Commanding Generation Y: How Generation X Military Leaders Can Better Utilize Generational Tendencies

    Science.gov (United States)

    2013-03-21

    generation ( Baby Boomers ). Although the profession of arms is a time-honored tradition steeped in discipline...senior leadership generational tendencies. Command; Leadership; Generation ; Baby Boomer ; Generation X; Generation Y Unclass Unclass Unclass UU 32 USMC...enable commanders to better lead Generation Y within the U.S. military. Discussion: Baby Boomers , Generation X, and Generation Y are

  17. Pulsed Corona Discharge Generated By Marx Generator

    Science.gov (United States)

    Sretenovic, G. B.; Obradovic, B. M.; Kovacevic, V. V.; Kuraica, M. M.; Puric J.

    2010-07-01

    The pulsed plasma has a significant role in new environmental protection technologies. As a part of a pulsed corona system for pollution control applications, Marx type repetitive pulse generator was constructed and tested in arrangement with wire-plate corona reactor. We performed electrical measurements, and obtained voltage and current signals, and also power and energy delivered per pulse. Ozone formation by streamer plasma in air was chosen to monitor chemical activity of the pulsed corona discharge.

  18. THE 2010 VERY HIGH ENERGY gamma-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87

    OpenAIRE

    Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; de Almeida, U. Barres; Becherini, Y.; Becker, J.; Behera, B.; Bernloehr, K.; Birsin, E.; Biteau, J.; Bochow, A.

    2012-01-01

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3-6) x 10(9) M-circle dot) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, resu...

  19. Wroclaw neutrino event generator

    International Nuclear Information System (INIS)

    Nowak, J A

    2006-01-01

    A neutrino event generator developed by the Wroclaw Neutrino Group is described. The physical models included in the generator are discussed and illustrated with the results of simulations. The considered processes are quasi-elastic scattering and pion production modelled by combining the Δ resonance excitation and deep inelastic scattering

  20. When Generations Collide

    Science.gov (United States)

    Fogg, Piper

    2008-01-01

    When four generations converge in the academic workplace, it can create serious culture clashes. It is happening across college campuses--in offices as diverse as admissions, student affairs, legal affairs, and technology. It is especially striking in the faculty ranks, where generational challenges have extra significance amid recruiting efforts,…

  1. Photovoltaic Bias Generator

    Science.gov (United States)

    2018-02-01

    Department of the Army position unless so designated by other authorized documents. Citation of manufacturer’s or trade names does not constitute an... Interior view of the photovoltaic bias generator showing wrapped-wire side of circuit board...3 Fig. 4 Interior view of the photovoltaic bias generator showing component side of circuit board

  2. Third Generation Coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2016-01-01

    , Gruppen oder Teams neue Orientierung auf einer tieferen Sinnebene ermöglicht. Im Gegensatz zum Coaching der ersten Generation, bei dem das Erreichen bestimmter, festgeschriebener Ziele im Vordergrund steht, und im Gegensatz zum Coaching der zweiten Generation, in dem wünschenswerte zukünftige...

  3. Hospitality services generate revenue.

    Science.gov (United States)

    Bizouati, S

    1993-01-01

    An increasing number of hospitals are undertaking external revenue-generating activities to supplement their shrinking budgets. Written at the request of Leadership, this article outlines an example of a successful catering service -- a money-generating business that more Canadian hospitals could profitably consider.

  4. Aerodynamically shaped vortex generators

    DEFF Research Database (Denmark)

    Hansen, Martin Otto Laver; Velte, Clara Marika; Øye, Stig

    2016-01-01

    An aerodynamically shaped vortex generator has been proposed, manufactured and tested in a wind tunnel. The effect on the overall performance when applied on a thick airfoil is an increased lift to drag ratio compared with standard vortex generators. Copyright © 2015 John Wiley & Sons, Ltd....

  5. Understanding portable generators

    Energy Technology Data Exchange (ETDEWEB)

    Hills, A.; Hawkins, B. [Guelph Univ., ON (Canada); Clarke, S. [Ontario Ministry of Agriculture, Food and Rural Affairs, Toronto, ON (Canada)

    2000-06-01

    This factsheet is intended to help consumers select a small portable generator for emergency electrical needs. Interest in standby generators has been heightened ever since the prolonged power outage in Eastern Ontario and Southwestern Quebec during the 1998 ice storm and the concern over Y2K related outages. Farmers, in particular, have been reassessing their need for emergency electrical power supply. This document presents some of the factors that should be considered when purchasing and operating a portable generator in the 3 to 12 kW size. It provides a detailed review of power quality and describes the use of tractor-driven power-take-off generators of 15 kW and larger. Several manufacturers make portable generators in many sizes with a whole range of features. This document includes a table depicting generator Feature/Benefit analysis to help consumers understand the differences between features and benefits. A second table provides a check list for generator feature/benefits. Specific details for the operations of various generators are available from manufacturers, distributors and electrical contractors. 2 tabs., 1 fig.

  6. Generative Processes: Thick Drawing

    Science.gov (United States)

    Wallick, Karl

    2012-01-01

    This article presents techniques and theories of generative drawing as a means for developing complex content in architecture design studios. Appending the word "generative" to drawing adds specificity to the most common representation tool and clarifies that such drawings are not singularly about communication or documentation but are…

  7. Generation Y Perspectives

    Science.gov (United States)

    Skytland, Nicholas; Painting, Kristen; Barrera, Aaron; Fitzpatrick, Garret

    2008-01-01

    This viewgraph presentation reviews the perception of NASA and the importance of engaging those people born between 1977 and 2000, also known as Generation Y. It examines some of the differences in attitudes and experiences, and how it reflects on how they view NASA. It also discusses use of the internet in connecting to the people from that generation.

  8. Neutron generator control system

    International Nuclear Information System (INIS)

    Peelman, H.E.; Bridges, J.R.

    1981-01-01

    A method is described of controlling the neutron output of a neutron generator tube used in neutron well logging. The system operates by monitoring the target beam current and comparing a function of this current with a reference voltage level to develop a control signal used in a series regulator to control the replenisher current of the neutron generator tube. (U.K.)

  9. Generation IV national program

    International Nuclear Information System (INIS)

    Preville, M.; Sadhankar, R.; Brady, D.

    2007-01-01

    This paper outlines the Generation IV National Program. This program involves evolutionary and innovative design with significantly higher efficiencies (∼50% compared to present ∼30%) - sustainable, economical, safe, reliable and proliferation resistant - for future energy security. The Generation IV Forum (GIF) effectively leverages the resources of the participants to meet these goals. Ten countries signed the GIF Charter in 2001

  10. Solar Fuel Generator

    Science.gov (United States)

    Lewis, Nathan S. (Inventor); West, William C. (Inventor)

    2017-01-01

    The disclosure provides conductive membranes for water splitting and solar fuel generation. The membranes comprise an embedded semiconductive/photoactive material and an oxygen or hydrogen evolution catalyst. Also provided are chassis and cassettes containing the membranes for use in fuel generation.

  11. The Next Great Generation?

    Science.gov (United States)

    Brownstein, Andrew

    2000-01-01

    Discusses ideas from a new book, "Millennials Rising: The Next Great Generation," (by Neil Howe and William Strauss) suggesting that youth culture is on the cusp of a radical shift with the generation beginning with this year's college freshmen who are typically team oriented, optimistic, and poised for greatness on a global scale. Includes a…

  12. OMG: Open molecule generator

    NARCIS (Netherlands)

    Peironcely, J.E.; Rojas-Chertó, M.; Fichera, D.; Reijmers, T.; Coulier, L.; Faulon, J.-L.; Hankemeier, T.

    2012-01-01

    Computer Assisted Structure Elucidation has been used for decades to discover the chemical structure of unknown compounds. In this work we introduce the first open source structure generator, Open Molecule Generator (OMG), which for a given elemental composition produces all non-isomorphic chemical

  13. Experience and Its Generation

    Science.gov (United States)

    Youqing, Chen

    2006-01-01

    Experience is an activity that arouses emotions and generates meanings based on vivid sensation and profound comprehension. It is emotional, meaningful, and personal, playing a key role in the course of forming and developing one's qualities. The psychological process of experience generation consists of such links as sensing things, arousing…

  14. Experience and Its Generation

    Institute of Scientific and Technical Information of China (English)

    Chen Youqing

    2006-01-01

    Experience iS an activity that arouses emotions and generates meanings based on vivid sensation and profound compreh ension.It iS emotional,meaningful,and personal,playing a key role in the course of forming and developing one'S qualities.The psychological process of experience generation consists of such links as sensing things,arousing emotions,promoting comprehension and association,generating insights and meanings,and deepening emotional responses.Undergoing things personally by means of direct sensation,taking part in activities,and living life are the most important preconditions of experience generation.Emotional influence,situational edification,and arts edification ale extemal factors that induce experience generation.

  15. Impacts on power generation

    International Nuclear Information System (INIS)

    Myers, J.; Sidebotton, P.

    1998-01-01

    The future impact of the arrival of natural gas in the Maritime provinces on electricity generation in the region was discussed. Currently, electrical generation sources in Nova Scotia include hydro generation (9 per cent), coal generation (80 per cent), heavy fuel oil generation (8 per cent), and light oil, wood chips and purchased power (3 per cent). It is expected that with the introduction of natural gas electric utilities will take advantage of new gas combustion turbines which have high efficiency rates. An overview of Westcoast Power's operations across Canada was also presented. The Company has three projects in the Maritimes - the Courtney Bay project in New Brunswick, the Bayside Power project, the Irving Paper project - in addition to the McMahon cogeneration plant in Taylor, B.C. figs

  16. Quantum random number generator

    Science.gov (United States)

    Soubusta, Jan; Haderka, Ondrej; Hendrych, Martin

    2001-03-01

    Since reflection or transmission of a quantum particle on a beamsplitter is inherently random quantum process, a device built on this principle does not suffer from drawbacks of neither pseudo-random computer generators or classical noise sources. Nevertheless, a number of physical conditions necessary for high quality random numbers generation must be satisfied. Luckily, in quantum optics realization they can be well controlled. We present an easy random number generator based on the division of weak light pulses on a beamsplitter. The randomness of the generated bit stream is supported by passing the data through series of 15 statistical test. The device generates at a rate of 109.7 kbit/s.

  17. Procedure generation and verification

    International Nuclear Information System (INIS)

    Sheely, W.F.

    1986-01-01

    The Department of Energy has used Artificial Intelligence of ''AI'' concepts to develop two powerful new computer-based techniques to enhance safety in nuclear applications. The Procedure Generation System, and the Procedure Verification System, can be adapted to other commercial applications, such as a manufacturing plant. The Procedure Generation System can create a procedure to deal with the off-normal condition. The operator can then take correct actions on the system in minimal time. The Verification System evaluates the logic of the Procedure Generator's conclusions. This evaluation uses logic techniques totally independent of the Procedure Generator. The rapid, accurate generation and verification of corrective procedures can greatly reduce the human error, possible in a complex (stressful/high stress) situation

  18. EGG: Empirical Galaxy Generator

    Science.gov (United States)

    Schreiber, C.; Elbaz, D.; Pannella, M.; Merlin, E.; Castellano, M.; Fontana, A.; Bourne, N.; Boutsia, K.; Cullen, F.; Dunlop, J.; Ferguson, H. C.; Michałowski, M. J.; Okumura, K.; Santini, P.; Shu, X. W.; Wang, T.; White, C.

    2018-04-01

    The Empirical Galaxy Generator (EGG) generates fake galaxy catalogs and images with realistic positions, morphologies and fluxes from the far-ultraviolet to the far-infrared. The catalogs are generated by egg-gencat and stored in binary FITS tables (column oriented). Another program, egg-2skymaker, is used to convert the generated catalog into ASCII tables suitable for ingestion by SkyMaker (ascl:1010.066) to produce realistic high resolution images (e.g., Hubble-like), while egg-gennoise and egg-genmap can be used to generate the low resolution images (e.g., Herschel-like). These tools can be used to test source extraction codes, or to evaluate the reliability of any map-based science (stacking, dropout identification, etc.).

  19. TFTR Motor Generator

    International Nuclear Information System (INIS)

    Murray, J.G.; Bronner, G.; Horton, M.

    1977-01-01

    A general description is given of 475 MVA pulsed motor generators for TFTR at Princeton Plasma Physics Laboratory. Two identical generators operating in parallel are capable of supplying 950 MVA for an equivalent square pulse of 6.77 seconds and 4,500 MJ at 0.7 power factor to provide the energy for the pulsed electrical coils and heating system for TFTR. The description includes the operational features of the 15,000 HP wound rotor motors driving each generator with its starting equipment and cycloconverter for controlling speed, power factor, and regulating line voltage during load pulsing where the generator speed changes from 87.5 to 60 Hz frequency variation to provide the 4,500 MJ or energy. The special design characteristics such as fatigue stress calculations for 10 6 cycles of operation, forcing factor on exciter to provide regulation, and low generator impedance are reviewed

  20. Steam generator life management

    International Nuclear Information System (INIS)

    Tapping, R.L.; Nickerson, J.; Spekkens, P.; Maruska, C.

    1998-01-01

    Steam generators are a critical component of a nuclear power reactor, and can contribute significantly to station unavailability, as has been amply demonstrated in Pressurized Water Reactors (PWRs). CANDU steam generators are not immune to steam generator degradation, and the variety of CANDU steam generator designs and tube materials has led to some unexpected challenges. However, aggressive remedial actions, and careful proactive maintenance activities, have led to a decrease in steam generator-related station unavailability of Canadian CANDUs. AECL and the CANDU utilities have defined programs that will enable existing or new steam generators to operate effectively for 40 years. Research and development work covers corrosion and mechanical degradation of tube bundles and internals, chemistry, thermal hydraulics, fouling, inspection and cleaning, as well as provision for specially tool development for specific problem solving. A major driving force is development of CANDU-specific fitness-for-service guidelines, including appropriate inspection and monitoring technology to measure steam generator condition. Longer-range work focuses on development of intelligent on-line monitoring for the feedwater system and steam generator. New designs have reduced risk of corrosion and fouling, are more easily inspected and cleaned, and are less susceptible to mechanical damage. The Canadian CANDU utilities have developed programs for remedial actions to combat degradation of performance (Gentilly-2, Point Lepreau, Bruce A/B, Pickering A/B), and have developed strategic plans to ensure that good future operation is ensured. This report shows how recent advances in cleaning technology are integrated into a life management strategy, discusses downcomer flow measurement as a means of monitoring steam generator condition, and describes recent advances in hideout return as a life management tool. The research and development program, as well as operating experience, has identified

  1. Compact neutron generator

    Science.gov (United States)

    Leung, Ka-Ngo; Lou, Tak Pui

    2005-03-22

    A compact neutron generator has at its outer circumference a toroidal shaped plasma chamber in which a tritium (or other) plasma is generated. A RF antenna is wrapped around the plasma chamber. A plurality of tritium ion beamlets are extracted through spaced extraction apertures of a plasma electrode on the inner surface of the toroidal plasma chamber and directed inwardly toward the center of neutron generator. The beamlets pass through spaced acceleration and focusing electrodes to a neutron generating target at the center of neutron generator. The target is typically made of titanium tubing. Water is flowed through the tubing for cooling. The beam can be pulsed rapidly to achieve ultrashort neutron bursts. The target may be moved rapidly up and down so that the average power deposited on the surface of the target may be kept at a reasonable level. The neutron generator can produce fast neutrons from a T-T reaction which can be used for luggage and cargo interrogation applications. A luggage or cargo inspection system has a pulsed T-T neutron generator or source at the center, surrounded by associated gamma detectors and other components for identifying explosives or other contraband.

  2. OMG: Open Molecule Generator.

    Science.gov (United States)

    Peironcely, Julio E; Rojas-Chertó, Miguel; Fichera, Davide; Reijmers, Theo; Coulier, Leon; Faulon, Jean-Loup; Hankemeier, Thomas

    2012-09-17

    Computer Assisted Structure Elucidation has been used for decades to discover the chemical structure of unknown compounds. In this work we introduce the first open source structure generator, Open Molecule Generator (OMG), which for a given elemental composition produces all non-isomorphic chemical structures that match that elemental composition. Furthermore, this structure generator can accept as additional input one or multiple non-overlapping prescribed substructures to drastically reduce the number of possible chemical structures. Being open source allows for customization and future extension of its functionality. OMG relies on a modified version of the Canonical Augmentation Path, which grows intermediate chemical structures by adding bonds and checks that at each step only unique molecules are produced. In order to benchmark the tool, we generated chemical structures for the elemental formulas and substructures of different metabolites and compared the results with a commercially available structure generator. The results obtained, i.e. the number of molecules generated, were identical for elemental compositions having only C, O and H. For elemental compositions containing C, O, H, N, P and S, OMG produces all the chemically valid molecules while the other generator produces more, yet chemically impossible, molecules. The chemical completeness of the OMG results comes at the expense of being slower than the commercial generator. In addition to being open source, OMG clearly showed the added value of constraining the solution space by using multiple prescribed substructures as input. We expect this structure generator to be useful in many fields, but to be especially of great importance for metabolomics, where identifying unknown metabolites is still a major bottleneck.

  3. OMG: Open Molecule Generator

    Directory of Open Access Journals (Sweden)

    Peironcely Julio E

    2012-09-01

    Full Text Available Abstract Computer Assisted Structure Elucidation has been used for decades to discover the chemical structure of unknown compounds. In this work we introduce the first open source structure generator, Open Molecule Generator (OMG, which for a given elemental composition produces all non-isomorphic chemical structures that match that elemental composition. Furthermore, this structure generator can accept as additional input one or multiple non-overlapping prescribed substructures to drastically reduce the number of possible chemical structures. Being open source allows for customization and future extension of its functionality. OMG relies on a modified version of the Canonical Augmentation Path, which grows intermediate chemical structures by adding bonds and checks that at each step only unique molecules are produced. In order to benchmark the tool, we generated chemical structures for the elemental formulas and substructures of different metabolites and compared the results with a commercially available structure generator. The results obtained, i.e. the number of molecules generated, were identical for elemental compositions having only C, O and H. For elemental compositions containing C, O, H, N, P and S, OMG produces all the chemically valid molecules while the other generator produces more, yet chemically impossible, molecules. The chemical completeness of the OMG results comes at the expense of being slower than the commercial generator. In addition to being open source, OMG clearly showed the added value of constraining the solution space by using multiple prescribed substructures as input. We expect this structure generator to be useful in many fields, but to be especially of great importance for metabolomics, where identifying unknown metabolites is still a major bottleneck.

  4. Superconducting current generators

    International Nuclear Information System (INIS)

    Genevey, P.

    1970-01-01

    After a brief summary of the principle of energy storage and liberation with superconducting coils,two current generators are described that create currents in the range 600 to 1400 A, used for two storage experiments of 25 kJ and 50 kJ respectively. The two current generators are: a) a flux pump and b) a superconducting transformer. Both could be developed into more powerful units. The study shows the advantage of the transformer over the flux pump in order to create large currents. The efficiencies of the two generators are 95 per cent and 40 to 60 per cent respectively. (author) [fr

  5. Random number generation

    International Nuclear Information System (INIS)

    Coveyou, R.R.

    1974-01-01

    The subject of random number generation is currently controversial. Differing opinions on this subject seem to stem from implicit or explicit differences in philosophy; in particular, from differing ideas concerning the role of probability in the real world of physical processes, electronic computers, and Monte Carlo calculations. An attempt is made here to reconcile these views. The role of stochastic ideas in mathematical models is discussed. In illustration of these ideas, a mathematical model of the use of random number generators in Monte Carlo calculations is constructed. This model is used to set up criteria for the comparison and evaluation of random number generators. (U.S.)

  6. PULSE SYNTHESIZING GENERATOR

    Science.gov (United States)

    Kerns, Q.A.

    1963-08-01

    >An electronlc circuit for synthesizing electrical current pulses having very fast rise times includes several sinewave generators tuned to progressively higher harmonic frequencies with signal amplitudes and phases selectable according to the Fourier series of the waveform that is to be synthesized. Phase control is provided by periodically triggering the generators at precisely controlled times. The outputs of the generators are combined in a coaxial transmission line. Any frequency-dependent delays that occur in the transmission line can be readily compensated for so that the desired signal wave shape is obtained at the output of the line. (AEC)

  7. Coal-fired generation

    CERN Document Server

    Breeze, Paul

    2015-01-01

    Coal-Fired Generation is a concise, up-to-date and readable guide providing an introduction to this traditional power generation technology. It includes detailed descriptions of coal fired generation systems, demystifies the coal fired technology functions in practice as well as exploring the economic and environmental risk factors. Engineers, managers, policymakers and those involved in planning and delivering energy resources will find this reference a valuable guide, to help establish a reliable power supply address social and economic objectives. Focuses on the evolution of the traditio

  8. Graph Generator Survey

    Energy Technology Data Exchange (ETDEWEB)

    Lothian, Joshua [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Powers, Sarah S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sullivan, Blair D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Baker, Matthew B. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Schrock, Jonathan [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Poole, Stephen W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2013-10-01

    The benchmarking effort within the Extreme Scale Systems Center at Oak Ridge National Laboratory seeks to provide High Performance Computing benchmarks and test suites of interest to the DoD sponsor. The work described in this report is a part of the effort focusing on graph generation. A previously developed benchmark, SystemBurn, allowed the emulation of different application behavior profiles within a single framework. To complement this effort, similar capabilities are desired for graph-centric problems. This report examines existing synthetic graph generator implementations in preparation for further study on the properties of their generated synthetic graphs.

  9. Power generation technologies

    CERN Document Server

    Breeze, Paul

    2014-01-01

    The new edition of Power Generation Technologies is a concise and readable guide that provides an introduction to the full spectrum of currently available power generation options, from traditional fossil fuels and the better established alternatives such as wind and solar power, to emerging renewables such as biomass and geothermal energy. Technology solutions such as combined heat and power and distributed generation are also explored. However, this book is more than just an account of the technologies - for each method the author explores the economic and environmental costs and risk factor

  10. Harmonic arbitrary waveform generator

    Science.gov (United States)

    Roberts, Brock Franklin

    2017-11-28

    High frequency arbitrary waveforms have applications in radar, communications, medical imaging, therapy, electronic warfare, and charged particle acceleration and control. State of the art arbitrary waveform generators are limited in the frequency they can operate by the speed of the Digital to Analog converters that directly create their arbitrary waveforms. The architecture of the Harmonic Arbitrary Waveform Generator allows the phase and amplitude of the high frequency content of waveforms to be controlled without taxing the Digital to Analog converters that control them. The Harmonic Arbitrary Waveform Generator converts a high frequency input, into a precision, adjustable, high frequency arbitrary waveform.

  11. Nanosecond neutron generator

    International Nuclear Information System (INIS)

    Lobov, S.I.; Pavlovskaya, N.G.; Pukhov, S.P.

    1991-01-01

    High-voltage nanosecond neutron generator for obtaining neutrons in D-T reaction is described. Yield of 6x10 6 neutron/pulse was generated in a sealed gas-filled diode with a target on the cathode by accelerating pulse voltage of approximately 0.5 MV and length at half-height of 0.5 ns and deuterium pressure of 6x10 -2 Torr. Ways of increasing neutron yield and possibilities of creating generators of nanosecond neutron pulses with great service life are considered

  12. PC Scene Generation

    Science.gov (United States)

    Buford, James A., Jr.; Cosby, David; Bunfield, Dennis H.; Mayhall, Anthony J.; Trimble, Darian E.

    2007-04-01

    AMRDEC has successfully tested hardware and software for Real-Time Scene Generation for IR and SAL Sensors on COTS PC based hardware and video cards. AMRDEC personnel worked with nVidia and Concurrent Computer Corporation to develop a Scene Generation system capable of frame rates of at least 120Hz while frame locked to an external source (such as a missile seeker) with no dropped frames. Latency measurements and image validation were performed using COTS and in-house developed hardware and software. Software for the Scene Generation system was developed using OpenSceneGraph.

  13. Philosophy of power generation

    International Nuclear Information System (INIS)

    Amein, H.; Joyia, Y.; Qureshi, M.N.; Asif, M.

    1995-01-01

    In view of the huge power demand in future, the capital investment requirements for the development of power projects to meet the future energy requirements are so alarming that public sector alone cannot manage to raise funds and participation of the private sector in power generation development has become imperative. This paper discusses a power generation philosophy based on preference to the exploitation of indigenous resources and participation of private sector. In order to have diversification in generation resources, due consideration has been given to the development of nuclear power and even non-conventional but promising technologies of solar, wind, biomass and geothermal etc. (author)

  14. French steam generator

    International Nuclear Information System (INIS)

    Remond, A.

    1986-01-01

    After recalling the potential damage mode of tubes of steam generator, the author recalls the safety criteria used in France. The improvements and the process of damage prejudice and reparation for tubular bundle are presented [fr

  15. Auxiliary Deep Generative Models

    DEFF Research Database (Denmark)

    Maaløe, Lars; Sønderby, Casper Kaae; Sønderby, Søren Kaae

    2016-01-01

    Deep generative models parameterized by neural networks have recently achieved state-of-the-art performance in unsupervised and semi-supervised learning. We extend deep generative models with auxiliary variables which improves the variational approximation. The auxiliary variables leave...... the generative model unchanged but make the variational distribution more expressive. Inspired by the structure of the auxiliary variable we also propose a model with two stochastic layers and skip connections. Our findings suggest that more expressive and properly specified deep generative models converge...... faster with better results. We show state-of-the-art performance within semi-supervised learning on MNIST (0.96%), SVHN (16.61%) and NORB (9.40%) datasets....

  16. Airburst-Generated Tsunamis

    Science.gov (United States)

    Berger, Marsha; Goodman, Jonathan

    2018-04-01

    This paper examines the questions of whether smaller asteroids that burst in the air over water can generate tsunamis that could pose a threat to distant locations. Such airburst-generated tsunamis are qualitatively different than the more frequently studied earthquake-generated tsunamis, and differ as well from tsunamis generated by asteroids that strike the ocean. Numerical simulations are presented using the shallow water equations in several settings, demonstrating very little tsunami threat from this scenario. A model problem with an explicit solution that demonstrates and explains the same phenomena found in the computations is analyzed. We discuss the question of whether compressibility and dispersion are important effects that should be included, and show results from a more sophisticated model problem using the linearized Euler equations that begins to addresses this.

  17. The nuclear power generation

    International Nuclear Information System (INIS)

    Serres, R.

    1999-01-01

    The French nuclear generating industry is highly competitive. The installations have an average age of fifteen years and are half way through their expected life. Nuclear power accounts for 70% of the profits of the French generating company, EDF. Nuclear generation has a minimal effect on the atmosphere and France has a level of CO 2 emissions, thought to be the main cause of the greenhouse effect, half that of Europe as a whole. The air in France is purer than in neighbouring countries, mainly because 75% of all electrical power is generated in nuclear plants and 15% in hydroelectric stations. The operations and maintenance of French nuclear power plants in the service and distribution companies out of a total of 100 000 employees in all, 90 % of whom are based in mainland France. (authors)

  18. Rhodium-103m generator

    International Nuclear Information System (INIS)

    Mamadaliev, N.; Levin, V.I.; Malinin, A.B.

    1978-01-01

    103 Pd separated from metal rhodium irradiated with deuterons has been used without a carrier for sup( 03m)Rh generator The generator of sup(103m)Rh is a column 6mm in diameter filled with an anionite in Cl - form (Dowex-2,8,200-400 mesh) with an adsorbed parent isotope of 103 Pd. As a result of its decay, a 103 Rh daughter isotope is accumulated, which can be washed out from the generator from time to time with a corresponding solution. To prepare the generator, 0.5g of the resin with an adsorbed 103 Pd is charged into the column containing 1g of the same resin. Washing out with 2N HCl yields more than 90% of sup(103m)Rh with a radionuclide purity of more than 99.99%

  19. Rechargeable radioactive isotope generator

    International Nuclear Information System (INIS)

    Thornton, A.K.; Cerone, F.E.

    1978-01-01

    The description is given of a rechargeable radioactive isotope generator having the following features: a box containing a transport shield, a shielded generator including elements for the absorption and holding of the parent isotope, an eluant tank, a first pipe causing this tank to communicate with the transport shield, a second pipe causing this transport shield to communicate with the shielded generator and a third pipe placing the shielded generator in communication with the outside of the unit. It also includes a shelf across the external front part of the unit a part of which is shielded by external components, a shielded elution flask in which the eluate is poured and a filter set at a point between the flask and the third pipe [fr

  20. Standard Firebrand Generator

    Data.gov (United States)

    Federal Laboratory Consortium — This apparatus, developed at EL, has been constructed to generate a controlled and repeatable size and mass distribution of glowing firebrands. The purpose of NIST...

  1. Generators for Miranda

    Energy Technology Data Exchange (ETDEWEB)

    Angiolini, G.; Borgna, H.; Garcia, A.; Fernandez, M.; Piriz, H.; Verdu, C. [IMPSA Hydrogenerators (Argentina)

    2000-10-01

    The three generators at the Miranda hydroelectric power plant on the Araguari river northwest of Belo Horizonte in the state of Minas Gerais began operation in 1998. All the electromechanical equipment for the project was supplied by IMPSA. The generators, which are driven by Francis turbines, are vertical shaft, three-phase, salient-pole synchronous machines with an output of 137 MVA. The generators successfully completed a series of studies and trials before commercial operation began and Companhia Energetica de Minas Gerais (CEMIG) is considering increasing the operation power to 150 MVA. The specification and design of the electrical aspects, stator winding, rotor, bearings, shaft line, generator cooling system, excitation system and monitoring systems are described. Electromagnetic requirements and acceptance testing results are given in two summary tables.

  2. Financing Distributed Generation

    Energy Technology Data Exchange (ETDEWEB)

    Walker, A.

    2001-06-29

    This paper introduces the engineer who is undertaking distributed generation projects to a wide range of financing options. Distributed generation systems (such as internal combustion engines, small gas turbines, fuel cells and photovoltaics) all require an initial investment, which is recovered over time through revenues or savings. An understanding of the cost of capital and financing structures helps the engineer develop realistic expectations and not be offended by the common requirements of financing organizations. This paper discusses several mechanisms for financing distributed generation projects: appropriations; debt (commercial bank loan); mortgage; home equity loan; limited partnership; vendor financing; general obligation bond; revenue bond; lease; Energy Savings Performance Contract; utility programs; chauffage (end-use purchase); and grants. The paper also discusses financial strategies for businesses focusing on distributed generation: venture capital; informal investors (''business angels''); bank and debt financing; and the stock market.

  3. Steam generator water lancing

    International Nuclear Information System (INIS)

    Kamler, F.; Schneider, W.

    1992-01-01

    The tubesheet and tube support plate deposits in CANDU steam generators are notable for their hardness. Also notable is the wide variety of steam generator access situations. Because of the sludge hardness and the difficulty of the access, traditional water lancing processes which directed jets from the central tube free lane or from the periphery of the bundle have proven unsuitable. This has led to the need for some very unique inter tube water lancing devices which could direct powerful water jets directly onto the deposits. This type of process was applied to the upper broached plates of the Bruce A steam generators, which had become severely blocked. It has since been applied to various other steam generator situations. This paper describes the flexlance equipment development, qualification, and performance in the various CANDU applications. 4 refs., 2 tabs., 7 figs

  4. Financing Distributed Generation

    International Nuclear Information System (INIS)

    Walker, A.

    2001-01-01

    This paper introduces the engineer who is undertaking distributed generation projects to a wide range of financing options. Distributed generation systems (such as internal combustion engines, small gas turbines, fuel cells and photovoltaics) all require an initial investment, which is recovered over time through revenues or savings. An understanding of the cost of capital and financing structures helps the engineer develop realistic expectations and not be offended by the common requirements of financing organizations. This paper discusses several mechanisms for financing distributed generation projects: appropriations; debt (commercial bank loan); mortgage; home equity loan; limited partnership; vendor financing; general obligation bond; revenue bond; lease; Energy Savings Performance Contract; utility programs; chauffage (end-use purchase); and grants. The paper also discusses financial strategies for businesses focusing on distributed generation: venture capital; informal investors (''business angels''); bank and debt financing; and the stock market

  5. Voltage regulator for generator

    Energy Technology Data Exchange (ETDEWEB)

    Naoi, K

    1989-01-17

    It is an object of this invention to provide a voltage regulator for a generator charging a battery, wherein even if the ambient temperature at the voltage regulator rises abnormally high, possible thermal breakage of the semiconductor elements constituting the voltage regulator can be avoided. A feature of this invention is that the semiconductor elements can be protected from thermal breakage, even at an abnormal ambient temperature rise at the voltage regulator for the battery charging generator, by controlling a maximum conduction ratio of a power transistor in the voltage regulator in accordance with the temperature at the voltage regulator. This is achieved through a switching device connected in series to the field coil of the generator and adapted to be controlled in accordance with an output voltage of the generator and the ambient temperature at the voltage regulator. 6 figs.

  6. Wind electric power generation

    International Nuclear Information System (INIS)

    Koch, M.K.; Wind, L.; Canter, B.; Moeller, T.

    2001-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of the private wind turbines. For each wind turbine the name of the site and of the type of turbine is given, and the power generation data are given for the month in question together with the total production in 1999 and 2000. Also the data of operation start are given. On the map of Denmark the sites of the wind turbines are marked. (CLS)

  7. Wind electric power generation

    International Nuclear Information System (INIS)

    Koch, M. K.; Wind, L.; Canter, B.; Moeller, T.

    2002-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of the private wind turbines. For each wind turbine the name of the site and of the type of turbine is given, and the power generation data are given for the month in question together with the total production in 2000 and 2001. Also the data of operation start are given. On the map of Denmark the sites of the wind turbines are marked. (SM)

  8. Automated lattice data generation

    Directory of Open Access Journals (Sweden)

    Ayyar Venkitesh

    2018-01-01

    Full Text Available The process of generating ensembles of gauge configurations (and measuring various observables over them can be tedious and error-prone when done “by hand”. In practice, most of this procedure can be automated with the use of a workflow manager. We discuss how this automation can be accomplished using Taxi, a minimal Python-based workflow manager built for generating lattice data. We present a case study demonstrating this technology.

  9. The Aeolian Asynchronous Generator

    Directory of Open Access Journals (Sweden)

    Ionel Dragomirescu

    2008-10-01

    Full Text Available The production of the electric energy with lower costs could be realized with the help of the aeolian electric central. In these centrals we can use the squirrel cage asynchronous generators, because these machines are the most safety in function and easy exploited. This work show the function analyzing of the asynchronous generator having on involving torque depending on the square wind speed, the air-density and on the construction of the wing spiral.

  10. Automated lattice data generation

    Science.gov (United States)

    Ayyar, Venkitesh; Hackett, Daniel C.; Jay, William I.; Neil, Ethan T.

    2018-03-01

    The process of generating ensembles of gauge configurations (and measuring various observables over them) can be tedious and error-prone when done "by hand". In practice, most of this procedure can be automated with the use of a workflow manager. We discuss how this automation can be accomplished using Taxi, a minimal Python-based workflow manager built for generating lattice data. We present a case study demonstrating this technology.

  11. Quad precision delay generator

    International Nuclear Information System (INIS)

    Krishnan, Shanti; Gopalakrishnan, K.R.; Marballi, K.R.

    1997-01-01

    A Quad Precision Delay Generator delays a digital edge by a programmed amount of time, varying from nanoseconds to microseconds. The output of this generator has an amplitude of the order of tens of volts and rise time of the order of nanoseconds. This was specifically designed and developed to meet the stringent requirements of the plasma focus experiments. Plasma focus is a laboratory device for producing and studying nuclear fusion reactions in hot deuterium plasma. 3 figs

  12. Steam generator tube failures

    International Nuclear Information System (INIS)

    MacDonald, P.E.; Shah, V.N.; Ward, L.W.; Ellison, P.G.

    1996-04-01

    A review and summary of the available information on steam generator tubing failures and the impact of these failures on plant safety is presented. The following topics are covered: pressurized water reactor (PWR), Canadian deuterium uranium (CANDU) reactor, and Russian water moderated, water cooled energy reactor (VVER) steam generator degradation, PWR steam generator tube ruptures, the thermal-hydraulic response of a PWR plant with a faulted steam generator, the risk significance of steam generator tube rupture accidents, tubing inspection requirements and fitness-for-service criteria in various countries, and defect detection reliability and sizing accuracy. A significant number of steam generator tubes are defective and are removed from service or repaired each year. This wide spread damage has been caused by many diverse degradation mechanisms, some of which are difficult to detect and predict. In addition, spontaneous tube ruptures have occurred at the rate of about one every 2 years over the last 20 years, and incipient tube ruptures (tube failures usually identified with leak detection monitors just before rupture) have been occurring at the rate of about one per year. These ruptures have caused complex plant transients which have not always been easy for the reactor operators to control. Our analysis shows that if more than 15 tubes rupture during a main steam line break, the system response could lead to core melting. Although spontaneous and induced steam generator tube ruptures are small contributors to the total core damage frequency calculated in probabilistic risk assessments, they are risk significant because the radionuclides are likely to bypass the reactor containment building. The frequency of steam generator tube ruptures can be significantly reduced through appropriate and timely inspections and repairs or removal from service

  13. Dust devil generation

    International Nuclear Information System (INIS)

    G Onishchenko, O; A Pokhotelov, O; Horton, W; Stenflo, L

    2014-01-01

    The equations describing axi-symmetric nonlinear internal gravity waves in an unstable atmosphere are derived. A hydrodynamic model of a dust devil generation mechanism in such an atmosphere is investigated. It is shown that in an unstably stratified atmosphere the convective plumes with poloidal motion can grow exponentially. Furthermore, it is demonstrated that these convective plumes in an atmosphere with weak large scale toroidal motion are unstable with respect to three-dimensional dust devil generation. (papers)

  14. Wave Generation Theory

    DEFF Research Database (Denmark)

    Frigaard, Peter; Høgedal, Michael; Christensen, Morten

    The intention of this manual is to provide some formulas and techniques which can be used for generating waves in hydraulic laboratories. Both long crested waves (2-D waves) and short crested waves (3-D waves) are considered.......The intention of this manual is to provide some formulas and techniques which can be used for generating waves in hydraulic laboratories. Both long crested waves (2-D waves) and short crested waves (3-D waves) are considered....

  15. Next generation initiation techniques

    Science.gov (United States)

    Warner, Tom; Derber, John; Zupanski, Milija; Cohn, Steve; Verlinde, Hans

    1993-01-01

    Four-dimensional data assimilation strategies can generally be classified as either current or next generation, depending upon whether they are used operationally or not. Current-generation data-assimilation techniques are those that are presently used routinely in operational-forecasting or research applications. They can be classified into the following categories: intermittent assimilation, Newtonian relaxation, and physical initialization. It should be noted that these techniques are the subject of continued research, and their improvement will parallel the development of next generation techniques described by the other speakers. Next generation assimilation techniques are those that are under development but are not yet used operationally. Most of these procedures are derived from control theory or variational methods and primarily represent continuous assimilation approaches, in which the data and model dynamics are 'fitted' to each other in an optimal way. Another 'next generation' category is the initialization of convective-scale models. Intermittent assimilation systems use an objective analysis to combine all observations within a time window that is centered on the analysis time. Continuous first-generation assimilation systems are usually based on the Newtonian-relaxation or 'nudging' techniques. Physical initialization procedures generally involve the use of standard or nonstandard data to force some physical process in the model during an assimilation period. Under the topic of next-generation assimilation techniques, variational approaches are currently being actively developed. Variational approaches seek to minimize a cost or penalty function which measures a model's fit to observations, background fields and other imposed constraints. Alternatively, the Kalman filter technique, which is also under investigation as a data assimilation procedure for numerical weather prediction, can yield acceptable initial conditions for mesoscale models. The

  16. Magnetohydrodynamic generation method

    International Nuclear Information System (INIS)

    Masai, Tadahisa; Ishibashi, Eiichi; Kojima, Akihiro.

    1967-01-01

    The present invention relates to a magneto-hydrodynamic generation method which increases the conductivity of active gas and the generated energy. In the conventional method of open-cycle magnetohydrodynamic generation, the working fluid does not possess a favorable electric conductivity since the collision cross section is large when the combustion is carried out in a condition of excess oxygen. Furthermore, combustion under a condition of oxygen shortage is uncapable of completely converting the generated energy. The air preheater or boiler is not sufficient to collect the waste gas resulting in damage and other economic disadvantages. In the present invention, the combustion gas caused by excess fuel in the combuster is supplied to the generator as the working gas, to which air or fully oxidized air is added to be reheated. While incomplete gas used for heat collection is not adequate, the unburned damage may be eliminated by combusting again and increasing the gas temperature and heat collection rate. Furthermore, a diffuser is mounted at the rear side of the generator to decrease the gas combustion rate. Thus, even when directly absorbing the preheated fully oxidized air or the ordinary air, the boiler is free from damage caused by combustion delay or impulsive force. (M. Ishida)

  17. Next generation PWR

    International Nuclear Information System (INIS)

    Tanaka, Toshihiko; Fukuda, Toshihiko; Usui, Shuji

    2001-01-01

    Development of LWR for power generation in Japan has been intended to upgrade its reliability, safety, operability, maintenance and economy as well as to increase its capacity in order, since nuclear power generation for commercial use was begun on 1970, to steadily increase its generation power. And, in Japan, ABWR (advanced BWR) of the most promising LWR in the world, was already used actually and APWR (advanced PWR) with the largest output in the world is also at a step of its actual use. And, development of the APWR in Japan was begun on 1980s, and is at a step of plan on construction of its first machine at early of this century. However, by large change of social affairs, economy of nuclear power generation is extremely required, to be positioned at an APWR improved development reactor promoted by collaboration of five PWR generation companies and the Mitsubishi Electric Co., Ltd. Therefore, on its development, investigation on effect of change in social affairs on nuclear power stations was at first carried out, to establish a design requirement for the next generation PWR. Here were described on outline, reactor core design, safety concept, and safety evaluation of APWR+ and development of an innovative PWR. (G.K.)

  18. Observations of polar patches generated by solar wind Alfvén wave coupling to the dayside magnetosphere

    Directory of Open Access Journals (Sweden)

    P. Prikryl

    Full Text Available A long series of polar patches was observed by ionosondes and an all-sky imager during a disturbed period (Kp = 7- and IMF Bz < 0. The ionosondes measured electron densities of up to 9 × 1011 m-3 in the patch center, an increase above the density minimum between patches by a factor of sim4.5. Bands of F-region irregularities generated at the equatorward edge of the patches were tracked by HF radars. The backscatter bands were swept northward and eastward across the polar cap in a fan-like formation as the afternoon convection cell expanded due to the IMF By > 0. Near the north magnetic pole, an all-sky imager observed the 630-nm emission patches of a distinctly band-like shape drifting northeastward to eastward. The 630-nm emission patches were associated with the density patches and backscatter bands. The patches originated in, or near, the cusp footprint where they were formed by convection bursts (flow channel events, FCEs structuring the solar EUV-produced photoionization and the particle-produced auroral/cusp ionization by segmenting it into elongated patches. Just equatorward of the cusp footprint Pc5 field line resonances (FLRs were observed by magnetometers, riometers and VHF/HF radars. The AC electric field associated with the FLRs resulted in a poleward-progressing zonal flow pattern and backscatter bands. The VHF radar Doppler spectra indicated the presence of steep electron density gradients which, through the gradient drift instability, can lead to the generation of the ionospheric irregularities found in patches. The FLRs and FCEs were associated with poleward-progressing DPY currents (Hall currents modulated by the IMF By and riometer absorption enhancements. The temporal and spatial characteristics of the VHF backscatter and associated riometer absorptions closely resembled those of poleward moving auroral forms (PMAFs. In the solar

  19. The Gel Generator option

    International Nuclear Information System (INIS)

    Boyd, R.E.

    1999-01-01

    The development of a national policy for guaranteeing an ample supply of 99m Tc to nuclear medicine, involves issues which go beyond the means by which radioactivation is achieved. Indeed, in such an exercise the pragmatic dictates of business and the sensitivities of politics must also be taken into account. Furthermore where a preference towards the nuclear reactor or the potential of cyclotrons is being questioned, the debate is incomplete if the only options that are considered are the fission-based 99 Mo generator versus the direct cyclotron production of 99m Tc. There is a third option (also neutron γ-based), an alternative to the fission 99 Mo generator, which ought not be overlooked. The application of low specific activity (n,γ) 99 Mo to a new type of generator, the Gel Generator, has been the focus of much research, particularly in Australia and more recently in China. After the initial concept had been established in the laboratory, the Australian researchers then undertook a comprehensive program of tests on the Gel Generator to assess its potential, either in the clinical laboratory or the centralised radiopharmacy, for supplying 99m Tc suitable for nuclear medicine. The outcome of this program was a clear indication that the Gel Generator innovation had the capability to provide both technical and economic advantages to the nuclear medicine industry. These advantages are described. Since that time the Gel Generator has been selected for routine use in China where it now satisfies more than 30% of the 99m Tc demand. (author)

  20. Generation IV reactors: economics

    International Nuclear Information System (INIS)

    Dupraz, B.; Bertel, E.

    2003-01-01

    The operating nuclear reactors were built over a short period: no more than 10 years and today their average age rounds 18 years. EDF (French electricity company) plans to renew its reactor park over a far longer period : 30 years from 2020 to 2050. According to EDF this objective implies 3 constraints: 1) a service life of 50 to 60 years for a significant part of the present operating reactors, 2) to be ready to built a generation 3+ unit in 2020 which infers the third constraint: 3) to launch the construction of an EPR (European pressurized reactor) prototype as soon as possible in order to have it operating in 2010. In this scheme, generation 4 reactor will benefit the feedback experience of generation 3 and will take over in 2030. Economic analysis is an important tool that has been used by the generation 4 international forum to select the likely future reactor systems. This analysis is based on 4 independent criteria: the basic construction cost, the construction time, the operation and maintenance costs and the fuel cycle cost. This analysis leads to the evaluation of the global cost of electricity generation and of the total investment required for each of the reactor system. The former defines the economic competitiveness in a de-regulated energy market while the latter is linked to the financial risk taken by the investor. It appears, within the limits of the assumptions and models used, that generation 4 reactors will be characterized by a better competitiveness and an equivalent financial risk when compared with the previous generation. (A.C.)

  1. Fourth Generation Reactor Concepts

    International Nuclear Information System (INIS)

    Furtek, A.

    2008-01-01

    Concerns over energy resources availability, climate changes and energy supply security suggest an important role for nuclear energy in future energy supplies. So far nuclear energy evolved through three generations and is still evolving into new generation that is now being extensively studied. Nuclear Power Plants are producing 16% of the world's electricity. Today the world is moving towards hydrogen economy. Nuclear technologies can provide energy to dissociate water into oxygen and hydrogen and to production of synthetic fuel from coal gasification. The introduction of breeder reactors would turn nuclear energy from depletable energy supply into an unlimited supply. From the early beginnings of nuclear energy in the 1940s to the present, three generations of nuclear power reactors have been developed: First generation reactors: introduced during the period 1950-1970. Second generation: includes commercial power reactors built during 1970-1990 (PWR, BWR, Candu, Russian RBMK and VVER). Third generation: started being deployed in the 1990s and is composed of Advanced LWR (ALWR), Advanced BWR (ABWR) and Passive AP600 to be deployed in 2010-2030. Future advances of the nuclear technology designs can broaden opportunities for use of nuclear energy. The fourth generation reactors are expected to be deployed by 2030 in time to replace ageing reactors built in the 1970s and 1980s. The new reactors are to be designed with a view of the following objectives: economic competitiveness, enhanced safety, minimal radioactive waste production, proliferation resistance. The Generation IV International Forum (GIF) was established in January 2000 to investigate innovative nuclear energy system concepts. GIF members include Argentina, Brazil, Canada, Euratom, France Japan, South Africa, South Korea, Switzerland, United Kingdom and United States with the IAEA and OECD's NEA as permanent observers. China and Russia are expected to join the GIF initiative. The following six systems

  2. New Generator Technology

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Roy S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-02-17

    New generator technology project is driven by the need to be able to remotely deploy generator technology where it is needed, when it is needed. Both the military and aid programs that provide assistance after disasters could use the ability to deploy energy generation that fits the needs of the situation. Currently, pre-specified generators are deployed, sometime more than half way around the world to provide electricity. Through our Phase-I to Phase III DARPA grant, we will provide a mechanism where a 3d print station and raw materials could be shipped to a deployment site and remotely deployed personnel. These remote personnel can collaborate with engineers at a home location where 3d print plans can be optimized for the remote purpose. The plans can then be sent electronically to the remote location for printing, much like NASA sent the plans for a socket wrench to the International Space Station for printing in . If multiple generators need to be deployed at different remote locations, within miles of each other the printer rig can be moved to print the generators where they are needed. 3d printing is growing in the field of manufacturing. 3d printing has matured to the point where many types of materials are now available for many types of manufacturing. Both magnetic and electrically conductive material materials have recently been developed which can now lead to 3d printing of engines and generators. Our project will provide a successful printer rig that can be remotely deployed, to print a generator design in the field as well as provide a process for deploying the printed generator as well. This Systems Engineering Management Plan(SEMP) will provide the planning required for a Phase I DARPA grant that may also include goals for Phase II and Phase II grants. The SEMP provides a proposed project schedule, references, system engineering processes, specialty engineering system deployment and product support sections. Each section will state how our company

  3. Next-generation phylogenomics

    Directory of Open Access Journals (Sweden)

    Chan Cheong Xin

    2013-01-01

    Full Text Available Abstract Thanks to advances in next-generation technologies, genome sequences are now being generated at breadth (e.g. across environments and depth (thousands of closely related strains, individuals or samples unimaginable only a few years ago. Phylogenomics – the study of evolutionary relationships based on comparative analysis of genome-scale data – has so far been developed as industrial-scale molecular phylogenetics, proceeding in the two classical steps: multiple alignment of homologous sequences, followed by inference of a tree (or multiple trees. However, the algorithms typically employed for these steps scale poorly with number of sequences, such that for an increasing number of problems, high-quality phylogenomic analysis is (or soon will be computationally infeasible. Moreover, next-generation data are often incomplete and error-prone, and analysis may be further complicated by genome rearrangement, gene fusion and deletion, lateral genetic transfer, and transcript variation. Here we argue that next-generation data require next-generation phylogenomics, including so-called alignment-free approaches. Reviewers Reviewed by Mr Alexander Panchin (nominated by Dr Mikhail Gelfand, Dr Eugene Koonin and Prof Peter Gogarten. For the full reviews, please go to the Reviewers’ comments section.

  4. Magnetohydrodynamic power generation

    International Nuclear Information System (INIS)

    Sheindlin, A.E.; Jackson, W.D.; Brzozowski, W.S.; Rietjens, L.H.Th.

    1979-01-01

    The paper describes research and development in the field of magnetohydrodynamic power generation technology, based on discussions held in the Joint IAEA/UNESCO International Liaison Group on MHD electrical power generation. Research and development programmes on open cycle, closed cycle plasma and liquid-metal MHD are described. Open cycle MHD has now entered the engineering development stage. The paper reviews the results of cycle analyses and economic and environmental evaluations: substantial agreement has been reached on the expected overall performance and necessary component specifications. The achievement in the Soviet Union on the U-25 MHD pilot plant in obtaining full rated electrical power of 20.4 MW is described, as well as long duration testing of the integrated operation of MHD components. Work in the United States on coal-fired MHD generators has shown that, with slagging of the walls, a run time of about one hundred hours at the current density and electric field of a commercial MHD generator has been achieved. Progress obtained in closed cycle plasma and liquid metal MHD is reviewed. Electrical power densities of up to 140 MWe/m 3 and an enthalpy extraction as high as 24 per cent have been achieved in noble gas MHD generator experiments. (Auth.)

  5. MHD Generating system

    Science.gov (United States)

    Petrick, Michael; Pierson, Edward S.; Schreiner, Felix

    1980-01-01

    According to the present invention, coal combustion gas is the primary working fluid and copper or a copper alloy is the electrodynamic fluid in the MHD generator, thereby eliminating the heat exchangers between the combustor and the liquid-metal MHD working fluids, allowing the use of a conventional coalfired steam bottoming plant, and making the plant simpler, more efficient and cheaper. In operation, the gas and liquid are combined in a mixer and the resulting two-phase mixture enters the MHD generator. The MHD generator acts as a turbine and electric generator in one unit wherein the gas expands, drives the liquid across the magnetic field and thus generates electrical power. The gas and liquid are separated, and the available energy in the gas is recovered before the gas is exhausted to the atmosphere. Where the combustion gas contains sulfur, oxygen is bubbled through a side loop to remove sulfur therefrom as a concentrated stream of sulfur dioxide. The combustor is operated substoichiometrically to control the oxide level in the copper.

  6. Power generating device

    Energy Technology Data Exchange (ETDEWEB)

    Onodera, Toshihiro

    1989-05-02

    The existing power generating device consisting of static components only lacks effective measures to utilize solar energy and maintain power generation, hence it is inevitable to make the device much larger and more complicated in order to utilize it as the primary power source for artificial satellites. In view of the above, in order to offer a power generating device useful for the primary power source for satellites which is simple and can keep power generation by solar energy, this invention proposes a power generating device composed of the following elements: (1) a rectangular parallelopiped No. II superconductor plate; (2) a measure to apply a magnetic field to one face of the above superconductor plate; (3) a measure to provide a temperature difference within the range between the starting temperature and the critical temperature of superconductivity to a pair of faces meeting at right angles with the face to which the magnetic field was applied by the above measure; (4) a measure to provide an electrode on each of the other pair of faces meeting at right angles with the face to which the magnetic field was applied by the above measure and form a closed circuit by connecting the each electrode above to each of a pair of electrodes of the load respectively; and (5) a switching measure which is installed in the closed circuit prepared by the above measure and shuts off the closed circuit when the direction of the electric current running the above closed circuit is reversed. 6 figs.

  7. The Atlin Hydro Project : generation for generations

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, S. [Atlin Tlingit Development Corp., Atlin, BC (Canada)

    2010-07-01

    This presentation documented the step-by-step process by which the Atlin Hydro Project was developed. The Taku River Tlingit First Nation undertook the Atlin project as part of its vision for responsible resource management, sustainable economic development, and cultural revival. The Atlin Community Energy Plan involved an assessment of electricity demand, a 20-year demand projection, energy efficiency recommendations, and an assessment of power supply options such as wind towers, connection to the Yukon power grid, and hydro. The potential impact on fisheries, hydrology, wildlife habitat, roads and bridges, navigable waters and forests, existing rights, and First Nation archaeology were assessed, along with other factors such as hazards and flood control. A hydrology assessment of the Surprise-Pine Drainage Basin was undertaken, and stream-flow measurements were taken near the intake location on Pine Creek. The project comprises a discharge control structure and a fish ladder; an intake and weir on Pine Creek; a penstock pipeline from intake to powerhouse; a powerhouse with a 2.1 MW Pelton turbine generator and a switch yard; and a power line from the powerhouse to the interconnection with the existing grid. The impacts on fisheries, wildlife, and human movement are expected to be minimal. 28 figs., 3 tabs.

  8. Third Generation Coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2016-01-01

    German abstract: Auf der Grundlage aktueller Sozialforschung, neuer Lerntheorien und Diskurse der Personalführung entfaltet sich ein neues Verständnis von Coaching und Coaching-Psychologie. In der dritten Generation wird Coaching aus gesellschaftlicher Perspektive betrachtet. Wenn sich die...... Gesellschaft verändert, muss sich auch Coaching als spezifische Form der Interaktion weiterentwickeln: Die Mission des Third Generation Coaching ist die Entwicklung von Nachhaltigkeit in der Anwendung, indem sich der Dialog stärker auf Werte und Sinn-Schaffen ausrichtet, weg vom einengenden Zielfokus hin zur...... Betonung von Aspirationen, Leidenschaften und Werten. In diesem Sinne trägt Third Generation Coaching zur Entfaltung und Weiterentwicklung persönlicher Identität bei – ein entscheidender Faktor für die menschliche Entwicklung in unserer Zeit. Auf der Basis kollaborativer Zusammenarbeit dieses Ansatzes...

  9. Protocol Implementation Generator

    DEFF Research Database (Denmark)

    Carvalho Quaresma, Jose Nuno; Probst, Christian W.

    2010-01-01

    Users expect communication systems to guarantee, amongst others, privacy and integrity of their data. These can be ensured by using well-established protocols; the best protocol, however, is useless if not all parties involved in a communication have a correct implementation of the protocol and a...... Generator framework based on the LySatool and a translator from the LySa language into C or Java....... necessary tools. In this paper, we present the Protocol Implementation Generator (PiG), a framework that can be used to add protocol generation to protocol negotiation, or to easily share and implement new protocols throughout a network. PiG enables the sharing, verification, and translation...

  10. The Compton generator revisited

    Science.gov (United States)

    Siboni, S.

    2014-09-01

    The Compton generator, introduced in 1913 by the US physicist A H Compton as a relatively simple device to detect the Earth's rotation with respect to the distant stars, is analyzed and discussed in a general perspective. The paper introduces a generalized definition of the generator, emphasizing the special features of the original apparatus, and provides a suggestive interpretation of the way the device works. To this end, an intriguing electromagnetic analogy is developed, which turns out to be particularly useful in simplifying the calculations. Besides the more extensive description of the Compton generator in itself, the combined use of concepts and methods coming from different fields of physics, such as particle dynamics in moving references frames, continuum mechanics and electromagnetism, may be of interest to both teachers and graduate students.

  11. Liquid metal steam generator

    International Nuclear Information System (INIS)

    Wolowodiuk, W.

    1975-01-01

    A liquid metal heated steam generator is described which in the event of a tube failure quickly exhausts out of the steam generator the products of the reaction between the water and the liquid metal. The steam is generated in a plurality of bayonet tubes which are heated by liquid metal flowing over them between an inner cylinder and an outer cylinder. The inner cylinder extends above the level of liquid metal but below the main tube sheet. A central pipe extends down into the inner cylinder with a centrifugal separator between it and the inner cylinder at its lower end and an involute deflector plate above the separator so that the products of a reaction between the liquid metal and the water will be deflected downwardly by the deflector plate and through the separator so that the liquid metal will flow outwardly and away from the central pipe through which the steam and gaseous reaction products are exhausted. (U.S.)

  12. Grid generation methods

    CERN Document Server

    Liseikin, Vladimir D

    2010-01-01

    This book is an introduction to structured and unstructured grid methods in scientific computing, addressing graduate students, scientists as well as practitioners. Basic local and integral grid quality measures are formulated and new approaches to mesh generation are reviewed. In addition to the content of the successful first edition, a more detailed and practice oriented description of monitor metrics in Beltrami and diffusion equations is given for generating adaptive numerical grids. Also, new techniques developed by the author are presented, in particular a technique based on the inverted form of Beltrami’s partial differential equations with respect to control metrics. This technique allows the generation of adaptive grids for a wide variety of computational physics problems, including grid clustering to given function values and gradients, grid alignment with given vector fields, and combinations thereof. Applications of geometric methods to the analysis of numerical grid behavior as well as grid ge...

  13. The generation problem

    International Nuclear Information System (INIS)

    Ecker, G.

    1983-01-01

    Evidence for the generation structure of quarks and leptons is reviewed. The two main aspects of the generation problem are emphasized. The concept and possible problems of horizontal symmetries are discussed. Two different mechanisms for horizontal symmetries are considered leading to a generalized permutation symmetry in SU(2)sub(L) x u(1) in one case. The second mechanism uses the discrete unbroken subgroup of an axial U(1) with hypercolour anomalies in composite models. A concrete realization in the rishon model is investigated. The two different approaches produce almost identical quark mass matrices for three generations. In addition to a correct prediction for the Cabibbo angle the models yield a very small Kobayashi-Maskawa mixing angle Theta 3 and thus provide for a natural explanation of the smallness of CP violation. (Author)

  14. Automated drawing generation system

    International Nuclear Information System (INIS)

    Yoshinaga, Toshiaki; Kawahata, Junichi; Yoshida, Naoto; Ono, Satoru

    1991-01-01

    Since automated CAD drawing generation systems still require human intervention, improvements were focussed on an interactive processing section (data input and correcting operation) which necessitates a vast amount of work. As a result, human intervention was eliminated, the original objective of a computerized system. This is the first step taken towards complete automation. The effects of development and commercialization of the system are as described below. (1) The interactive processing time required for generating drawings was improved. It was determined that introduction of the CAD system has reduced the time required for generating drawings. (2) The difference in skills between workers preparing drawings has been eliminated and the quality of drawings has been made uniform. (3) The extent of knowledge and experience demanded of workers has been reduced. (author)

  15. Grid generation methods

    CERN Document Server

    Liseikin, Vladimir D

    2017-01-01

    This new edition provides a description of current developments relating to grid methods, grid codes, and their applications to actual problems. Grid generation methods are indispensable for the numerical solution of differential equations. Adaptive grid-mapping techniques, in particular, are the main focus and represent a promising tool to deal with systems with singularities. This 3rd edition includes three new chapters on numerical implementations (10), control of grid properties (11), and applications to mechanical, fluid, and plasma related problems (13). Also the other chapters have been updated including new topics, such as curvatures of discrete surfaces (3). Concise descriptions of hybrid mesh generation, drag and sweeping methods, parallel algorithms for mesh generation have been included too. This new edition addresses a broad range of readers: students, researchers, and practitioners in applied mathematics, mechanics, engineering, physics and other areas of applications.

  16. Generating ethnographic research questions

    DEFF Research Database (Denmark)

    Friberg, Torbjörn

    2015-01-01

    ? By drawing on the conceptual history of anthropology, the aim of this article is to generate ethnographic-oriented research questions concerned with higher education. The first part of the article provides an ethnographic background, while the second part focuses on Paul Willis's reasoning on ethnographic......As part of recent complex transformations, it seems that higher educational organisations are being forced to reorganise, standardise and streamline in order to survive in the new political and economic context. How are ethnographers in general going to approach these contemporary phenomena...... imagination, as a prerequisite for generating alternative research questions. The third part makes explicit anthropologist Maurice Godelier's theoretical imagination, carving out some specific theoretical parts which may be used in the generating process. The conclusion then suggests a number of questions...

  17. House of Generations

    DEFF Research Database (Denmark)

    Geert Jensen, Birgitte

    2017-01-01

    only the benefits of living close to the family. The Aarhus Municipality project "House of Generations" is a vision for creating a framework for relationships across all generations, for meaningful encounters and for rewarding neighbourliness. Three of Aarhus Municipality's magistrate departments...... participate in the project: Health and Care, Children and Youth, and Social Conditions and Employment. A public housing association that provides student dorms also participates in the project. The physical framework will be a building with a total area of approx. 25,000 m², located at Pier 4, at Aarhus......' harbour areas. The building will be a multi-generational house comprising a mixture of flexible public housing units for students, the elderly and residents who require care (elderly disabled people and people with acquired brain injuries). The building will be connected with common areas located in close...

  18. Spherical neutron generator

    Science.gov (United States)

    Leung, Ka-Ngo

    2006-11-21

    A spherical neutron generator is formed with a small spherical target and a spherical shell RF-driven plasma ion source surrounding the target. A deuterium (or deuterium and tritium) ion plasma is produced by RF excitation in the plasma ion source using an RF antenna. The plasma generation region is a spherical shell between an outer chamber and an inner extraction electrode. A spherical neutron generating target is at the center of the chamber and is biased negatively with respect to the extraction electrode which contains many holes. Ions passing through the holes in the extraction electrode are focused onto the target which produces neutrons by D-D or D-T reactions.

  19. Review of Micro Magnetic Generator

    OpenAIRE

    Lin DU; Gengchen SHI; Jingjing ZHAO

    2014-01-01

    This paper discusses the research progress of micro magnetic generator systems. Micro magnetic generator systems convert energy from the environment to electric energy with advantages as high reliability, high power density, long life time and can be applied to extreme environment. This paper summarizes methods for improving generator performance of micro magnetic generator, including rotational magnetic generator, vibrational magnetic generator and hybrid magnetic generator, analyzes and com...

  20. Programmable pulse generator

    International Nuclear Information System (INIS)

    Xue Zhihua; Lou Binqiao; Duan Xiaohui

    2002-01-01

    The author introduces the design of programmable pulse generator that is based on a micro-controller and controlled by RS232 interface of personal computer. The whole system has good stability. The pulse generator can produce TTL pulse and analog pulse. The pulse frequency can be selected by EPLD. The voltage amplitude and pulse width of analog pulse can be adjusted by analog switches and digitally-controlled potentiometers. The software development tools of computer is National Instruments LabView5.1. The front panel of this virtual instrumentation is intuitive and easy-to-use. Parameters can be selected and changed conveniently by knob and slide

  1. Hacking the next generation

    CERN Document Server

    Dhanjani, Nitesh; Hardin, Brett

    2009-01-01

    With the advent of rich Internet applications, the explosion of social media, and the increased use of powerful cloud computing infrastructures, a new generation of attackers has added cunning new techniques to its arsenal. For anyone involved in defending an application or a network of systems, Hacking: The Next Generation is one of the few books to identify a variety of emerging attack vectors. You'll not only find valuable information on new hacks that attempt to exploit technical flaws, you'll also learn how attackers take advantage of individuals via social networking sites, and abuse

  2. Seismic wave generator

    International Nuclear Information System (INIS)

    Devaure, Bernard.

    1982-01-01

    This invention concerns a device for simulating earth tremors. This device includes a seismic wave generator formed of a cylinder, one end of which is closed by one of the walls of a cell containing a soil, the other end being closed by a wall on which are fixed pyrotechnic devices generating shock waves inside the cylinder. These waves are transmitted from the cylinder to the cell through openings made in the cell wall. This device also includes a mechanical device acting as low-pass filter, located inside the cylinder and close to the cell wall [fr

  3. Intracavity vortex beam generation

    Science.gov (United States)

    Naidoo, Darryl; Aït-Ameur, Kamel; Forbes, Andrew

    2011-10-01

    In this paper we explore vortex beams and in particular the generation of single LG0l modes and superpositions thereof. Vortex beams carry orbital angular momentum (OAM) and this intrinsic property makes them prevalent in transferring this OAM to matter and to be used in quantum information processing. We explore an extra-cavity and intra-cavity approach in LG0l mode generation respectively. The outputs of a Porro-prism resonator are represented by "petals" and we show that through a full modal decomposition, the "petal" fields are a superposition of two LG0l modes.

  4. Electricity Generation Baseline Report

    Energy Technology Data Exchange (ETDEWEB)

    Logan, Jeffrey [National Renewable Energy Lab. (NREL), Golden, CO (United States); Marcy, Cara [National Renewable Energy Lab. (NREL), Golden, CO (United States); McCall, James [National Renewable Energy Lab. (NREL), Golden, CO (United States); Flores-Espino, Francisco [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bloom, Aaron [National Renewable Energy Lab. (NREL), Golden, CO (United States); Aabakken, Jorn [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cole, Wesley [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jenkin, Thomas [National Renewable Energy Lab. (NREL), Golden, CO (United States); Porro, Gian [National Renewable Energy Lab. (NREL), Golden, CO (United States); Liu, Chang [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ganda, Francesco [Argonne National Lab. (ANL), Argonne, IL (United States); Boardman, Richard [Idaho National Lab. (INL), Idaho Falls, ID (United States); Tarka, Thomas [National Energy Technology Lab. (NETL), Albany, OR (United States); Brewer, John [National Energy Technology Lab. (NETL), Albany, OR (United States); Schultz, Travis [National Energy Technology Lab. (NETL), Albany, OR (United States)

    2017-01-01

    This report was developed by a team of national laboratory analysts over the period October 2015 to May 2016 and is part of a series of studies that provide background material to inform development of the second installment of the Quadrennial Energy Review (QER 1.2). The report focuses specifically on U.S. power sector generation. The report limits itself to the generation sector and does not address in detail parallel issues in electricity end use, transmission and distribution, markets and policy design, and other important segments. The report lists 15 key findings about energy system needs of the future.

  5. Electric power generator

    International Nuclear Information System (INIS)

    Carney, H.C.

    1977-01-01

    An electric power generator of the type employing a nuclear heat source and a thermoelectric converter is described wherein a transparent thermal insulating medium is provided inside an encapsulating enclosure to thermally insulate the heat source and thermoelectric generator. The heat source, the thermoelectric converter, and the enclosure are provided with facing surfaces which are heat-reflective to a substantial degree to inhibit radiation of heat through the medium of the encapsulating enclosure. Multiple reflective foils may be spaced within the medium as necessary to inhibit natural convection of heat and/or further inhibit radiation

  6. Wind electric power generation

    International Nuclear Information System (INIS)

    Groening, B.; Koch, M.; Canter, B.; Moeller, T.

    1995-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of private wind turbines. For each wind turbine the name of the site and of the type of turbine is given, and the power generation data are given for the month in question together with the total production in 1988 and 1989. Also the data of operation start are given. On the map of Denmark the sites of the wind turbines are marked. The statistics for December 1994 comprise 2328 wind turbines

  7. Radioactive material generator

    International Nuclear Information System (INIS)

    Czaplinski, T.V.; Bolter, B.J.; Heyer, R.E.; Bruno, G.A.

    1975-01-01

    A radioactive material generator includes radioactive material in a column, which column is connected to inlet and outlet conduits, the generator being embedded in a lead casing. The inlet and outlet conduits extend through the casing and are topped by pierceable closure caps. A fitting, containing means to connect an eluent supply and an eluate container, is adapted to pierce the closure caps. The lead casing and the fitting are compatibly contoured such that they will fit only if properly aligned with respect to each other

  8. The generation game

    OpenAIRE

    Chatrakul Na Ayudhya, Uracha

    2015-01-01

    Purpose – Explores the limited value of concepts such as Baby-Boomer, Generation X and Generation Y and advances the view that life course is more valuable.\\ud \\ud Design/methodology/approach – Examines how young adults in Britain, born between 1975 and 1982, conceptualized the notion of work-life balance as they were about to leave university and enter full-time paid employment. \\ud \\ud Findings – Reveals that the notion of individual choice strongly underpins young adults’ conceptualization...

  9. ColloInputGenerator

    DEFF Research Database (Denmark)

    2013-01-01

    This is a very simple program to help you put together input files for use in Gries' (2007) R-based collostruction analysis program. It basically puts together a text file with a frequency list of lexemes in the construction and inserts a column where you can add the corpus frequencies. It requires...... it as input for basic collexeme collostructional analysis (Stefanowitsch & Gries 2003) in Gries' (2007) program. ColloInputGenerator is, in its current state, based on programming commands introduced in Gries (2009). Projected updates: Generation of complete work-ready frequency lists....

  10. Generator for ionizing radiation

    International Nuclear Information System (INIS)

    Romanovskij, V.F.; Panasjuk, V.S.; Stepanov, B.M.; Ovtscharov, A.M.; Akimov, J.A.

    1979-01-01

    The X-ray, electron, or neutron generator contains a radiation source with an accelerating tube, whose shell encloses a resonance transformer, a subdivided tube insulator and a high-tension electrode for the accelerating tube. The accelerating tube can be evacuated. The high-tension winding of the resonance transformer lies within the tube insulator of the accelerating tube and the evacuated space between resonance transformer and tube insulator. The generator may be applied in medicine, in geophysical research or for activation analysis of materials. (DG) 891 HP/DG 892 BRE [de

  11. Hera presentation generator (Poster)

    NARCIS (Netherlands)

    Frasincar, F.; Houben, G.J.P.M.; Barna, P.; Ellis, A.; Hagino, T.

    2005-01-01

    Semantic Web Information Systems (SWIS) are Web Information Systems that use Semantic Web technologies. Hera is a model-driven design methodology for SWIS. In Hera, models are represented in RDFS and model instances in RDF. The Hera Presentation Generator (HPG) is an integrated development

  12. Tredje generations coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2012-01-01

    ”Tredje generations coaching” udfolder et nyt univers for coaching og coachingpsykologi gennem en bearbejdelse af aktuel samfundsforskning, nye læringsteorier og diskurser om det personlige lederskab. ”Tredje generations coaching” er funderet på en samfundsmæssig forståelse af coaching. Coaching er...... blevet så betydningsfuld, fordi samfundet opleves som uoverskueligt og hyperkomplekst. Viden skal nu udformes og anvendes i specifikke kontekster og situationer, og både i privatliv og i det offentlige rum skal vi lære at forhandle os til rette. Coaching kan hjælpe os til at skabe ny viden og mestre...... sociale forhandlinger. Coaching er dermed en slags fødselshjælp til nye refleksioner og perspektiver, en hjælp til selvhjælp og en støtte til ens egen selvdannelsesproces. ”Tredje generations coaching” fremhæver coach og coachee i deres narrativ-samskabende partnerskab. Til forskel fra første generations...

  13. CONFIGURATION GENERATOR MODEL

    International Nuclear Information System (INIS)

    Alsaed, A.

    2004-01-01

    ''The Disposal Criticality Analysis Methodology Topical Report'' prescribes an approach to the methodology for performing postclosure criticality analyses within the monitored geologic repository at Yucca Mountain, Nevada. An essential component of the methodology is the ''Configuration Generator Model for In-Package Criticality'' that provides a tool to evaluate the probabilities of degraded configurations achieving a critical state. The configuration generator model is a risk-informed, performance-based process for evaluating the criticality potential of degraded configurations in the monitored geologic repository. The method uses event tree methods to define configuration classes derived from criticality scenarios and to identify configuration class characteristics (parameters, ranges, etc.). The probabilities of achieving the various configuration classes are derived in part from probability density functions for degradation parameters. The NRC has issued ''Safety Evaluation Report for Disposal Criticality Analysis Methodology Topical Report, Revision 0''. That report contained 28 open items that required resolution through additional documentation. Of the 28 open items, numbers 5, 6, 9, 10, 18, and 19 were concerned with a previously proposed software approach to the configuration generator methodology and, in particular, the k eff regression analysis associated with the methodology. However, the use of a k eff regression analysis is not part of the current configuration generator methodology and, thus, the referenced open items are no longer considered applicable and will not be further addressed

  14. Nuclear power generation

    International Nuclear Information System (INIS)

    Hirao, Katumi; Sato, Akira; Kaimori, Kimihiro; Kumano, Tetsuji

    2001-01-01

    Nuclear power generation for commercial use in Japan has passed 35 years since beginning of operation in the Tokai Nuclear Power Station in 1966, and has 51 machines of reactor and about 44.92 MW of total output of equipment scale in the 21st century. However, an environment around nuclear energy becomes severer at present, and then so many subjects to be overcome are remained such as increased unreliability of the public on nuclear energy at a chance of critical accident of the JCO uranium processing facility, delay of pull-thermal plan, requirement for power generation cost down against liberalization of electric power, highly aging countermeasure of power plant begun its operation as its Genesis, and so on. Under such conditions, in order that nuclear power generation in Japan survives as one of basic electric source in future, it is necessary not only to pursue safety and reliability of the plant reliable to the public, but also to intend to upgrade its operation and maintenance by positively adopting good examples on operational management method on abroad and to endeavor further upgrading of application ratio of equipments and reduction of generation cost. Here were outlined on operation conditions of nuclear power stations in Japan, and introduced on upgrading of their operational management and maintenance management. (G.K.)

  15. Large hydropower generating units

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-01

    This document presents the Brazilian experience with the design, fabrication, construction, commissioning and operation of large scale and generation capacity unities. The experience had been acquired with the implementation of Itumbiara, Paulo Afonso IV, Tucurui, Itaipu and Xingo power plants, which are among the largest world unities.

  16. Generating a scalar logic

    DEFF Research Database (Denmark)

    Ramsgaard Thomsen, Mette; Tamke, Martin

    2011-01-01

    This paper presents the design project "it's a SMALL world", an exhibition design developed for the Danish Design Centre in 2009. The project investigates the making of a generative design environment by which multiple design parameters as from program, site or the subsequent digital fabrication ...

  17. Dynamical generation of flavour

    Indian Academy of Sciences (India)

    Introduction of family symmetry and generation of flavour structure by Yukawa couplings arising as vacuum expectation values (VEVs) of 'spurion' fields offers an attractive alternative prospect for understanding flavour structure [1]. Model builders have considered various. Pramana – J. Phys., Vol. 86, No. 2, February 2016.

  18. Next Generation Inverter

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Zilai [General Motors LLC, Detroit, MI (United States); Gough, Charles [General Motors LLC, Detroit, MI (United States)

    2016-04-22

    The goal of this Cooperative Agreement was the development of a Next Generation Inverter for General Motors’ electrified vehicles, including battery electric vehicles, range extended electric vehicles, plug-in hybrid electric vehicles and hybrid electric vehicles. The inverter is a critical electronics component that converts battery power (DC) to and from the electric power for the motor (AC).

  19. Risks of power generation

    International Nuclear Information System (INIS)

    Mostert, P.

    1981-01-01

    A comparison is made between the various ways of power generation in the Netherlands and the hazards attached to them. Tables are presented of fuels used, the quantities used per annum and in the course of the last 20 years, accidents and pollution types and percentages, as well as the toxicity and waste disposal risks. (Auth.)

  20. Next generation of accelerators

    International Nuclear Information System (INIS)

    Richter, B.

    1979-01-01

    Existing high-energy accelerators are reviewed, along with those under construction or being designed. Finally, some of the physics issues which go into setting machine parameters, and some of the features of the design of next generation electron and proton machines are discussed

  1. Leading Generation Y

    Science.gov (United States)

    Coley, David C.

    2009-01-01

    School administrators are facing the perfect storm: a growing number of baby boomers retiring each year, an absence of experienced teachers to take their place, and high turnover among young teachers. The need to hire and retain a new generation of teachers is one of the biggest challenges facing school administrators. To fill these vacancies,…

  2. Loser Generated Content

    DEFF Research Database (Denmark)

    Petersen, Søren Mørk

    2008-01-01

    In this article [ 1 ] some of the critical aspects of Web 2.0 are mapped in relation to labor and the production of user generated content. For many years the Internet was considered an apt technology for subversion of capitalism by the Italian post–Marxists. What we have witnessed, however...

  3. Dynalight Next Generation

    DEFF Research Database (Denmark)

    Jørgensen, Bo Nørregaard; Ottosen, Carl-Otto; Dam-Hansen, Carsten

    2016-01-01

    The project aims to develop the next generation of energy cost-efficient artificial lighting control that enables greenhouse growers to adapt their use of artificial lighting dynamically to fluctuations in the price of electricity. This is a necessity as fluctuations in the price of electricity c...

  4. Next Generation Social Networks

    DEFF Research Database (Denmark)

    Sørensen, Lene Tolstrup; Skouby, Knud Erik

    2008-01-01

    different online networks for communities of people who share interests or individuals who presents themselves through user produced content is what makes up the social networking of today. The purpose of this paper is to discuss perceived user requirements to the next generation social networks. The paper...

  5. Point Lepreau generating station

    International Nuclear Information System (INIS)

    Ganong, G.H.D.; Strang, A.E.; Gunter, G.E.; Thompson, T.S.

    Point Lepreau-1 reactor is a 600 MWe generating station expected to be in service by October 1979. New Brunswick is suffering a 'catch up' phenomenon in load growth and needs to decrease dependence on foreign oil. The site is on salt water and extensive study has gone into corrosion control. Project management, financing and scheduling have unique aspects. (E.C.B.)

  6. Aircraft Oxygen Generation

    Science.gov (United States)

    2012-02-01

    An Oxygen Enriched Air System for the AV-8A Harrier (NADC-81198-60).” 70 Horch , T., et. al. “The F-16 Onboard Oxygen Generating System: Performance...Only and Safety Privileged). Horch , T., Miller, R., Bomar, J., Tedor, J., Holden, R., Ikels, K., & Lozano, P. (1983). The F-16 Onboard Oxygen

  7. Variable speed generators

    CERN Document Server

    Boldea, Ion

    2005-01-01

    With the deregulation of electrical energy production and distribution, says Boldea (Polytechnical Institute, Timisoara, Romania) producers are looking for ways to tailor their electricity for different markets. Variable-speed electric generators are serving that purpose, up to the 400 megavolt ampere unit size, in Japan since 1996 and Germany sinc

  8. Image scaling curve generation

    NARCIS (Netherlands)

    2012-01-01

    The present invention relates to a method of generating an image scaling curve, where local saliency is detected in a received image. The detected local saliency is then accumulated in the first direction. A final scaling curve is derived from the detected local saliency and the image is then

  9. Image scaling curve generation.

    NARCIS (Netherlands)

    2011-01-01

    The present invention relates to a method of generating an image scaling curve, where local saliency is detected in a received image. The detected local saliency is then accumulated in the first direction. A final scaling curve is derived from the detected local saliency and the image is then

  10. MEMS Solar Generators

    OpenAIRE

    Grbovic, Dragoslav; Osswald, Sebastian

    2011-01-01

    Approved for public release; distribution is unlimited Using MEMS bimaterial structures to build highly efficient solar energy generators. This is a novel approach that utilizes developments in the area of bimaterial sensors and applies them in the field of solar energy harvesting.

  11. Pulsed neutron generator

    International Nuclear Information System (INIS)

    Bespalov, D.F.; Bykovskii, Yu.A.; Vergun, I.I.; Kozlovskii, K.I.; Kozyrev, Yu.P.; Leonov, R.K.; Simagin, B.I.; Tsybin, A.S.; Shikanov, A.Ie.

    1986-03-01

    The paper describes a new device for generating pulsed neutron fields, utilized in nuclear geophysics for carrying out pulsed neutron logging and activation analysis under field conditions. The invention employs a sealed-off neutron tube with a laser ion source which increases neutron yield to the level of 10 neutrons per second or higher. 2 refs., 1 fig

  12. Steam generators and furnaces

    Energy Technology Data Exchange (ETDEWEB)

    Swoboda, E

    1978-04-01

    The documents published in 1977 in the field of steam generators for conventional thermal power plants are classified according to the following subjects: power industry and number of power plants, planning and operation, design and construction, furnaces, environmental effects, dirt accumulation and corrosion, conservation and scouring, control and automation, fundamental research, and materials.

  13. Future generations in democracy

    DEFF Research Database (Denmark)

    Jensen, Karsten Klint

    2015-01-01

    of future generations. The analysis reveals that they tend to overlook the democratic costs of such representation (violation of political equality, risk of distortion of the deliberation and undermining of autonomy), while they seem to ignore the alternative of giving consideration to the interests...

  14. Energy generation device

    International Nuclear Information System (INIS)

    Araki, Takashi; Tatsumi, Masami; Tada, Koji.

    1990-01-01

    In a reaction estimated as nuclear fusion, a portion near of electrode is heated locally to a high temperature by the heat of the reaction generated on the electrode, by which the electrode is melted or heavy water is boiled. Then, Continuous reaction is difficult and not practical. In view of the above, a cathode made of deuterium absorbing materials is put into heavy water and electric current is supplied, to continuously take place the reaction and an anode is disposed in a cylindrical cathode to cause reaction of energy generation therein in order to continuously take out the generated energy to the outside safely. Further, heavy water is circulated inside the cylindrical cathode to externally take out heavy water the temperature of which is elevated by the generated energy, and fresh heavy water is supplied to the inside of the cylindrical cathode. Thus, heavy water does not boil on the electrode, temperature elevation can be suppressed and melting of the electrode itself can be prevented. (N.H.)

  15. Mentorship: A Generational Perspective

    Science.gov (United States)

    Shadle, Eric

    2016-01-01

    Three major generations are represented in today's workforce: Baby Boomers, Gen X, and Millennials. Each of these groups has a wide range of definitions, but here they are defined according to their most common definitions: Baby boomers include those born in the decade following the end of World War II and are between the ages of 50 and 70 years.…

  16. High Voltage Seismic Generator

    Science.gov (United States)

    Bogacz, Adrian; Pala, Damian; Knafel, Marcin

    2015-04-01

    This contribution describes the preliminary result of annual cooperation of three student research groups from AGH UST in Krakow, Poland. The aim of this cooperation was to develop and construct a high voltage seismic wave generator. Constructed device uses a high-energy electrical discharge to generate seismic wave in ground. This type of device can be applied in several different methods of seismic measurement, but because of its limited power it is mainly dedicated for engineering geophysics. The source operates on a basic physical principles. The energy is stored in capacitor bank, which is charged by two stage low to high voltage converter. Stored energy is then released in very short time through high voltage thyristor in spark gap. The whole appliance is powered from li-ion battery and controlled by ATmega microcontroller. It is possible to construct larger and more powerful device. In this contribution the structure of device with technical specifications is resented. As a part of the investigation the prototype was built and series of experiments conducted. System parameter was measured, on this basis specification of elements for the final device were chosen. First stage of the project was successful. It was possible to efficiently generate seismic waves with constructed device. Then the field test was conducted. Spark gap wasplaced in shallowborehole(0.5 m) filled with salt water. Geophones were placed on the ground in straight line. The comparison of signal registered with hammer source and sparker source was made. The results of the test measurements are presented and discussed. Analysis of the collected data shows that characteristic of generated seismic signal is very promising, thus confirms possibility of practical application of the new high voltage generator. The biggest advantage of presented device after signal characteristics is its size which is 0.5 x 0.25 x 0.2 m and weight approximately 7 kg. This features with small li-ion battery makes

  17. GASIFICATION FOR DISTRIBUTED GENERATION

    Energy Technology Data Exchange (ETDEWEB)

    Ronald C. Timpe; Michael D. Mann; Darren D. Schmidt

    2000-05-01

    A recent emphasis in gasification technology development has been directed toward reduced-scale gasifier systems for distributed generation at remote sites. The domestic distributed power generation market over the next decade is expected to be 5-6 gigawatts per year. The global increase is expected at 20 gigawatts over the next decade. The economics of gasification for distributed power generation are significantly improved when fuel transport is minimized. Until recently, gasification technology has been synonymous with coal conversion. Presently, however, interest centers on providing clean-burning fuel to remote sites that are not necessarily near coal supplies but have sufficient alternative carbonaceous material to feed a small gasifier. Gasifiers up to 50 MW are of current interest, with emphasis on those of 5-MW generating capacity. Internal combustion engines offer a more robust system for utilizing the fuel gas, while fuel cells and microturbines offer higher electric conversion efficiencies. The initial focus of this multiyear effort was on internal combustion engines and microturbines as more realistic near-term options for distributed generation. In this project, we studied emerging gasification technologies that can provide gas from regionally available feedstock as fuel to power generators under 30 MW in a distributed generation setting. Larger-scale gasification, primarily coal-fed, has been used commercially for more than 50 years to produce clean synthesis gas for the refining, chemical, and power industries. Commercial-scale gasification activities are under way at 113 sites in 22 countries in North and South America, Europe, Asia, Africa, and Australia, according to the Gasification Technologies Council. Gasification studies were carried out on alfalfa, black liquor (a high-sodium waste from the pulp industry), cow manure, and willow on the laboratory scale and on alfalfa, black liquor, and willow on the bench scale. Initial parametric tests

  18. Pulsed current generator

    International Nuclear Information System (INIS)

    Semenov, V.D.; Furman, Eh.G.

    1974-01-01

    The paper describes a current pulse generator with an auxiliary network consisting of a choke and diode in series designed to enlarge the range of pulse frequency control. One output of the network is connected to an adjustable valve cathode and via antoher auxiliary condenser to the point where the cathode of the main key unit is joined to the start of the magnetizing coil. A second output is connected to the anode of another adjustable valve and via another auxiliary condenser to the point where the anode of the other main key unit is joined to the end of the magnetizing coil. The generator can be used to excite the electromagnets of charged particle accelerators or in devices designed to produce magnetic fields. (author)

  19. Why three generations?

    Directory of Open Access Journals (Sweden)

    Masahiro Ibe

    2016-07-01

    Full Text Available We discuss an anthropic explanation of why there exist three generations of fermions. If one assumes that the right-handed neutrino sector is responsible for both the matter–antimatter asymmetry and the dark matter, then anthropic selection favors three or more families of fermions. For successful leptogenesis, at least two right-handed neutrinos are needed, while the third right-handed neutrino is invoked to play the role of dark matter. The number of the right-handed neutrinos is tied to the number of generations by the anomaly constraints of the U(1B−L gauge symmetry. Combining anthropic arguments with observational constraints, we obtain predictions for the X-ray observations, as well as for neutrinoless double-beta decay.

  20. Second harmonic generation imaging

    CERN Document Server

    2013-01-01

    Second-harmonic generation (SHG) microscopy has shown great promise for imaging live cells and tissues, with applications in basic science, medical research, and tissue engineering. Second Harmonic Generation Imaging offers a complete guide to this optical modality, from basic principles, instrumentation, methods, and image analysis to biomedical applications. The book features contributions by experts in second-harmonic imaging, including many pioneering researchers in the field. Written for researchers at all levels, it takes an in-depth look at the current state of the art and possibilities of SHG microscopy. Organized into three sections, the book: Provides an introduction to the physics of the process, step-by-step instructions on how to build an SHG microscope, and comparisons with related imaging techniques Gives an overview of the capabilities of SHG microscopy for imaging tissues and cells—including cell membranes, muscle, collagen in tissues, and microtubules in live cells—by summarizing experi...

  1. Choice probability generating functions

    DEFF Research Database (Denmark)

    Fosgerau, Mogens; McFadden, Daniel; Bierlaire, Michel

    2010-01-01

    This paper establishes that every random utility discrete choice model (RUM) has a representation that can be characterized by a choice-probability generating function (CPGF) with specific properties, and that every function with these specific properties is consistent with a RUM. The choice...... probabilities from the RUM are obtained from the gradient of the CPGF. Mixtures of RUM are characterized by logarithmic mixtures of their associated CPGF. The paper relates CPGF to multivariate extreme value distributions, and reviews and extends methods for constructing generating functions for applications....... The choice probabilities of any ARUM may be approximated by a cross-nested logit model. The results for ARUM are extended to competing risk survival models....

  2. High energy neutron generator

    International Nuclear Information System (INIS)

    Barjon, R.; Breynat, G.

    1987-01-01

    This patent describes a generator of fast neutrons only slightly contaminated by neutrons of energy less than 15 MeV, comprising a source of charged particles of energy equal to at least 15 MeV, a target made of lithium deuteride, and means for cooling the target. The target comprises at least two elements placed in series in the path of the charged particles and separated from each other, the thickness of each of the elements being selected as a function of the average energy of the charged particles emitted from the source and the energy of the fast neutrons to be generated such that neutrons of energy equal to at least 15 MeV are emitted in the forward direction in response to the bombardment of the target from behind by the charged particles. The target cooling means comprises means for circulating between and around the elements a gas which does not chemically react with lithium deuteride

  3. The intense neutron generator

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, W B

    1966-07-01

    The presentation discusses both the economic and research contexts that would be served by producing neutrons in gram quantities at high intensities by electrical means without uranium-235. The revenue from producing radioisotopes is attractive. The array of techniques introduced by the multipurpose 65 megawatt Intense Neutron Generator project includes liquid metal cooling, superconducting magnets for beam bending and focussing, super-conductors for low-loss high-power radiofrequency systems, efficient devices for producing radiofrequency power, plasma physics developments for producing and accelerating hydrogen, ions at high intensity that are still far out from established practice, a multimegawatt high voltage D.C. generating machine that could have several applications. The research fields served relate principally to materials science through neutron-phonon and other quantum interactions as well as through neutron diffraction. Nuclear physics is served through {mu}-, {pi}- and K-meson production. Isotope production enters many fields of applied research. (author)

  4. Electric power generation

    International Nuclear Information System (INIS)

    Pinske, J.D.

    1981-01-01

    Apart from discussing some principles of power industry the present text deals with the different ways of electric power generation. Both the conventional methods of energy conversion in heating and water power stations and the facilities for utilizing regenerative energy sources (sun, wind, ground heat, tidal power) are considered. The script represents the essentials of the lecture of the same name which is offered to the students of the special subject 'electric power engineering' at the Fachhochschule Hamburg. It does not require any special preliminary knowledge except for the general principles of electrical engineering. It is addressing students of electrical engineering who have passed their preliminary examination at technical colleges and universities. Moreover, it shall also be of use for engineers who want to obtain a quick survey of the structure and the operating characteristics of the extremely different technical methods of power generation. (orig.) [de

  5. Inflow Turbulence Generation Methods

    Science.gov (United States)

    Wu, Xiaohua

    2017-01-01

    Research activities on inflow turbulence generation methods have been vigorous over the past quarter century, accompanying advances in eddy-resolving computations of spatially developing turbulent flows with direct numerical simulation, large-eddy simulation (LES), and hybrid Reynolds-averaged Navier-Stokes-LES. The weak recycling method, rooted in scaling arguments on the canonical incompressible boundary layer, has been applied to supersonic boundary layer, rough surface boundary layer, and microscale urban canopy LES coupled with mesoscale numerical weather forecasting. Synthetic methods, originating from analytical approximation to homogeneous isotropic turbulence, have branched out into several robust methods, including the synthetic random Fourier method, synthetic digital filtering method, synthetic coherent eddy method, and synthetic volume forcing method. This article reviews major progress in inflow turbulence generation methods with an emphasis on fundamental ideas, key milestones, representative applications, and critical issues. Directions for future research in the field are also highlighted.

  6. Thermoacoustic magnetohydrodynamic electrical generator

    International Nuclear Information System (INIS)

    Wheatley, J.C.; Swift, G.W.; Migliori, A.

    1986-01-01

    A thermoacoustic magnetohydrodynamic electrical generator is described comprising a magnet having a magnetic field, an elongate hollow housing containing an electrically conductive liquid and a thermoacoustic structure positioned in the liquid, heat exchange means thermally connected to the thermoacoustic structure for inducing the liquid to oscillate at an acoustic resonant frequency within the housing. The housing is positioned in the magnetic field and oriented such that the direction of the magnetic field and the direction of oscillatory motion of the liquid are substantially orthogonal to one another, first and second electrical conductor means connected to the liquid on opposite sides of the housing along an axis which is substantially orthogonal to both the direction of the magnetic field and the direction of oscillatory motion of the liquid, an alternating current output signal is generated in the conductor means at a frequency corresponding to the frequency of the oscillatory motion of the liquid

  7. Short pulse neutron generator

    Science.gov (United States)

    Elizondo-Decanini, Juan M.

    2016-08-02

    Short pulse neutron generators are described herein. In a general embodiment, the short pulse neutron generator includes a Blumlein structure. The Blumlein structure includes a first conductive plate, a second conductive plate, a third conductive plate, at least one of an inductor or a resistor, a switch, and a dielectric material. The first conductive plate is positioned relative to the second conductive plate such that a gap separates these plates. A vacuum chamber is positioned in the gap, and an ion source is positioned to emit ions in the vacuum chamber. The third conductive plate is electrically grounded, and the switch is operable to electrically connect and disconnect the second conductive plate and the third conductive plate. The at least one of the resistor or the inductor is coupled to the first conductive plate and the second conductive plate.

  8. JET flywheel generators

    International Nuclear Information System (INIS)

    Huart, M.; Sonnerup, L.

    1986-01-01

    Two large vertical shaft flywheel generators each provides the JET device with peak power up to 400 MW and energy up to 2600 MJ per pulse to induce and confine the multi-mega-ampere plasma current. The integrated rotor flywheel consists of a 650 tonne/10 m diameter rim carrying the poles of the machine. The energy is stored kinetically during a 9 min interval of acceleration from half-speed to full-speed and then released during a 20 s long deceleration. A design life of 100 000 cycles at full energy rating was specified. The mechanical design and construction of the generators is reviewed. Particular attention is paid to the assessment of the stresses and fatigue life of the rotor system, its dynamic behaviour (rim movement, critical speed and balancing) and on the performance in operation of the large thrust bearing. (author)

  9. Parallel Polarization State Generation.

    Science.gov (United States)

    She, Alan; Capasso, Federico

    2016-05-17

    The control of polarization, an essential property of light, is of wide scientific and technological interest. The general problem of generating arbitrary time-varying states of polarization (SOP) has always been mathematically formulated by a series of linear transformations, i.e. a product of matrices, imposing a serial architecture. Here we show a parallel architecture described by a sum of matrices. The theory is experimentally demonstrated by modulating spatially-separated polarization components of a laser using a digital micromirror device that are subsequently beam combined. This method greatly expands the parameter space for engineering devices that control polarization. Consequently, performance characteristics, such as speed, stability, and spectral range, are entirely dictated by the technologies of optical intensity modulation, including absorption, reflection, emission, and scattering. This opens up important prospects for polarization state generation (PSG) with unique performance characteristics with applications in spectroscopic ellipsometry, spectropolarimetry, communications, imaging, and security.

  10. Vertical steam generator

    International Nuclear Information System (INIS)

    Cuda, F.; Kondr, M.; Kresta, M.; Kusak, V.; Manek, O.; Turon, S.

    1982-01-01

    A vertical steam generator for nuclear power plants and dual purpose power plants consists of a cylindrical vessel in which are placed heating tubes in the form upside-down U. The heating tubes lead to the jacket of the cylindrical collector placed in the lower part of the steam generator perpendicularly to its vertical axis. The cylindrical collector is divided by a longitudinal partition into the inlet and outlet primary water sections of the heating tubes. One ends of the heating tube leads to the jacket of the collector for primary water feeding and the second ends of the heating tubes into the jacket of the collector which feeds and offtakes primary water from the heating tubes. (B.S.)

  11. Power generation statistics

    International Nuclear Information System (INIS)

    Kangas, H.

    2001-01-01

    The frost in February increased the power demand in Finland significantly. The total power consumption in Finland during January-February 2001 was about 4% higher than a year before. In January 2001 the average temperature in Finland was only about - 4 deg C, which is nearly 2 degrees higher than in 2000 and about 6 degrees higher than long term average. Power demand in January was slightly less than 7.9 TWh, being about 0.5% less than in 2000. The power consumption in Finland during the past 12 months exceeded 79.3 TWh, which is less than 2% higher than during the previous 12 months. In February 2001 the average temperature was - 10 deg C, which was about 5 degrees lower than in February 2000. Because of this the power consumption in February 2001 increased by 5%. Power consumption in February was 7.5 TWh. The maximum hourly output of power plants in Finland was 13310 MW. Power consumption of Finnish households in February 2001 was about 10% higher than in February 2000, and in industry the increase was nearly zero. The utilization rate in forest industry in February 2001 decreased from the value of February 2000 by 5%, being only about 89%. The power consumption of the past 12 months (Feb. 2000 - Feb. 2001) was 79.6 TWh. Generation of hydroelectric power in Finland during January - February 2001 was 10% higher than a year before. The generation of hydroelectric power in Jan. - Feb. 2001 was nearly 2.7 TWh, corresponding to 17% of the power demand in Finland. The output of hydroelectric power in Finland during the past 12 months was 14.7 TWh. The increase from the previous 12 months was 17% corresponding to over 18% of the power demand in Finland. Wind power generation in Jan. - Feb. 2001 was exceeded slightly 10 GWh, while in 2000 the corresponding output was 20 GWh. The degree of utilization of Finnish nuclear power plants in Jan. - Feb. 2001 was high. The output of these plants was 3.8 TWh, being about 1% less than in Jan. - Feb. 2000. The main cause for the

  12. Next generation vaccines.

    Science.gov (United States)

    Riedmann, Eva M

    2011-07-01

    In February this year, about 100 delegates gathered for three days in Vienna (Austria) for the Next Generation Vaccines conference. The meeting held in the Vienna Hilton Hotel from 23rd-25th February 2011 had a strong focus on biotech and industry. The conference organizer Jacob Fleming managed to put together a versatile program ranging from the future generation of vaccines to manufacturing, vaccine distribution and delivery, to regulatory and public health issues. Carefully selected top industry experts presented first-hand experience and shared solutions for overcoming the latest challenges in the field of vaccinology. The program also included several case study presentations on novel vaccine candidates in different stages of development. An interactive pre-conference workshop as well as interactive panel discussions during the meeting allowed all delegates to gain new knowledge and become involved in lively discussions on timely, interesting and sometimes controversial topics related to vaccines.

  13. The intense neutron generator

    International Nuclear Information System (INIS)

    Lewis, W.B.

    1966-01-01

    The presentation discusses both the economic and research contexts that would be served by producing neutrons in gram quantities at high intensities by electrical means without uranium-235. The revenue from producing radioisotopes is attractive. The array of techniques introduced by the multipurpose 65 megawatt Intense Neutron Generator project includes liquid metal cooling, superconducting magnets for beam bending and focussing, super-conductors for low-loss high-power radiofrequency systems, efficient devices for producing radiofrequency power, plasma physics developments for producing and accelerating hydrogen, ions at high intensity that are still far out from established practice, a multimegawatt high voltage D.C. generating machine that could have several applications. The research fields served relate principally to materials science through neutron-phonon and other quantum interactions as well as through neutron diffraction. Nuclear physics is served through μ-, π- and K-meson production. Isotope production enters many fields of applied research. (author)

  14. Electrochemical energy generation

    International Nuclear Information System (INIS)

    Kreysa, G.; Juettner, K.

    1993-01-01

    The proceedings encompass 40 conference papers belonging to the following subject areas: Baseline and review papers; electrochemical fuel cells; batteries: Primary and secondary cells; electrochemical, regenerative systems for energy conversion; electrochemical hydrogen generation; electrochemistry for nuclear power plant; electrochemistry for spent nuclear fuel reprocessing; energy efficiency in electrochemical processes. There is an annex listing the authors and titles of the poster session, and compacts of the posters can be obtained from the office of the Gesellschaft Deutscher Chemiker, Abteilung Tagungen. (MM) [de

  15. Second generation registry framework.

    Science.gov (United States)

    Bellgard, Matthew I; Render, Lee; Radochonski, Maciej; Hunter, Adam

    2014-01-01

    Information management systems are essential to capture data be it for public health and human disease, sustainable agriculture, or plant and animal biosecurity. In public health, the term patient registry is often used to describe information management systems that are used to record and track phenotypic data of patients. Appropriate design, implementation and deployment of patient registries enables rapid decision making and ongoing data mining ultimately leading to improved patient outcomes. A major bottleneck encountered is the static nature of these registries. That is, software developers are required to work with stakeholders to determine requirements, design the system, implement the required data fields and functionality for each patient registry. Additionally, software developer time is required for ongoing maintenance and customisation. It is desirable to deploy a sophisticated registry framework that can allow scientists and registry curators possessing standard computing skills to dynamically construct a complete patient registry from scratch and customise it for their specific needs with little or no need to engage a software developer at any stage. This paper introduces our second generation open source registry framework which builds on our previous rare disease registry framework (RDRF). This second generation RDRF is a new approach as it empowers registry administrators to construct one or more patient registries without software developer effort. New data elements for a diverse range of phenotypic and genotypic measurements can be defined at any time. Defined data elements can then be utilised in any of the created registries. Fine grained, multi-level user and workgroup access can be applied to each data element to ensure appropriate access and data privacy. We introduce the concept of derived data elements to assist the data element standards communities on how they might be best categorised. We introduce the second generation RDRF that

  16. Wind power generation

    International Nuclear Information System (INIS)

    Anon.

    1999-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of private wind turbines. The data are arranged according to the size of the turbines. For each wind turbine the name of the site and type of turbine is given as well as the production during the last 3 months in 1998, and the total production in 1997 and 1998. Data on the operation is given

  17. Wind power. [electricity generation

    Science.gov (United States)

    Savino, J. M.

    1975-01-01

    A historical background on windmill use, the nature of wind, wind conversion system technology and requirements, the economics of wind power and comparisons with alternative systems, data needs, technology development needs, and an implementation plan for wind energy are presented. Considerable progress took place during the 1950's. Most of the modern windmills feature a wind turbine electricity generator located directly at the top of their rotor towers.

  18. Generation of monoenergetic positrons

    International Nuclear Information System (INIS)

    Hulett, L.D. Jr.; Dale, J.M.; Miller, P.D. Jr.; Moak, C.D.; Pendyala, S.; Triftshaeuser, W.; Howell, R.H.; Alvarez, R.A.

    1983-01-01

    Many experiments have been performed in the generation and application of monoenergetic positron beams using annealed tungsten moderators and fast sources of 58 Co, 22 Na, 11 C, and LINAC bremstrahlung. This paper will compare the degrees of success from our various approaches. Moderators made from both single crystal and polycrystal tungsten have been tried. Efforts to grow thin films of tungsten to be used as transmission moderators and brightness enhancement devices are in progress

  19. Equilibrium and generators

    International Nuclear Information System (INIS)

    Balter, H.S.

    1994-01-01

    This work studies the behaviour of radionuclides when it produce a desintegration activity,decay and the isotopes stable creation. It gives definitions about the equilibrium between activity of parent and activity of the daughter, radioactive decay,isotope stable and transient equilibrium and maxim activity time. Some considerations had been given to generators that permit a disgregation of two radioisotopes in equilibrium and its good performance. Tabs

  20. "Asset Ownership Across Generations"

    OpenAIRE

    Ngina S. Chiteji; Frank P. Stafford

    2000-01-01

    This paper examines cross-generational connections in asset ownership. It begins by presenting a theoretical framework that develops the distinction between the intergenerational transfer of knowledge about financial assets and the direct transfer of dollars from parents to children. Its analysis of data from the Panel Study of Income Dynamics (PSID) reveals intergenerational correlations in asset ownership, and we find evidence to suggest that parental asset ownership or family-based exposur...

  1. Choice Probability Generating Functions

    DEFF Research Database (Denmark)

    Fosgerau, Mogens; McFadden, Daniel L; Bierlaire, Michel

    This paper considers discrete choice, with choice probabilities coming from maximization of preferences from a random utility field perturbed by additive location shifters (ARUM). Any ARUM can be characterized by a choice-probability generating function (CPGF) whose gradient gives the choice...... probabilities, and every CPGF is consistent with an ARUM. We relate CPGF to multivariate extreme value distributions, and review and extend methods for constructing CPGF for applications....

  2. Mechanisms for generating froissaron

    International Nuclear Information System (INIS)

    Glushko, N.I.; Kobylinski, N.A.; Martynov, E.S.; Shelest, V.P.

    1982-01-01

    From a common point of view, we consider the mechanisms for generating froissaron which arise due to the quasieikonal approximation, the U-matrix approach and the method of continued unitarity. A realistic model for the input pomeron is suggested and the data on high-energy pp-scattering are described. Likeness and difference of asymptotic and preasymptotic regimes for three variants of froissaron are discussed

  3. 350 KVA motor generators

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Each logic circuit in the central computers consumes only a fraction of a watt: however, the final load constituted by many such circuits plus peripheral equipment is nearly half a million watts. Shown here are two 350 KVA motor generators used to convert 50 Hz mains to 60 Hz (US standard). Flywheels on the M.G. shafts remove power dropouts of up to 0.5 s.

  4. Micro watt thermocurrent generator

    International Nuclear Information System (INIS)

    Bustard, T.; Goslee, D.; Barr, H.

    1976-01-01

    This nuclear thermocurrent generator to feed a cardic pacemaker should have higher life expectancy and reliability than was previously achieved. For this purpose a gettering arrangement is connected to be heat conducting immediately adjacent to the nuclear fuel arrangement in an evacuated casing. The gettering arrangement can be operated to activate at as high a temperature as possible, from 121 0 C to preferably about 204 0 C, so that a high vacuum is maintained. The current generating thermal column works at a temperature difference of 55.6 0 C. As the cold end of the column is connected to the outer casing, and should be held to a mean body temperature of 37.8 0 C, the hot side of the thermal column may only be heated to 93.4 0 C. The temperature jump from 121 0 or 204 0 to 93.4 0 is produced by a thermal resistance inserted between the hot side of the thermal column and the fuel arrangement. It may consist of a spacer made of stainless steel or by a gap, while in this first arrangement the nuclear heat generator is situated between the gettering arrangement and the thermal column, another arrangement shows the gettering arrangement enclosed in the fuel arrangement and thermal column. Here the heat flows in one direction only, the required temperature gradient is produced by suitable construction of the heat contacts between the 3 elements. Detailed constructional and manufacturing data are given for both models. Plutonium oxide is welded into a double casing as heat generator, in example the casing is made of nickel alloy. 1/10 gram of plutonium supplies a thermal energy of 50m watts, which produces a thermal current of 300 to 400 micro watts at 0.3V. (RW) [de

  5. Four Generations in Phenomenology

    Energy Technology Data Exchange (ETDEWEB)

    Kribs, Graham D. [Department of Physics, University of Oregon, Eugene, OR 97403 (United States); Plehn, Tilman [SUPA, School of Physics, University of Edinburgh, Edinburgh EH9 3JZ, Scotland (HCP speaker) (United Kingdom); Spannowsky, Michael [ASC, Department fuer Physik, Ludwig-Maximilians-Universitaet Muenchen, 80333 Muenchen (Germany); Tait, Tim M.P. [HEP Division, Argonne National Laboratory, 9700 Cass Ave., Argonne, IL 60439 (United States)

    2008-03-15

    In four-generation models Higgs masses of 115-315 GeV are perfectly allowed by electroweak precision data. In this mass range we find dramatic effects on Higgs phenomenology at hadron colliders: production rates are enhanced, weak-boson-fusion channels are suppressed, angular distributions are modified, Higgs pairs can be observed, and Higgs decays to Majorana neutrinos can lead to exotic signals.

  6. Automated Test Case Generation

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    I would like to present the concept of automated test case generation. I work on it as part of my PhD and I think it would be interesting also for other people. It is also the topic of a workshop paper that I am introducing in Paris. (abstract below) Please note that the talk itself would be more general and not about the specifics of my PhD, but about the broad field of Automated Test Case Generation. I would introduce the main approaches (combinatorial testing, symbolic execution, adaptive random testing) and their advantages and problems. (oracle problem, combinatorial explosion, ...) Abstract of the paper: Over the last decade code-based test case generation techniques such as combinatorial testing or dynamic symbolic execution have seen growing research popularity. Most algorithms and tool implementations are based on finding assignments for input parameter values in order to maximise the execution branch coverage. Only few of them consider dependencies from outside the Code Under Test’s scope such...

  7. Electricity generation cost

    International Nuclear Information System (INIS)

    Bald, M.

    1984-01-01

    Also questions of efficiency play a part in the energy discussion. In this context, the economic evaluation of different energy supply variants is of importance. Especially with regard to the generation of electric power there have been discussions again and again during the last years on the advantage of the one or the other kind of electric power generation. In the meantime, a large number of scientific studies has been published on this topic which mainly deal with comparisons of the costs of electric power generated by hard coal or nuclear energy, i.e. of those energy forms which still have the possibilities of expansion. The following part shows a way for the evaluation of efficiency comparisons which starts from simplified assumptions and which works with arithmetical aids, which don't leave the area of the fundamental operations. The general comprehensibility is paid for with cuts on ultimate analytical and arithmetical precision. It will, however, turn out that the results achieved by this method don't differ very much from those which have been won by scientific targets. (orig./UA) [de

  8. Linear wind generator

    International Nuclear Information System (INIS)

    Kozarov, A.; Petrov, O.; Antonov, J.; Sotirova, S.; Petrova, B.

    2006-01-01

    The purpose of the linear wind-power generator described in this article is to decrease the following disadvantages of the common wind-powered turbine: 1) large bending and twisting moments to the blades and the shaft, especially when strong winds and turbulence exist; 2) significant values of the natural oscillation period of the construction result in the possibility of occurrence of destroying resonance oscillations; 3) high velocity of the peripheral parts of the rotor creating a danger for birds; 4) difficulties, connected with the installation and the operation on the mountain ridges and passages where the wind energy potential is the largest. The working surfaces of the generator in questions driven by the wind are not connected with a joint shaft but each moves along a railway track with few oscillations. So the sizes of each component are small and their number can be rather large. The mechanical trajectory is not a circle but a closed outline in a vertical plain, which consists of two rectilinear sectors, one above the other, connected in their ends by semi-circumferences. The mechanical energy of each component turns into electrical on the principle of the linear electrical generator. A regulation is provided when the direction of the wind is perpendicular to the route. A possibility of effectiveness is shown through aiming of additional quantities of air to the movable components by static barriers

  9. The event generator SIMON

    International Nuclear Information System (INIS)

    Durand, D.; Lopez, O.; Nguyen, A.D.

    1997-01-01

    The utilization and development of SIMON generator work was conducted at LPC.This generator was conceived for simple and versatile simulations of different processes occurring in the nuclear collisions at Fermi Energies. At present it is utilized in a large number of French foreign laboratories. Particularly, certain analyses of INDRA data have been done by use of this generator: estimation of collective energy in the Xe + Sn and Gd + U central collisions; shape and space-time correlation analysis in fragment-fragment and particle-fragment output of the same system; calorimetric study of the Xe + Sn and Ar + Ni system; study of the vaporization for the Ar + Ni system. Recently a number of items were improved or modified, among which: the initial configuration was allowed to be non-spherical what permits the analysis of the semi-central collisions; a so-called pre-fragmentation emission may be included to estimate different time constants implied in the fragmentation process

  10. Steam generator life management

    International Nuclear Information System (INIS)

    King, P.; McGillivray, R.; Reinhardt, W.; Millman, J.; King, B.; Schneider, W.

    2003-01-01

    'Full-Text:' Steam Generator Life Management responsibility embodies doing whatever is necessary to maintain the steam generation equipment of a nuclear plant in effective, reliable service. All comes together in that most critical deliverable, namely the submission of the documentation which wins approval for return to service after an outage program. Life management must address all aspects of SG reliability over the life of the plant. Nevertheless, the life management activities leading up to return to service approval is where all of it converges. Steam Generator Life Management activities entail four types of work, all equally important in supporting the objective of successful operation. These activities are i) engineering functions; including identification of inspection and maintenance requirements, outage planning and scope definition plus engineering assessment, design and analysis as necessary to support equipment operation, ii) fitness of service work; including the expert evaluation of degradation mechanisms, disposition of defects for return to service or not, and the fitness for service analysis as required to justify ongoing operation with acceptable defects, iii) inspection work; including large scale eddy current inspection of tubing, the definition of defect size and character, code inspections of pressure vessel integrity and visual inspections for integrity and iv) maintenance work; including repairs, retrofits, cleaning and modifications, all as necessary to implement the measures defined during activities i) through iii). The paper discusses the approach and execution of the program for the achievement of the above objectives and particularly of items i) and ii). (author)

  11. Generation Z: Educating and Engaging the Next Generation of Students

    Science.gov (United States)

    Seemiller, Corey; Grace, Meghan

    2017-01-01

    In 1995, the Internet was born. So, too, was Generation Z. The oldest of this post-Millennial generation arrived to college in 2013, and more than four years later, Generation Z students fill the nation's classrooms, campus programs, and residence halls. In order to recruit, educate, and graduate this new generational cohort effectively, educators…

  12. Superconducting wind turbine generators

    International Nuclear Information System (INIS)

    Abrahamsen, A B; Seiler, E; Zirngibl, T; Andersen, N H; Mijatovic, N; Traeholt, C; Pedersen, N F; Oestergaard, J; Noergaard, P B

    2010-01-01

    We have examined the potential of 10 MW superconducting direct drive generators to enter the European offshore wind power market and estimated that the production of about 1200 superconducting turbines until 2030 would correspond to 10% of the EU offshore market. The expected properties of future offshore turbines of 8 and 10 MW have been determined from an up-scaling of an existing 5 MW turbine and the necessary properties of the superconducting drive train are discussed. We have found that the absence of the gear box is the main benefit and the reduced weight and size is secondary. However, the main challenge of the superconducting direct drive technology is to prove that the reliability is superior to the alternative drive trains based on gearboxes or permanent magnets. A strategy of successive testing of superconducting direct drive trains in real wind turbines of 10 kW, 100 kW, 1 MW and 10 MW is suggested to secure the accumulation of reliability experience. Finally, the quantities of high temperature superconducting tape needed for a 10 kW and an extreme high field 10 MW generator are found to be 7.5 km and 1500 km, respectively. A more realistic estimate is 200-300 km of tape per 10 MW generator and it is concluded that the present production capacity of coated conductors must be increased by a factor of 36 by 2020, resulting in a ten times lower price of the tape in order to reach a realistic price level for the superconducting drive train.

  13. Closing the generation gap

    International Nuclear Information System (INIS)

    Silverstein, E.

    1997-09-01

    The author has explained how the naive obstructions to unifying vacua with different net generation numbers can be overcome, and she gave a class of examples of chirality-changing phase transitions in four dimensions. The phenomenon exhibited here presumably occurs quite generally; it would be very interesting to understand whether in fact one can connect all vacua with N ≤ 1 supersymmetry at low energies. For this an F-theory analysis could be quite instructive, once that approach is developed more fully for four-folds. Perhaps the next in principle question to ask along these lines is whether there could be any physical process which changes the number of supersymmetries

  14. Improvements to vapor generators

    International Nuclear Information System (INIS)

    Keller, Arthur; Monroe, Neil.

    1976-01-01

    A supporting system is proposed for vapor generators of the 'supported' type. Said supporting system is intended to compensate the disparities of thermal expansion due to the differences in the vertical dimensions of the tubes in the walls of the combustion chamber and their collectors compared to that of the balloon tanks and the connecting tube clusters of vaporization, the first one being longer than the second ones. Said system makes it possible to build said combustion chamber higher than the balloon tanks and the tube clusters of vaporization. The capacity of steam production is thus enhanced [fr

  15. Nuclear power generating costs

    International Nuclear Information System (INIS)

    Srinivasan, M.R.; Kati, S.L.; Raman, R.; Nanjundeswaran, K.; Nadkarny, G.V.; Verma, R.S.; Mahadeva Rao, K.V.

    1983-01-01

    Indian experience pertaining to investment and generation costs of nuclear power stations is reviewed. The causes of investment cost increases are analysed and the increases are apportioned to escalation, design improvements and safety related adders. The paper brings out the fact that PHWR investment costs in India compare favourably with those experienced in developed countries in spite of the fact that the programme and the unit size are relatively much smaller in India. It brings out that in India at current prices a nuclear power station located over 800 km from coal reserves and operating at 75% capacity factor is competitive with thermal power at 60% capacity factor. (author)

  16. Next generation data harmonization

    Science.gov (United States)

    Armstrong, Chandler; Brown, Ryan M.; Chaves, Jillian; Czerniejewski, Adam; Del Vecchio, Justin; Perkins, Timothy K.; Rudnicki, Ron; Tauer, Greg

    2015-05-01

    Analysts are presented with a never ending stream of data sources. Often, subsets of data sources to solve problems are easily identified but the process to align data sets is time consuming. However, many semantic technologies do allow for fast harmonization of data to overcome these problems. These include ontologies that serve as alignment targets, visual tools and natural language processing that generate semantic graphs in terms of the ontologies, and analytics that leverage these graphs. This research reviews a developed prototype that employs all these approaches to perform analysis across disparate data sources documenting violent, extremist events.

  17. Steam generator tube performance

    International Nuclear Information System (INIS)

    Tatone, O.S.; Pathania, R.S.

    1984-10-01

    A review of the performance of steam generator tubes in 116 water-cooled nuclear power reactors showed that tubes were plugged at 54 (46 percent) of the reactors. The number of tubes removed from service decreased from 4 692 (0.30 percent) in 1981 to 3 222 (0.20 percent) in 1982. The leading causes of tube failures were stress corrosion cracking from the primary side, stress corrosion cracking (or intergranular attack) from the secondary side and pitting corrosion. The lowest incidence of corrosion-induced defects from the secondary side occurred in reactors that have used only volatile treatment, with or without condensate demineralization

  18. Steam generator tube performance

    International Nuclear Information System (INIS)

    Tatone, O.S.; Tapping, R.L.; Stipan, L.

    1992-03-01

    A survey of steam generator operating experience for 1986 has been carried out for 184 pressurized water and pressurized heavy-water reactors, and 1 water-cooled, graphite-moderated reactor. Tubes were plugged at 75 of the reactors (40.5%). In 1986, 3737 tubes were plugged (0.14% of those in service) and 3148 tubes were repaired by sleeving. A small number of reactors accounted for the bulk of the plugged tubes, a phenomenon consistent with previous years. For 1986, the available tubesheet sludge data for 38 reactors has been compiled into tabular form, and sludge/deposit data will be incorporated into all future surveys

  19. Semiconductor thermoelectric generators

    CERN Document Server

    Fahrner, Wolfgang R

    2009-01-01

    It is well-known that fossil fuels are being rapidly depleted, and that atomic power is rejected by many people. As a consequence, there is a strong trend towards alternative sources such as wind, photovoltaics, solar heat and biomass. Strangely enough, quite another power source is generally neglected: namely, the thermoelectric generator (a device which converts heat, i.e. thermal energy, directly into electrical energy). The reason for this neglect is probably the low conversion efficiency, which is of the order of a few percent at most. However, there are two arguments in favor of the ther

  20. PLEXOS Input Data Generator

    Energy Technology Data Exchange (ETDEWEB)

    2017-02-01

    The PLEXOS Input Data Generator (PIDG) is a tool that enables PLEXOS users to better version their data, automate data processing, collaborate in developing inputs, and transfer data between different production cost modeling and other power systems analysis software. PIDG can process data that is in a generalized format from multiple input sources, including CSV files, PostgreSQL databases, and PSS/E .raw files and write it to an Excel file that can be imported into PLEXOS with only limited manual intervention.

  1. Choice probability generating functions

    DEFF Research Database (Denmark)

    Fosgerau, Mogens; McFadden, Daniel; Bierlaire, Michel

    2013-01-01

    This paper considers discrete choice, with choice probabilities coming from maximization of preferences from a random utility field perturbed by additive location shifters (ARUM). Any ARUM can be characterized by a choice-probability generating function (CPGF) whose gradient gives the choice...... probabilities, and every CPGF is consistent with an ARUM. We relate CPGF to multivariate extreme value distributions, and review and extend methods for constructing CPGF for applications. The choice probabilities of any ARUM may be approximated by a cross-nested logit model. The results for ARUM are extended...

  2. Radioisotope and radiopharmaceutical generators

    International Nuclear Information System (INIS)

    Barak, M.; Winchell, H.W.

    1975-01-01

    A chromatographic column for generating technetium-99m isotopes and technetium-99m labeled pharmaceuticals in a simple two-step process is described. Technetium-99m pertechnetate in a first step is isolated by adsorption upon an adsorbent packing. Then the technetium-99m in a second step is eluted from the packing, either with an immediately labeled biological compound to form a radiopharmaceutical, or by a controlled volume of eluant to produce a 99m-technetium-bearing eluate of a desired specific concentration. (Official Gazette)

  3. Computer generated holographic microtags

    International Nuclear Information System (INIS)

    Sweatt, W.C.

    1998-01-01

    A microlithographic tag comprising an array of individual computer generated holographic patches having feature sizes between 250 and 75 nanometers is disclosed. The tag is a composite hologram made up of the individual holographic patches and contains identifying information when read out with a laser of the proper wavelength and at the proper angles of probing and reading. The patches are fabricated in a steep angle Littrow readout geometry to maximize returns in the -1 diffracted order. The tags are useful as anti-counterfeiting markers because of the extreme difficulty in reproducing them. 5 figs

  4. Biomass Energy Generation Project

    Energy Technology Data Exchange (ETDEWEB)

    Olthoff, Edward [Cedar Falls Utilities, Cedar Falls, IA (United States)

    2017-05-15

    The Municipal Electric Utility of the City of Cedar Falls (dba Cedar Fals Utilities or CFU) received a congressionally directed grant funded through DOE-EERE to run three short (4 hour) duration test burns and one long (10 days) duration test burn to test the viability of renewable fuels in Streeter Station Boiler #6, a stoker coal fired electric generation unit. The long test burn was intended to test supply chain assumptions, optimize boiler combustion and assess the effects of a longer duration burn of biomass on the boiler.

  5. Steam generator arrangement

    International Nuclear Information System (INIS)

    Ssinegurski, E.

    1981-01-01

    A steam flow path arrangement for covering the walls of the rear gas pass of a steam generator is disclosed. The entire flow passes down the sidewalls with a minor portion then passing up through the rear wall to a superheater inlet header at an intermediate elevation. The major portion of the flow passes up the front wall and through hanger tubes to a roof header. From there the major portion passes across the roof and down the rear wall to the superheater inlet header at the intermediate elevation

  6. Generation of earthquake signals

    International Nuclear Information System (INIS)

    Kjell, G.

    1994-01-01

    Seismic verification can be performed either as a full scale test on a shaker table or as numerical calculations. In both cases it is necessary to have an earthquake acceleration time history. This report describes generation of such time histories by filtering white noise. Analogue and digital filtering methods are compared. Different methods of predicting the response spectrum of a white noise signal filtered by a band-pass filter are discussed. Prediction of both the average response level and the statistical variation around this level are considered. Examples with both the IEEE 301 standard response spectrum and a ground spectrum suggested for Swedish nuclear power stations are included in the report

  7. Isotopic Thermionic Generator

    International Nuclear Information System (INIS)

    Clemot, M.; Devin, B.; Durand, J.P.

    1967-01-01

    This report describes the general design of a thermionic direct conversion space generator. The power source used is a radioisotope. Two radioisotopes are considered: Pu 238 and Cm 244. The system is made up of a heat pipe concentrating the thermal flux from the isotope to the emitter, and of a second heat pipe evacuating the waste heat from the collector to the outer wall used as radiating panel. Calculations are given in the particular case of a 100 electrical watts output power. (authors) [fr

  8. Code Generation with Templates

    CERN Document Server

    Arnoldus, Jeroen; Serebrenik, A

    2012-01-01

    Templates are used to generate all kinds of text, including computer code. The last decade, the use of templates gained a lot of popularity due to the increase of dynamic web applications. Templates are a tool for programmers, and implementations of template engines are most times based on practical experience rather than based on a theoretical background. This book reveals the mathematical background of templates and shows interesting findings for improving the practical use of templates. First, a framework to determine the necessary computational power for the template metalanguage is presen

  9. Review of Micro Magnetic Generator

    Directory of Open Access Journals (Sweden)

    Lin DU

    2014-08-01

    Full Text Available This paper discusses the research progress of micro magnetic generator systems. Micro magnetic generator systems convert energy from the environment to electric energy with advantages as high reliability, high power density, long life time and can be applied to extreme environment. This paper summarizes methods for improving generator performance of micro magnetic generator, including rotational magnetic generator, vibrational magnetic generator and hybrid magnetic generator, analyzes and compares their design and performance, and concludes key technologies and ongoing challenges for further progress. The paper is instructive and meaningful to for research work of related field.

  10. Simple and Realistic Data Generation

    DEFF Research Database (Denmark)

    Pedersen, Kenneth Houkjær; Torp, Kristian; Wind, Rico

    2006-01-01

    This paper presents a generic, DBMS independent, and highly extensible relational data generation tool. The tool can efficiently generate realistic test data for OLTP, OLAP, and data streaming applications. The tool uses a graph model to direct the data generation. This model makes it very simple...... to generate data even for large database schemas with complex inter- and intra table relationships. The model also makes it possible to generate data with very accurate characteristics....

  11. Emotion-driven level generation

    OpenAIRE

    Togelius, Julian; Yannakakis, Georgios N.

    2016-01-01

    This chapter examines the relationship between emotions and level generation. Grounded in the experience-driven procedural content generation framework we focus on levels and introduce a taxonomy of approaches for emotion-driven level generation. We then review four characteristic level generators of our earlier work that exemplify each one of the approaches introduced. We conclude the chapter with our vision on the future of emotion-driven level generation.

  12. A molecular noise generator

    International Nuclear Information System (INIS)

    Lu Ting; Ferry, Michael; Hasty, Jeff; Weiss, Ron

    2008-01-01

    Recent studies have demonstrated that intracellular variations in the rate of gene expression are of fundamental importance to cellular function and development. While such 'noise' is often considered detrimental in the context of perturbing genetic systems, it can be beneficial in processes such as species diversification and facilitation of evolution. A major difficulty in exploring such effects is that the magnitude and spectral properties of the induced variations arise from some intrinsic cellular process that is difficult to manipulate. Here, we present two designs of a molecular noise generator that allow for the flexible modulation of the noise profile of a target gene. The first design uses a dual-signal mechanism that enables independent tuning of the mean and variability of an output protein. This is achieved through the combinatorial control of two signals that regulate transcription and translation separately. We then extend the design to allow for DNA copy-number regulation, which leads to a wider tuning spectrum for the output molecule. To gain a deeper understanding of the circuit's functionality in a realistic environment, we introduce variability in the input signals in order to ascertain the degree of noise induced by the control process itself. We conclude by illustrating potential applications of the noise generator, demonstrating how it could be used to ascertain the robust or fragile properties of a genetic circuit

  13. Next generation CANDU plants

    International Nuclear Information System (INIS)

    Hedges, K.R.; Yu, S.K.W.

    1998-01-01

    Future CANDU designs will continue to meet the emerging design and performance requirements expected by the operating utilities. The next generation CANDU products will integrate new technologies into both the product features as well as into the engineering and construction work processes associated with delivering the products. The timely incorporation of advanced design features is the approach adopted for the development of the next generation of CANDU. AECL's current products consist of 700MW Class CANDU 6 and 900 MW Class CANDU 9. Evolutionary improvements are continuing with our CANDU products to enhance their adaptability to meet customers ever increasing need for higher output. Our key product drivers are for improved safety, environmental protection and improved cost effectiveness. Towards these goals we have made excellent progress in Research and Development and our investments are continuing in areas such as fuel channels and passive safety. Our long term focus is utilizing the fuel cycle flexibility of CANDU reactors as part of the long term energy mix

  14. Next generation toroidal devices

    International Nuclear Information System (INIS)

    Yoshikawa, Shoichi

    1998-10-01

    A general survey of the possible approach for the next generation toroidal devices was made. Either surprisingly or obviously (depending on one's view), the technical constraints along with the scientific considerations lead to a fairly limited set of systems for the most favorable approach for the next generation devices. Specifically if the magnetic field strength of 5 T or above is to be created by superconducting coils, it imposes minimum in the aspect ratio for the tokamak which is slightly higher than contemplated now for ITER design. The similar technical constraints make the minimum linear size of a stellarator large. Scientifically, it is indicated that a tokamak of 1.5 times in the linear dimension should be able to produce economically, especially if a hybrid reactor is allowed. For the next stellarator, it is strongly suggested that some kind of helical axis is necessary both for the (almost) absolute confinement of high energy particles and high stability and equilibrium beta limits. The author still favors a heliac most. Although it may not have been clearly stated in the main text, the stability afforded by the shearless layer may be exploited fully in a stellarator. (author)

  15. Next generation toroidal devices

    Energy Technology Data Exchange (ETDEWEB)

    Yoshikawa, Shoichi [Princeton Plasma Physics Lab., Princeton Univ., NJ (United States)

    1998-10-01

    A general survey of the possible approach for the next generation toroidal devices was made. Either surprisingly or obviously (depending on one`s view), the technical constraints along with the scientific considerations lead to a fairly limited set of systems for the most favorable approach for the next generation devices. Specifically if the magnetic field strength of 5 T or above is to be created by superconducting coils, it imposes minimum in the aspect ratio for the tokamak which is slightly higher than contemplated now for ITER design. The similar technical constraints make the minimum linear size of a stellarator large. Scientifically, it is indicated that a tokamak of 1.5 times in the linear dimension should be able to produce economically, especially if a hybrid reactor is allowed. For the next stellarator, it is strongly suggested that some kind of helical axis is necessary both for the (almost) absolute confinement of high energy particles and high stability and equilibrium beta limits. The author still favors a heliac most. Although it may not have been clearly stated in the main text, the stability afforded by the shearless layer may be exploited fully in a stellarator. (author)

  16. Stretchable piezoelectric nanocomposite generator.

    Science.gov (United States)

    Park, Kwi-Il; Jeong, Chang Kyu; Kim, Na Kyung; Lee, Keon Jae

    2016-01-01

    Piezoelectric energy conversion that generate electric energy from ambient mechanical and vibrational movements is promising energy harvesting technology because it can use more accessible energy resources than other renewable natural energy. In particular, flexible and stretchable piezoelectric energy harvesters which can harvest the tiny biomechanical motions inside human body into electricity properly facilitate not only the self-powered energy system for flexible and wearable electronics but also sensitive piezoelectric sensors for motion detectors and in vivo diagnosis kits. Since the piezoelectric ZnO nanowires (NWs)-based energy harvesters (nanogenerators) were proposed in 2006, many researchers have attempted the nanogenerator by using the various fabrication process such as nanowire growth, electrospinning, and transfer techniques with piezoelectric materials including polyvinylidene fluoride (PVDF) polymer and perovskite ceramics. In 2012, the composite-based nanogenerators were developed using simple, low-cost, and scalable methods to overcome the significant issues with previously-reported energy harvester, such as insufficient output performance and size limitation. This review paper provides a brief overview of flexible and stretchable piezoelectric nanocomposite generator for realizing the self-powered energy system with development history, power performance, and applications.

  17. Future nuclear power generation

    International Nuclear Information System (INIS)

    Mosbah, D.S.; Nasreddine, M.

    2006-01-01

    The book includes an introduction then it speaks about the options to secure sources of energy, nuclear power option, nuclear plants to generate energy including light-water reactors (LWR), heavy-water reactors (HWR), advanced gas-cooled reactors (AGR), fast breeder reactors (FBR), development in the manufacture of reactors, fuel, uranium in the world, current status of nuclear power generation, economics of nuclear power, nuclear power and the environment and nuclear power in the Arab world. A conclusion at the end of the book suggests the increasing demand for energy in the industrialized countries and in a number of countries that enjoy special and economic growth such as China and India pushes the world to search for different energy sources to insure the urgent need for current and anticipated demand in the near and long-term future in light of pessimistic and optimistic outlook for energy in the future. This means that states do a scientific and objective analysis of the currently available data for the springboard to future plans to secure the energy required to support economy and welfare insurance.

  18. ULSGEN (Uplink Summary Generator)

    Science.gov (United States)

    Wang, Y.-F.; Schrock, M.; Reeve, T.; Nguyen, K.; Smith, B.

    2014-01-01

    Uplink is an important part of spacecraft operations. Ensuring the accuracy of uplink content is essential to mission success. Before commands are radiated to the spacecraft, the command and sequence must be reviewed and verified by various teams. In most cases, this process requires collecting the command data, reviewing the data during a command conference meeting, and providing physical signatures by designated members of various teams to signify approval of the data. If commands or sequences are disapproved for some reason, the whole process must be restarted. Recording data and decision history is important for traceability reasons. Given that many steps and people are involved in this process, an easily accessible software tool for managing the process is vital to reducing human error which could result in uplinking incorrect data to the spacecraft. An uplink summary generator called ULSGEN was developed to assist this uplink content approval process. ULSGEN generates a web-based summary of uplink file content and provides an online review process. Spacecraft operations personnel view this summary as a final check before actual radiation of the uplink data. .

  19. Steam generator materials

    International Nuclear Information System (INIS)

    Kim, Joung Soo; Han, J. H.; Kim, H. P.; Lim, Y. S.; Lee, D. H.; Suh, J. H.; Hwang, S. S.; Hur, D. H.; Kim, D. J.; Kim, Y. H.

    2002-05-01

    In order to keep the nuclear power plant(NPP)s safe and increase their operating efficiency, axial stress corrosion cracking(SCC)(IGA/IGSCC, PWSCC, PbSCC) test techniques were developed and SCC property data of the archive steam generator tubing materials having been used in nuclear power plants operating in Korea were produced. The data obtained in this study were data-based, which will be used to clarify the damage mechanisms, to operate the plants safely, and to increase the lifetime of the tubing. In addition, the basic technologies for the improvement of the SCC property of the tubing materials, for new SCC inhibition, for damaged tube repair, and for manufacturing processes of the tubing were developed. In the 1 phase of this long term research, basic SCC test data obtained from the archive steam generator tubing materials used in NPPs operating in Korea were established. These basic technologies developed in the 1 phase will be used in developing process optimization during the 2 phase in order to develop application technologies to the field nuclear power plants

  20. Teaching Millennials and Generation Z: Bridging the Generational Divide.

    Science.gov (United States)

    Shatto, Bobbi; Erwin, Kelly

    2017-02-01

    Most undergraduate students today are part of the millennial generation. However, the next wave of students-Generation Z-are just beginning to enter universities. Although these groups share many similarities, they each have unique characteristics that create challenges in the classroom. Incorporating technology, engaging students with adaptive learning activities, and understanding basic generational differences are ways to limit the effects of generational conflict while keeping both millennials and Generation Z students engaged in learning. It is important to understand basic differences and distinctions across generations for developing pedagogy that reaches these unique student populations.

  1. Manual for the ELL (2) - parser generator and tree generator generator

    OpenAIRE

    Heckmann, Reinhold

    1986-01-01

    Regular right part grammars extended by tree generator specifications are interpreted by a combined parser generator and tree generator that produces an ELL(2) parser. This parser is able to translate programs of the specified language into abstract syntax trees according to the tree specifications in the generator input.

  2. Tri-generation nation

    International Nuclear Information System (INIS)

    Pichon, Max

    2010-01-01

    Full text: Sydney and Melbourne councils are looking to outperform each other with ambitious greenhouse and energy efficiency initiatives. Sydney wants to cut CO_2 by 70 per cent by 2030, while Melbourne's 1200 Buildings retrofit project speaks for itself. One key technology both councils are tapping is trigeneration, which generates electricity, heating and cooling from local gas-fired power units. From a physics perspective, a combustion process cannot be more than 30 per cent efficient, so capturing and using the waste heat can lead to great savings. Sydney Lord Mayor Clover Moore said a third of the council's carbon reduction goal of 3.9Mt a year by 2030 will come from tri-gen. Melbourne is aiming to achieve zero net emissions by 2020, which means eliminating 5.8Mt of CO_2, a lot of it through tri-gen. It has already seen a surge among landlords. GPT, Stockland and Mirvac have all stuck tri-gen units in Sydney office developments, while newly carbon- neutral NAB has installed the technology on its data centre in Melbourne and expects to save 20,000 tonnes of CO_2 a year. But one expert, while welcoming the spike in popularity, says there are traps for the unwary. Johnson Controls' Peter Moser sees two core drivers for its uptake. “First is the prominence of GreenStar and NABERS. Many companies will move to tri-gen as they will want the extra points or stars,” he told WME. “Secondly, there is the continuous increase in the price of energy. At the same time there may be an [emissions trading scheme] or a carbon price introduced, and that puts pressure on the consumer. Combining those two scenarios will see more people adopt tri-gen because it will become more economically viable and the payback periods of tri-gen will come down considerably.” But he points to the importance of pre-planning when considering tri-gen, warning. “To put tri-gen into a building, let alone retrofit a whole city and make it work, you need highly complex teams working together

  3. Wind Generators and Market Power

    DEFF Research Database (Denmark)

    Misir, Nihat

    price thresholds are significantly higher when the monopolist at the peakload level owns both types of generators. Furthermore, when producing electricity with the peakload generator, the monopolist can avoid facing prices below marginal cost by owning a certain share of the wind generators.......Electricity production from wind generators holds significant importance in European Union’s 20% renewable energy target by 2020. In this paper, I show that ownership of wind generators affects market outcomes by using both a Cournot oligopoly model and a real options model. In the Cournot...... oligopoly model, ownership of the wind generators by owners of fossil-fueled (peakload) generators decreases total peakload production and increases the market price. These effects increase with total wind generation and aggregate wind generator ownership. In the real options model, start up and shut down...

  4. Generative Moire Structures

    Directory of Open Access Journals (Sweden)

    Adrian – Mihail Marian

    2006-01-01

    Full Text Available “GRAPHIC ON COMPUTER” – the work of the Czech Petar Milojevic, published in Titus Mocanu’s book “THE MODERN ART’S MORPHOLOGY”, in 1973, had great influence on me. I tried to discover the algorithm that generated this work. It was not so difficult to do and in a short time I was able to draw 12 such structures. In time, with interruptions, I have returned to this kind of works. In my personal exhibition “CYBERNETIC DESIGN” that took place at “M4-1-13-etopa” gallery of Pitesti, in March 1981, I have presented 8 such structures. To my joy, they had an impact on art lovers.

  5. Touchable Online Braille Generator

    Directory of Open Access Journals (Sweden)

    Wooseob Jeong

    2008-03-01

    Full Text Available A prototype of a touchable online Braille generator has been developed for the visually impaired or blind using force feedback technology, which has been used in video games for years. Without expensive devices, this prototype allows blind people to access information on the Web by touching output Braille displays with a force feedback mouse. The data collected from user studies conducted with blind participants has provided valuable information about the optimal conditions for the use of the prototype. The end product of this research will enable visually impaired people to enjoy information on the Web more freely.

  6. Second harmonic generation microscopy

    DEFF Research Database (Denmark)

    Brüggemann, Dagmar Adeline; Brewer, Jonathan R.; Risbo, Jens

    2010-01-01

    Myofibers and collagen show non-linear optical properties enabling imaging using second harmonic generation (SHG) microscopy. The technique is evaluated for use as a tool for real-time studies of thermally induced changes in thin samples of unfixed and unstained pork. The forward and the backward...... scattered SHG light reveal complementary features of the structures of myofibers and collagen fibers. Upon heating the myofibers show no structural changes before reaching a temperature of 53 °C. At this temperature the SHG signal becomes extinct. The extinction of the SHG at 53 °C coincides with a low......-temperature endotherm peak observable in the differential scanning calorimetry (DSC) thermograms. DSC analysis of epimysium, the connective tissue layer that enfold skeletal muscles, produces one large endotherm starting at 57 °C and peaking at 59.5 °C. SHG microscopy of collagen fibers reveals a variability of thermal...

  7. Generator for ionising radiation

    International Nuclear Information System (INIS)

    Romanovsky, V.F.; Panasjuk, V.S.; Stepanov, B.M.; Ovcharov, A.M.; Akimov, J.A.

    1979-01-01

    The generator for ionising radiation wherein a transmitter for ionising radiation contains a resonance transformer wherein the field coil is composed of a low voltage outside portion and a transformer coil, electrically connected with an electrically conducting housing of the resonance transformer, and an acclerating tube wherein the high voltage electrode is coupled with the high voltage end of the transformer coil of the resonance transformer and fixed to one of the ends of the tubular insulator of the accelerator tube, wherein the low voltage electrode is electrically connected with the housing of the resonance transformer and a source of charged particles is introduced into the evacuated inner space of the acceleration tube and electrically connected with one of the electrodes thereof, is described. (G.C.)

  8. Mood Dependent Music Generator

    DEFF Research Database (Denmark)

    Scirea, Marco

    2013-01-01

    Music is one of the most expressive media to show and manipulate emotions, but there have been few studies on how to generate music connected to emotions. Such studies have always been shunned upon by musicians affirming that a machine cannot create expressive music, as it's the composer......'s and player's experiences and emotions that get poured into the piece. At the same time another problem is that music is highly complicated (and subjective) and finding out which elements transmit certain emotions is not an easy task. This demo wants to show how the manipulation of a set of features can...... actually change the mood the music transmits, hopefully awakening an interest in this area of research....

  9. Light Beam Generation

    DEFF Research Database (Denmark)

    2007-01-01

    The invention relates to a method and a system for synthesizing a set of controllable light beams by provision of a system for synthesizing a set of light beams, comprising a spatially modulated light source for generation of electromagnetic radiation with a set of replicas of a predetermined......(x-xs, y-ys), a Fourier transforming lens for Fourier transforming the electromagnetic radiation, a first spatial light modulator for phase shifting the Fourier transformed electromagnetic radiation with the phase -F(u, v) of S*, S* is the complex conjugate of the Fourier transformed symbol s, a Fourier...... transforming lens for Inverse Fourier transforming the spatially modulated radiation, whereby a set of light beams are formed propagating through the inverse Fourier plane (x', y') at desired positions (x's, y's), and a controller for controlling the position of a replica of the symbol, s, for movement...

  10. Generation in Europe

    International Nuclear Information System (INIS)

    Aveline, Michelle; Mason, Laura.

    1994-01-01

    Information for this document has been collected from a range of primary sources which include annual reports, strategy statements and company information leaflets. The first part consists of profiles for each of the countries of Western Europe and selected countries in Eastern Europe. In each case an overview of the organization of the electricity industry is given and information where available on interconnections, new projects, ongoing work at existing plant, environmental issues and details of plant and closures. In the second part, details are given of some of the largest power generating companies in Europe listed in alphabetical order. The most up-to-date figures available have been used in all cases and the companies have been invited to comment on the text. (UK)

  11. Generation of electrical power

    International Nuclear Information System (INIS)

    Hursen, T.F.; Kolenik, S.A.; Purdy, D.L.

    1976-01-01

    A heat-to-electricity converter is disclosed which includes a radioactive heat source and a thermoelectric element of relatively short overall length capable of delivering a low voltage of the order of a few tenths of a volt. Such a thermoelectric element operates at a higher efficiency than longer higher-voltage elements; for example, elements producing 6 volts. In the generation of required power, the thermoelectric element drives a solid-state converter which is controlled by input current rather than input voltage and operates efficiently for a high signal-plus-noise to signal ratio of current. The solid-state converter has the voltage gain necessary to deliver the required voltage at the low input of the thermoelectric element

  12. Generator for radiological diagnostics

    Energy Technology Data Exchange (ETDEWEB)

    Seissl, J; Broenner, K; Krause, H

    1978-10-02

    A generator is described for X-ray diagnostics, with a high-voltage transformer with a primary coil connected or with the grid and a secondary coil feeding the X-ray tube and with a rectifier bridge situated in the primary circuit of the high-voltage transformer. The direct current branch of the rectifier bridge contains a filter capacitor and a thyristor which is opened and closed by means of a pulse duty factor determining the capacitor voltage and thus the voltage of the X-ray tube. An LC-tuned circuit is connected to the thyristor whose capacity is discharged to the conductive thyristor so that the thyristor is quenched via a free-wheel diode arranged in parallel to the thyristor. In this way, a high switching frequency of the thyristor and, consequently, a low ripple of the X-ray tube voltage is obtained.

  13. Peak power ratio generator

    Science.gov (United States)

    Moyer, R.D.

    A peak power ratio generator is described for measuring, in combination with a conventional power meter, the peak power level of extremely narrow pulses in the gigahertz radio frequency bands. The present invention in a preferred embodiment utilizes a tunnel diode and a back diode combination in a detector circuit as the only high speed elements. The high speed tunnel diode provides a bistable signal and serves as a memory device of the input pulses for the remaining, slower components. A hybrid digital and analog loop maintains the peak power level of a reference channel at a known amount. Thus, by measuring the average power levels of the reference signal and the source signal, the peak power level of the source signal can be determined.

  14. X-ray generator

    Energy Technology Data Exchange (ETDEWEB)

    Zucarias, A; Shepherd, J W

    1982-09-08

    An X-ray tube has a tubular envelope with a cathode for directing an electron beam onto a focal spot area of a spaced anode target to generate X-rays. The target is mounted for axial rotation on one end of a rotor disposed in an end portion of the envelope and encircled by a stator of an alternating current induction motor. An annular shield of high permeability magnetic material extends transversely between the electron beam and the stator of the induction motor for shunting stray or fringe electromagnetic fields established by the stator away from the electron beam to avoid consequent lateral deflections of the electron and corresponding lateral movements of the focal spot area.

  15. Superconducting wind turbine generators

    DEFF Research Database (Denmark)

    Abrahamsen, Asger Bech; Mijatovic, Nenad; Seiler, Eugen

    2010-01-01

    , the main challenge of the superconducting direct drive technology is to prove that the reliability is superior to the alternative drive trains based on gearboxes or permanent magnets. A strategy of successive testing of superconducting direct drive trains in real wind turbines of 10 kW, 100 kW, 1 MW and 10......We have examined the potential of 10 MW superconducting direct drive generators to enter the European offshore wind power market and estimated that the production of about 1200 superconducting turbines until 2030 would correspond to 10% of the EU offshore market. The expected properties of future...... offshore turbines of 8 and 10 MW have been determined from an up-scaling of an existing 5 MW turbine and the necessary properties of the superconducting drive train are discussed. We have found that the absence of the gear box is the main benefit and the reduced weight and size is secondary. However...

  16. Steam generator tube performance

    International Nuclear Information System (INIS)

    Tatone, O.S.; Pathania, R.S.

    1982-04-01

    The performance of steam generator tubes in water-cooled nuclear power reactors has been reviewed for 1980. Tube defects occurred at 38% of the 97 reactors surveyed. This is a marginal improvement over 1979 when defects occurred at 41% of the reactors. The number of failed tubes was also lower, 0.14% of the tubes in service in 1980 compared with 0.20% of those in service in 1979. Analysis of the causes of these failures indicates that stress corrosion cracking was the leading failure mechanism. Reactors that used all-volatile treatment of secondary water, with or without full-flow condensate demineralization since start-up showed the lowest incidence of corrosion-related defects

  17. Reloadable radioactive generator system

    International Nuclear Information System (INIS)

    Colombetti, L.G.

    1977-01-01

    A generator system that can be reloaded with an elutable radioactive material, such as 99 molybdenum, a multiple number of times is described. The system basically comprises a column filled with alumina, a loading vial containing a predetermined amount of the elutable radioactive material, and a rinsing vial containing a sterile solution. The two vials are connected by a conduit so that when communication is achieved between the column and loading vial and an evacuated vial is placed in communication with the bottom of the column, the predetermined amount of the radioactive material in the loading vial will be transferred to the column. The procedure can be repeated as the elutable material in the column is dissipated

  18. Steam generator tube performance

    International Nuclear Information System (INIS)

    Tatone, O.S.; Pathania, R.S.

    1983-08-01

    A review of the performance of steam generator tubes in 110 water-cooled nuclear power reactors showed that tubes were plugged at 46 (42 percent) of the reactors. The number of tubes removed from service increased from 1900 (0.14 percent) in 1980 to 4692 (0.30 percent) in 1981. The leading causes of tube failures were stress corrosion cracking from the primary side, stress corrosion cracking (or intergranular attack) from the secondary side and pitting corrosion. The lowest incidence of corrosion-induced defects from the secondary side occurred in reactors that used all-volatile treatment since start-up. At one reactor a large number of degraded tubes were repaired by sleeving which is expected to become an important method of tube repair in the future

  19. Turbulence generation by waves

    Energy Technology Data Exchange (ETDEWEB)

    Kaftori, D.; Nan, X.S.; Banerjee, S. [Univ. of California, Santa Barbara, CA (United States)

    1995-12-31

    The interaction between two-dimensional mechanically generated waves, and a turbulent stream was investigated experimentally in a horizontal channel, using a 3-D LDA synchronized with a surface position measuring device and a micro-bubble tracers flow visualization with high speed video. Results show that although the wave induced orbital motion reached all the way to the wall, the characteristics of the turbulence wall structures and the turbulence intensity close to the wall were not altered. Nor was the streaky nature of the wall layer. On the other hand, the mean velocity profile became more uniform and the mean friction velocity was increased. Close to the free surface, the turbulence intensity was substantially increased as well. Even in predominantly laminar flows, the introduction of 2-D waves causes three dimensional turbulence. The turbulence enhancement is found to be proportional to the wave strength.

  20. Photovoltaic Solar Energy Generation

    CERN Document Server

    Lotsch, H.K.V; U.Hoffmann, Volker; Rhodes, William T; Asakura, Toshimitsu; Brenner, Karl-Heinz; Hänsch, Theodor W; Kamiya, Takeshi; Krausz, Ferenc; Monemar, Bo; Venghaus, Herbert; Weber, Horst; Weinfurter, Harald

    2005-01-01

    This comprehensive description and discussion of photovoltaics (PV) is presented at a level that makes it accessible to the interested academic. Starting with an historical overview, the text outlines the relevance of photovoltaics today and in the future. Then follows an introduction to the physical background of solar cells and the most important materials and technologies, with particular emphasis placed on future developments and prospects. The book goes beyond technology by also describing the path from the cell to the module to the system, proceeding to important applications, such as grid-connected and stand-alone systems. The composition and development of the markets and the role of PV in future energy systems are also considered. Finally, the discussion turns to the future structure of energy supplies, expected to comprise more distributed generation, and addresses synergies and competition from other carbon-free energy sources.