Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict
Next generation x-ray all-sky monitor
International Nuclear Information System (INIS)
Priedhorsky, W. C.; Peele, A. G.; Nugent, K. A.
1997-01-01
We set forth a conceptual design for x-ray all-sky monitor based on lobster-eye wide-field telescopes. This instrument, suitable for a small satellite, would monitor the flux of objects as faint as 2x10 -15 W/m 2 (0.5-2.4 keV) on a daily basis with a signal-to-noise of 5. Sources would be located to 1-2 arc-minutes. Detailed simulations show that crosstalk from the cruciform lobster images would not significantly compromise performance. At this sensitivity limit, we could monitor not just x-ray binaries but fainter classes of x-ray sources. Hundreds of active galactic nuclei, coronal sources, and cataclysmic variables could be tracked on a daily basis. Large numbers of fast transients should be visible, including gamma-ray bursts and the soft x-ray breakout of nearby type II supernovae. Long-term x-ray measurements will advance our understanding of the geometries and perhaps masses of AGN, and coronal energy sources in stars
Digital all-sky polarization imaging of partly cloudy skies.
Pust, Nathan J; Shaw, Joseph A
2008-12-01
Clouds reduce the degree of linear polarization (DOLP) of skylight relative to that of a clear sky. Even thin subvisual clouds in the "twilight zone" between clouds and aerosols produce a drop in skylight DOLP long before clouds become visible in the sky. In contrast, the angle of polarization (AOP) of light scattered by a cloud in a partly cloudy sky remains the same as in the clear sky for most cases. In unique instances, though, select clouds display AOP signatures that are oriented 90 degrees from the clear-sky AOP. For these clouds, scattered light oriented parallel to the scattering plane dominates the perpendicularly polarized Rayleigh-scattered light between the instrument and the cloud. For liquid clouds, this effect may assist cloud particle size identification because it occurs only over a relatively limited range of particle radii that will scatter parallel polarized light. Images are shown from a digital all-sky-polarization imager to illustrate these effects. Images are also shown that provide validation of previously published theories for weak (approximately 2%) polarization parallel to the scattering plane for a 22 degrees halo.
De Marchi, Guido; ESASky Team
2018-06-01
ESASky is a discovery portal giving to all astronomers, professional and amateur alike, an easy way to access high-quality scientific data from their computer, tablet, or mobile device. It includes over half a million images, 300,000 spectra, and more than a billion catalogue sources. From gamma rays to radio wavelengths, it allows users to explore the cosmos with data from a dozen space missions from the astronomical archives of ESA, NASA, and JAXA and does not require prior knowledge of any particular mission. ESASky features an all-sky exploration interface, letting users easily zoom in for stars as single targets or as part of a whole galaxy, visualise them and retrieve the relevant data taken in an area of the sky with just a few clicks. Users can easily compare observations of the same source obtained by different space missions at different times and wavelengths. They can also use ESASky to plan future observations with the James Webb Space Telescope, comparing the relevant portion of the sky as observed by Hubble and other missions. We will illustrate the many options to visualise and access astronomical data: interactive footprints for each instrument, tree-maps, filters, and solar-system object trajectories can all be combined and displayed. The most recent version of ESASky, released in February, also includes access to scientific publications, allowing users to visualise on the sky all astronomical objects with associated scientific publications and to link directly back to the papers in the NASA Astrophysics Data System.
An All-Sky Portable (ASP) Optical Catalogue
Flesch, Eric Wim
2017-06-01
This optical catalogue combines the all-sky USNO-B1.0/A1.0 and most-sky APM catalogues, plus overlays of SDSS optical data, into a single all-sky map presented in a sparse binary format that is easily downloaded at 9 Gb zipped. Total count is 1 163 237 190 sources and each has J2000 astrometry, red and blue magnitudes with PSFs and variability indicator, and flags for proper motion, epoch, and source survey and catalogue for each of the photometry and astrometry. The catalogue is available on http://quasars.org/asp.html, and additional data for this paper is available at http://dx.doi.org/10.4225/50/5807fbc12595f.
ROTSE All-Sky Surveys for Variable Stars. I. Test Fields
International Nuclear Information System (INIS)
Akerlof, C.; Amrose, S.; Balsano, R.; Bloch, J.; Casperson, D.; Fletcher, S.; Gisler, G.; Hills, J.; Kehoe, R.; Lee, B.
2000-01-01
The Robotic Optical Transient Search Experiment I (ROTSE-I) experiment has generated CCD photometry for the entire northern sky in two epochs nightly since 1998 March. These sky patrol data are a powerful resource for studies of astrophysical transients. As a demonstration project, we present first results of a search for periodic variable stars derived from ROTSE-I observations. Variable identification, period determination, and type classification are conducted via automatic algorithms. In a set of nine ROTSE-I sky patrol fields covering roughly 2000 deg2, we identify 1781 periodic variable stars with mean magnitudes between m v = 10.0 and m v = 15.5. About 90% of these objects are newly identified as variable. Examples of many familiar types are presented. All classifications for this study have been manually confirmed. The selection criteria for this analysis have been conservatively defined and are known to be biased against some variable classes. This preliminary study includes only 5.6% of the total ROTSE-I sky coverage, suggesting that the full ROTSE-I variable catalog will include more than 32,000 periodic variable stars. (c) (c) 2000. The American Astronomical Society
Reflective all-sky thermal infrared cloud imager.
Redman, Brian J; Shaw, Joseph A; Nugent, Paul W; Clark, R Trevor; Piazzolla, Sabino
2018-04-30
A reflective all-sky imaging system has been built using a long-wave infrared microbolometer camera and a reflective metal sphere. This compact system was developed for measuring spatial and temporal patterns of clouds and their optical depth in support of applications including Earth-space optical communications. The camera is mounted to the side of the reflective sphere to leave the zenith sky unobstructed. The resulting geometric distortion is removed through an angular map derived from a combination of checkerboard-target imaging, geometric ray tracing, and sun-location-based alignment. A tape of high-emissivity material on the side of the reflector acts as a reference that is used to estimate and remove thermal emission from the metal sphere. Once a bias that is under continuing study was removed, sky radiance measurements from the all-sky imager in the 8-14 μm wavelength range agreed to within 0.91 W/(m 2 sr) of measurements from a previously calibrated, lens-based infrared cloud imager over its 110° field of view.
Gaia , an all sky astrometric and photometric survey
International Nuclear Information System (INIS)
Carrasco, J.M.
2017-01-01
Gaia space mission includes a low resolution spectroscopic instrument to classify and parametrize the observed sources. Gaia is a full-sky unbiased survey down to about 20th magnitude. The scanning law yields a rather uniform coverage of the sky over the full mission. The data reduction is a global one over the full mission. Both sky coverage and data reduction strategy ensure an unprecedented all-sky homogeneous spectrophotometric survey. Certainly, that survey is of interest for future on-ground and space projects (LSST, PLATO, EUCLID, ...). This work addresses the exploitation of the Gaia spectrophotometry as standard photometry reference through the discussion of the sky coverage, the spectrophotometric precision and the expected uncertainties of the synthetic photometry derived from the low resolution Gaia spectra and photometry.
International Nuclear Information System (INIS)
Bilicki, Maciej; Jarrett, Thomas H.; Cluver, Michelle E.; Steward, Louise; Peacock, John A.
2014-01-01
Key cosmological applications require the three-dimensional (3D) galaxy distribution on the entire celestial sphere. These include measuring the gravitational pull on the Local Group, estimating the large-scale bulk flow, and testing the Copernican principle. However, the largest all-sky redshift surveys—the 2MASS Redshift Survey and IRAS Point Source Catalog Redshift Survey—have median redshifts of only z = 0.03 and sample the very local universe. All-sky galaxy catalogs exist that reach much deeper—SuperCOSMOS in the optical, the Two Micron All Sky Survey (2MASS) in the near-IR, and WISE in the mid-IR—but these lack complete redshift information. At present, the only rapid way toward larger 3D catalogs covering the whole sky is through photometric redshift techniques. In this paper we present the 2MASS Photometric Redshift catalog (2MPZ) containing one million galaxies, constructed by cross-matching Two Micron All Sky Survey Extended Source Catalog (2MASS XSC), WISE, and SuperCOSMOS all-sky samples and employing the artificial neural network approach (the ANNz algorithm), trained on such redshift surveys as the Sloan Digital Sky Survey, 6dFGS, and 2dFGRS. The derived photometric redshifts have errors nearly independent of distance, with an all-sky accuracy of σ z = 0.015 and a very small percentage of outliers. In this way, we obtain redshift estimates with a typical precision of 12% for all the 2MASS XSC galaxies that lack spectroscopy. In addition, we have made an early effort toward probing the entire 3D sky beyond 2MASS, by pairing up WISE with SuperCOSMOS and training the ANNz on GAMA redshift data currently reaching to z med ∼ 0.2. This has yielded photo-z accuracies comparable to those in the 2MPZ. These all-sky photo-z catalogs, with a median z ∼ 0.1 for the 2MPZ, and significantly deeper for future WISE-based samples, will be the largest and most complete of their kind for the foreseeable future
Weather and atmosphere observation with the ATOM all-sky camera
Directory of Open Access Journals (Sweden)
Jankowsky Felix
2015-01-01
Full Text Available The Automatic Telescope for Optical Monitoring (ATOM for H.E.S.S. is an 75 cm optical telescope which operates fully automated. As there is no observer present during observation, an auxiliary all-sky camera serves as weather monitoring system. This device takes an all-sky image of the whole sky every three minutes. The gathered data then undergoes live-analysis by performing astrometric comparison with a theoretical night sky model, interpreting the absence of stars as cloud coverage. The sky monitor also serves as tool for a meteorological analysis of the observation site of the the upcoming Cherenkov Telescope Array. This overview covers design and benefits of the all-sky camera and additionally gives an introduction into current efforts to integrate the device into the atmosphere analysis programme of H.E.S.S.
Uncertainties of parameterized surface downward clear-sky shortwave and all-sky longwave radiation.
Gubler, S.; Gruber, S.; Purves, R. S.
2012-06-01
As many environmental models rely on simulating the energy balance at the Earth's surface based on parameterized radiative fluxes, knowledge of the inherent model uncertainties is important. In this study we evaluate one parameterization of clear-sky direct, diffuse and global shortwave downward radiation (SDR) and diverse parameterizations of clear-sky and all-sky longwave downward radiation (LDR). In a first step, SDR is estimated based on measured input variables and estimated atmospheric parameters for hourly time steps during the years 1996 to 2008. Model behaviour is validated using the high quality measurements of six Alpine Surface Radiation Budget (ASRB) stations in Switzerland covering different elevations, and measurements of the Swiss Alpine Climate Radiation Monitoring network (SACRaM) in Payerne. In a next step, twelve clear-sky LDR parameterizations are calibrated using the ASRB measurements. One of the best performing parameterizations is elected to estimate all-sky LDR, where cloud transmissivity is estimated using measured and modeled global SDR during daytime. In a last step, the performance of several interpolation methods is evaluated to determine the cloud transmissivity in the night. We show that clear-sky direct, diffuse and global SDR is adequately represented by the model when using measurements of the atmospheric parameters precipitable water and aerosol content at Payerne. If the atmospheric parameters are estimated and used as a fix value, the relative mean bias deviance (MBD) and the relative root mean squared deviance (RMSD) of the clear-sky global SDR scatter between between -2 and 5%, and 7 and 13% within the six locations. The small errors in clear-sky global SDR can be attributed to compensating effects of modeled direct and diffuse SDR since an overestimation of aerosol content in the atmosphere results in underestimating the direct, but overestimating the diffuse SDR. Calibration of LDR parameterizations to local conditions
Uncertainties of parameterized surface downward clear-sky shortwave and all-sky longwave radiation.
Directory of Open Access Journals (Sweden)
S. Gubler
2012-06-01
Full Text Available As many environmental models rely on simulating the energy balance at the Earth's surface based on parameterized radiative fluxes, knowledge of the inherent model uncertainties is important. In this study we evaluate one parameterization of clear-sky direct, diffuse and global shortwave downward radiation (SDR and diverse parameterizations of clear-sky and all-sky longwave downward radiation (LDR. In a first step, SDR is estimated based on measured input variables and estimated atmospheric parameters for hourly time steps during the years 1996 to 2008. Model behaviour is validated using the high quality measurements of six Alpine Surface Radiation Budget (ASRB stations in Switzerland covering different elevations, and measurements of the Swiss Alpine Climate Radiation Monitoring network (SACRaM in Payerne. In a next step, twelve clear-sky LDR parameterizations are calibrated using the ASRB measurements. One of the best performing parameterizations is elected to estimate all-sky LDR, where cloud transmissivity is estimated using measured and modeled global SDR during daytime. In a last step, the performance of several interpolation methods is evaluated to determine the cloud transmissivity in the night.
We show that clear-sky direct, diffuse and global SDR is adequately represented by the model when using measurements of the atmospheric parameters precipitable water and aerosol content at Payerne. If the atmospheric parameters are estimated and used as a fix value, the relative mean bias deviance (MBD and the relative root mean squared deviance (RMSD of the clear-sky global SDR scatter between between −2 and 5%, and 7 and 13% within the six locations. The small errors in clear-sky global SDR can be attributed to compensating effects of modeled direct and diffuse SDR since an overestimation of aerosol content in the atmosphere results in underestimating the direct, but overestimating the diffuse SDR. Calibration of LDR parameterizations
The SPHEREx All-Sky Spectral Survey
Bock, James; SPHEREx Science Team
2018-01-01
SPHEREx, a mission in NASA's Medium Explorer (MIDEX) program that was selected for Phase A in August 2017, is an all-sky survey satellite designed to address all three science goals in NASA's astrophysics division, with a single instrument, a wide-field spectral imager. SPHEREx will probe the physics of inflation by measuring non-Gaussianity by studying large-scale structure, surveying a large cosmological volume at low redshifts, complementing high-z surveys optimized to constrain dark energy. The origin of water and biogenic molecules will be investigated in all phases of planetary system formation - from molecular clouds to young stellar systems with protoplanetary disks - by measuring ice absorption spectra. We will chart the origin and history of galaxy formation through a deep survey mapping large-scale spatial power in two deep fields located near the ecliptic poles. Following in the tradition of all-sky missions such as IRAS, COBE and WISE, SPHEREx will be the first all-sky near-infrared spectral survey. SPHEREx will create spectra (0.75 – 4.2 um at R = 41; and 4.2 – 5 um at R = 135) with high sensitivity making background-limited observations using a passively-cooled telescope with a wide field-of-view for large mapping speed. During its two-year mission, SPHEREx will produce four complete all-sky maps that will serve as a rich archive for the astronomy community. With over a billion detected galaxies, hundreds of millions of high-quality stellar and galactic spectra, and over a million ice absorption spectra, the archive will enable diverse scientific investigations including studies of young stellar systems, brown dwarfs, high-redshift quasars, galaxy clusters, the interstellar medium, asteroids and comets. All aspects of the instrument and spacecraft have high heritage. SPHEREx requires no new technologies and carries large technical and resource margins on every aspect of the design. SPHEREx is a partnership between Caltech and JPL, following the
Caldwell, Andy
2005-01-01
In 2001, the "All Sky Camera Network" came to life as an outreach program to connect the Denver Museum of Nature and Science (DMNS) exhibit "Space Odyssey" with Colorado schools. The network is comprised of cameras placed strategically at schools throughout Colorado to capture fireballs--rare events that produce meteorites.…
STARS4ALL Night Sky Brightness Photometer
Directory of Open Access Journals (Sweden)
Jaime Zamorano
2017-06-01
Full Text Available We present the main features of TESS-W, the first version of a series of inexpensive but reliable photometers that will be used to measure night sky brightness. The bandpass is extended to the red with respect of that of the Sky Quality Meter (SQM. TESS-W connects to a router via WIFI and it sends automatically the brightness values to a data repository using Internet of Things protocols. The device includes an infrared sensor to estimate the cloud coverage. It is designed for fixed stations to monitor the evolution of the sky brightness. The photometer could also be used in local mode connected to a computer or tablet to gather data from a moving vehicle. The photometer is being developed within STARS4ALL project, a collective awareness platform for promoting dark skies in Europe, funded by the EU. We intend to extend the existing professional networks to a citizen-based network of photometers.
All-sky brightness monitoring of light pollution with astronomical methods.
Rabaza, O; Galadí-Enríquez, D; Estrella, A Espín; Dols, F Aznar
2010-06-01
This paper describes a mobile prototype and a protocol to measure light pollution based on astronomical methods. The prototype takes three all-sky images using BVR filters of the Johnson-Cousins astronomical photometric system. The stars are then identified in the images of the Hipparcos and General Catalogue of Photometric Data II astronomical catalogues, and are used as calibration sources. This method permits the measurement of night-sky brightness and facilitates an estimate of which fraction is due to the light up-scattered in the atmosphere by a wide variety of man-made sources. This is achieved by our software, which compares the sky background flux to that of many stars of known brightness. The reduced weight and dimensions of the prototype allow the user to make measurements from virtually any location. This prototype is capable of measuring the sky distribution of light pollution, and also provides an accurate estimate of the background flux at each photometric band. (c) 2010 Elsevier Ltd. All rights reserved.
VHE and UHE gamma ray astronomy: transients and sources
International Nuclear Information System (INIS)
Fegan, D.J.
1987-01-01
The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy
Using All-Sky Imaging to Improve Telescope Scheduling (Abstract)
Cole, G. M.
2017-12-01
(Abstract only) Automated scheduling makes it possible for a small telescope to observe a large number of targets in a single night. But when used in areas which have less-than-perfect sky conditions such automation can lead to large numbers of observations of clouds and haze. This paper describes the development of a "sky-aware" telescope automation system that integrates the data flow from an SBIG AllSky340c camera with an enhanced dispatch scheduler to make optimum use of the available observing conditions for two highly instrumented backyard telescopes. Using the minute-by-minute time series image stream and a self-maintained reference database, the software maintains a file of sky brightness, transparency, stability, and forecasted visibility at several hundred grid positions. The scheduling software uses this information in real time to exclude targets obscured by clouds and select the best observing task, taking into account the requirements and limits of each instrument.
Second ROSAT all-sky survey (2RXS) source catalogue
Boller, Th.; Freyberg, M. J.; Trümper, J.; Haberl, F.; Voges, W.; Nandra, K.
2016-04-01
Aims: We present the second ROSAT all-sky survey source catalogue, hereafter referred to as the 2RXS catalogue. This is the second publicly released ROSAT catalogue of point-like sources obtained from the ROSAT all-sky survey (RASS) observations performed with the position-sensitive proportional counter (PSPC) between June 1990 and August 1991, and is an extended and revised version of the bright and faint source catalogues. Methods: We used the latest version of the RASS processing to produce overlapping X-ray images of 6.4° × 6.4° sky regions. To create a source catalogue, a likelihood-based detection algorithm was applied to these, which accounts for the variable point-spread function (PSF) across the PSPC field of view. Improvements in the background determination compared to 1RXS were also implemented. X-ray control images showing the source and background extraction regions were generated, which were visually inspected. Simulations were performed to assess the spurious source content of the 2RXS catalogue. X-ray spectra and light curves were extracted for the 2RXS sources, with spectral and variability parameters derived from these products. Results: We obtained about 135 000 X-ray detections in the 0.1-2.4 keV energy band down to a likelihood threshold of 6.5, as adopted in the 1RXS faint source catalogue. Our simulations show that the expected spurious content of the catalogue is a strong function of detection likelihood, and the full catalogue is expected to contain about 30% spurious detections. A more conservative likelihood threshold of 9, on the other hand, yields about 71 000 detections with a 5% spurious fraction. We recommend thresholds appropriate to the scientific application. X-ray images and overlaid X-ray contour lines provide an additional user product to evaluate the detections visually, and we performed our own visual inspections to flag uncertain detections. Intra-day variability in the X-ray light curves was quantified based on the
Gaia, an all-sky survey for standard photometry
Carrasco, J. M.; Weiler, M.; Jordi, C.; Fabricius, C.
2017-03-01
Gaia ESA's space mission (launched in 2013) includes two low resolution spectroscopic instruments (one in the blue, BP, and another in the red, RP, wavelength domains) to classify and derive the astrophysical parameters of the observed sources. As it is well known, Gaia is a full-sky unbiased survey down to about 20th magnitude. The scanning law yields a rather uniform coverage of the sky over the full extent (a minimum of 5 years) of the mission. Gaia data reduction is a global one over the full mission. Both sky coverage and data reduction strategy ensure an unprecedented all-sky homogeneous spectrophotometric survey. Certainly, that survey is of interest for current and future on-ground and space projects, like LSST, PLATO, EUCLID and J-PAS/J-PLUS among others. These projects will benefit from the large amount (more than one billion) and wide variety of objects observed by Gaia with good quality spectrophotometry. Synthetic photometry derived from Gaia spectrophotometry for any passband can be used to expand the set of standard sources for these new instruments to come. In the current Gaia data release scenario, BP/RP spectrophotometric data will be available in the third release (in 2018, TBC). Current preliminary results allow us to estimate the precision of synthetic photometry derived from the Gaia data. This already allows the preparation of the on-going and future surveys and space missions. We discuss here the exploitation of the Gaia spectrophotometry as standard reference due to its full-sky coverage and its expected photometric uncertainties derived from the low resolution Gaia spectra.
Planck 2013 results. XI. All-sky model of thermal dust emission
DEFF Research Database (Denmark)
Abergel, A.; Ade, P. A. R.; Aghanim, N.
2014-01-01
This paper presents an all-sky model of dust emission from the Planck 353, 545, and 857 GHz, and IRAS 100 mu m data. Using a modified blackbody fit to the data we present all-sky maps of the dust optical depth, temperature, and spectral index over the 353-3000 GHz range. This model is a good repr...
The SPHEREx All-Sky Spectroscopic Survey
Unwin, Stephen C.; SPHEREx Science Team, SPHEREx Project Team
2016-06-01
SPHEREx is a mission to conduct an optical-near-IR survey of the entire sky with a spectrum at every pixel location. It was selected by NASA for a Phase A study in its Small Explorer Program; if selected, development would begin in 2016, and the observatory would start a 2-year prime mission in 2020. An all-sky spectroscopic survey can be used to tackle a wide range of science questions. The SPHEREx science team is focusing on three: (1) Probing the physics of inflation through measuring non-Gaussianity from the study of large-scale structure; (2) Studying the origin of water and biogenic molecules in a wide range of physical and chemical environments via ice absorption spectra; (3) Charting the history of star formation in the universe through intensity mapping of the large-scale spatial power. The instrument is a small wide-field telescope operating in the range of 0.75 - 4.8 µm at a spectral resolution of 41.5 in the optical and 150 at the long-wavelength end. It observes in a sun-sync low-earth orbit, covering the sky like WISE and COBE. SPHEREx is a simple instrument that requires no new technology. The Phase A design has substantial technical and resource margins and can be built with low risk. It is a partnership between Caltech and JPL, with Ball Aerospace and the Korea Astronomy and Space Science Institute as major partners. This research was carried out at the Jet Propulsion Laboratory, California Institute of Technology, under a contract with the National Aeronautics and Space Administration.
2MASS - The 2 Micron All Sky Survey
Kleinmann, S. G.
1992-01-01
This paper describes a new sky survey to be carried out in three wavebands, J(1.25 m), H(1.65 m), and K(2.2 m). The limiting sensitivity of the survey, 10 sigma detection of point sources with K not greater than 14 mag, coupled with its all-sky coverage, were selected primarily to support studies of the large-scale structure of the Milky Way and the Local Universe. The survey requires construction of a pair of observing facilities, one each for the Northern and Southern Hemispheres. Operations are scheduled to begin in 1995. The data will begin becoming publicly available soon thereafter.
The Sondrestrom Research Facility All-sky Imagers
Kendall, E. A.; Grill, M.; Gudmundsson, E.; Stromme, A.
2010-12-01
The Sondrestrom Upper Atmospheric Research Facility is located near Kangerlussuaq, Greenland, just north of the Arctic Circle and 100 km inland from the west coast of Greenland. The facility is operated by SRI International in Menlo Park, California, under the auspices of the U.S. National Science Foundation. Operating in Greenland since 1983, the Sondrestrom facility is host to more than 20 instruments, the majority of which provide unique and complementary information about the arctic upper atmosphere. Together these instruments advance our knowledge of upper atmospheric physics and determine how the tenuous neutral gas interacts with the charged space plasma environment. The suite of instrumentation supports many disciplines of research - from plate tectonics to auroral physics and space weather. The Sondrestrom facility has recently acquired two new all-sky imagers. In this paper, we present images from both new imagers, placing them in context with other instruments at the site and detailing to the community how to gain access to this new data set. The first new camera replaces the intensified auroral system which has been on site for nearly three decades. This new all-sky imager (ASI), designed and assembled by Keo Scientific Ltd., employs a medium format 180° fisheye lens coupled to a set of five 3-inch narrowband interference filters. The current filter suite allows operation at the following wavelengths: 750 nm, 557.7 nm, 777.4 nm, 630.0 nm, and 732/3 nm. Monochromatic images from the ASI are acquired at a specific filter and integration time as determined by a unique configuration file. Integrations as short as 0.5 sec can be commanded for exceptionally bright features. Preview images are posted to the internet in near real-time, with final images posted weeks later. While images are continuously collected in a "patrol mode," users can request special collection sequences for targeted experiments. The second new imager installed at the Sondrestrom
Early warning for VHE gamma-ray flares with the ARGO-YBJ detector
Energy Technology Data Exchange (ETDEWEB)
Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others
2011-12-11
Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.
Planck 2013 results. XI. All-sky model of thermal dust emission
Abergel, A; Aghanim, N; Alina, D; Alves, M I R; Armitage-Caplan, C; Arnaud, M; Ashdown, M; Atrio-Barandela, F; Aumont, J; Baccigalupi, C; Banday, A J; Barreiro, R B; Bartlett, J G; Battaner, E; Benabed, K; Benoît, A; Benoit-Lévy, A; Bernard, J -P; Bersanelli, M; Bielewicz, P; Bobin, J; Bock, J J; Bonaldi, A; Bond, J R; Borrill, J; Bouchet, F R; Boulanger, F; Bridges, M; Bucher, M; Burigana, C; Butler, R C; Cardoso, J -F; Catalano, A; Chamballu, A; Chary, R -R; Chiang, H C; Chiang, L -Y; Christensen, P R; Church, S; Clemens, M; Clements, D L; Colombi, S; Colombo, L P L; Combet, C; Couchot, F; Coulais, A; Crill, B P; Curto, A; Cuttaia, F; Danese, L; Davies, R D; Davis, R J; de Bernardis, P; de Rosa, A; de Zotti, G; Delabrouille, J; Delouis, J -M; Désert, F -X; Dickinson, C; Diego, J M; Dole, H; Donzelli, S; Doré, O; Douspis, M; Dupac, X; Efstathiou, G; Enßlin, T A; Eriksen, H K; Falgarone, E; Finelli, F; Forni, O; Frailis, M; Fraisse, A A; Franceschi, E; Galeotta, S; Ganga, K; Ghosh, T; Giard, M; Giardino, G; Giraud-Héraud, Y; González-Nuevo, J; Górski, K M; Gratton, S; Gregorio, A; Grenier, I A; Gruppuso, A; Guillet, V; Hansen, F K; Hanson, D; Harrison, D; Helou, G; Henrot-Versillé, S; Hernández-Monteagudo, C; Herranz, D; Hildebrandt, S R; Hivon, E; Hobson, M; Holmes, W A; Hornstrup, A; Hovest, W; Huffenberger, K M; Jaffe, A H; Jaffe, T R; Jewell, J; Joncas, G; Jones, W C; Juvela, M; Keihänen, E; Keskitalo, R; Kisner, T S; Knoche, J; Knox, L; Kunz, M; Kurki-Suonio, H; Lagache, G; Lähteenmäki, A; Lamarre, J -M; Lasenby, A; Laureijs, R J; Lawrence, C R; Leonardi, R; León-Tavares, J; Lesgourgues, J; Levrier, F; Liguori, M; Lilje, P B; Linden-Vørnle, M; López-Caniego, M; Lubin, P M; Macías-Pérez, J F; Maffei, B; Maino, D; Mandolesi, N; Maris, M; Marshall, D J; Martin, P G; Martínez-González, E; Masi, S; Massardi, M; Matarrese, S; Matthai, F; Mazzotta, P; McGehee, P; Melchiorri, A; Mendes, L; Mennella, A; Migliaccio, M; Mitra, S; Miville-Deschênes, M -A; Moneti, A; Montier, L; Morgante, G; Mortlock, D; Munshi, D; Murphy, J A; Naselsky, P; Nati, F; Natoli, P; Netterfield, C B; Nørgaard-Nielsen, H U; Noviello, F; Novikov, D; Novikov, I; Osborne, S; Oxborrow, C A; Paci, F; Pagano, L; Pajot, F; Paladini, R; Paoletti, D; Pasian, F; Patanchon, G; Perdereau, O; Perotto, L; Perrotta, F; Piacentini, F; Piat, M; Pierpaoli, E; Pietrobon, D; Plaszczynski, S; Pointecouteau, E; Polenta, G; Ponthieu, N; Popa, L; Poutanen, T; Pratt, G W; Prézeau, G; Prunet, S; Puget, J -L; Rachen, J P; Reach, W T; Rebolo, R; Reinecke, M; Remazeilles, M; Renault, C; Ricciardi, S; Riller, T; Ristorcelli, I; Rocha, G; Rosset, C; Roudier, G; Rowan-Robinson, M; Rubiño-Martín, J A; Rusholme, B; Sandri, M; Santos, D; Savini, G; Scott, D; Seiffert, M D; Shellard, E P S; Spencer, L D; Starck, J -L; Stolyarov, V; Stompor, R; Sudiwala, R; Sunyaev, R; Sureau, F; Sutton, D; Suur-Uski, A -S; Sygnet, J -F; Tauber, J A; Tavagnacco, D; Terenzi, L; Toffolatti, L; Tomasi, M; Tristram, M; Tucci, M; Tuovinen, J; Türler, M; Umana, G; Valenziano, L; Valiviita, J; Van Tent, B; Vielva, P; Villa, F; Vittorio, N; Wade, L A; Wandelt, B D; Welikala, N; Yvon, D; Zacchei, A; Zonca, A
2014-01-01
This paper presents an all-sky model of dust emission from the Planck 857, 545 and 353 GHz, and IRAS 100 micron data. Using a modified black-body fit to the data we present all-sky maps of the dust optical depth, temperature, and spectral index over the 353-3000 GHz range. This model is a tight representation of the data at 5 arcmin. It shows variations of the order of 30 % compared with the widely-used model of Finkbeiner, Davis, and Schlegel. The Planck data allow us to estimate the dust temperature uniformly over the whole sky, providing an improved estimate of the dust optical depth compared to previous all-sky dust model, especially in high-contrast molecular regions. An increase of the dust opacity at 353 GHz, tau_353/N_H, from the diffuse to the denser interstellar medium (ISM) is reported. It is associated with a decrease in the observed dust temperature, T_obs, that could be due at least in part to the increased dust opacity. We also report an excess of dust emission at HI column densities lower than...
Alaskan Auroral All-Sky Images on the World Wide Web
Stenbaek-Nielsen, H. C.
1997-01-01
In response to a 1995 NASA SPDS announcement of support for preservation and distribution of important data sets online, the Geophysical Institute, University of Alaska Fairbanks, Alaska, proposed to provide World Wide Web access to the Poker Flat Auroral All-sky Camera images in real time. The Poker auroral all-sky camera is located in the Davis Science Operation Center at Poker Flat Rocket Range about 30 miles north-east of Fairbanks, Alaska, and is connected, through a microwave link, with the Geophysical Institute where we maintain the data base linked to the Web. To protect the low light-level all-sky TV camera from damage due to excessive light, we only operate during the winter season when the moon is down. The camera and data acquisition is now fully computer controlled. Digital images are transmitted each minute to the Web linked data base where the data are available in a number of different presentations: (1) Individual JPEG compressed images (1 minute resolution); (2) Time lapse MPEG movie of the stored images; and (3) A meridional plot of the entire night activity.
LoFASM: A Low Frequency All Sky Monitor for Radio Transients and Student Training
2015-09-02
SECURITY CLASSIFICATION OF: The Low-Frequency All- Sky Monitor (LoFASM) is an innovative new radio astronomy observatory. Designed and built by...Feb-2015 Approved for Public Release; Distribution Unlimited Final Report: LoFASM: A Low Frequency All Sky Monitor for Radio Transients and Student...reviewed journals: Number of Papers published in non peer-reviewed journals: Final Report: LoFASM: A Low Frequency All Sky Monitor for Radio Transients and
All-sky radiance simulation of Megha-Tropiques SAPHIR microwave ...
Indian Academy of Sciences (India)
used as input to the RTTOV model to simulate cloud-affected SAPHIR radiances. ... All-sky radiance simulation; Megha tropiques; microwave SAPHIR sensor; radiative transfer; data ... versions of these non-linear processes (Ohring and.
All-Sky Interferometry with Spherical Harmonic Transit Telescopes
Energy Technology Data Exchange (ETDEWEB)
Shaw, J.Richard [Canadian Inst. Theor. Astrophys.; Sigurdson, Kris [British Columbia U.; Pen, Ue-Li [Canadian Inst. Theor. Astrophys.; Stebbins, Albert [Fermilab; Sitwell, Michael [British Columbia U.
2013-02-01
In this paper we describe the spherical harmonic transit telescope, a novel formalism for the analysis of transit radio telescopes. This all-sky approach bypasses the curved sky complications of traditional interferometry and so is particularly well suited to the analysis of wide-field radio interferometers. It enables compact and computationally efficient representations of the data and its statistics that allow new ways of approaching important problems like map-making and foreground removal. In particular, we show how it enables the use of the Karhunen-Loeve transform as a highly effective foreground filter, suppressing realistic foreground residuals for our fiducial example by at least a factor twenty below the 21cm signal even in highly contaminated regions of the sky. This is despite the presence of the angle-frequency mode mixing inherent in real-world instruments with frequency-dependent beams. We show, using Fisher forecasting, that foreground cleaning has little effect on power spectrum constraints compared to hypothetical foreground-free measurements. Beyond providing a natural real-world data analysis framework for 21cm telescopes now under construction and future experiments, this formalism allows accurate power spectrum forecasts to be made that include the interplay of design constraints and realistic experimental systematics with twenty-first century 21cm science.
Leng, Pei; Li, Zhao-Liang; Duan, Si-Bo; Tang, Ronglin; Gao, Mao-Fang
2017-12-01
Evapotranspiration (ET) is an important component of the water and energy cycle. The present study develops a practical approach for generating all-sky ET with the synergistic use of satellite images and meteorological data. In this approach, the ET over clear-sky pixels is estimated from a two-stage land surface temperature (LST)/fractional vegetation cover feature space method where the dry/wet edges are determined from theoretical calculations. For cloudy pixels, the Penman-Monteith equation is used to calculate the ET where no valid remotely sensed LST is available. An evaluation of the method with ET collected at ground-based large aperture scintillometer measurements at the Yucheng Comprehensive Experimental Station (YCES) in China is performed over a growth period from April to October 2010. The results show that the root-mean-square error (RMSE) and bias over clear-sky pixels are 57.3 W/m2 and 18.2 W/m2, respectively, whereas an RMSE of 69.3 W/m2 with a bias of 12.3 W/m2 can be found over cloudy pixels. Moreover, a reasonable overall RMSE of 65.3 W/m2 with a bias of 14.4 W/m2 at the YCES can be obtained under all-sky conditions, indicating a promising prospect for the derivation of all-sky ET using currently available satellite and meteorological data at a regional or global scale in future developments.
H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.
2010-02-01
Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.
Assimilating All-Sky Himawari-8 Satellite Infrared Radiances: A Case of Typhoon Soudelor (2015)
Honda, Takumi; Miyoshi, Takemasa; Lien, Guo-Yuan; Nishizawa, Seiya; Yoshida, Ryuji; Adachi, Sachiho A.; Terasaki, Koji; Okamoto, Kozo; Tomita, Hirofumi; Bessho, Kotaro
2018-01-01
Japan’s new geostationary satellite Himawari-8, the first of a series of the third-generation geostationary meteorological satellites includingGOES-16, has been operational since July 2015. Himawari-8 produces highresolution observations with 16 frequency bands every 10 min for full disk, and every 2.5 min for local regions. This study aims to assimilate all-sky every-10-min infrared (IR) radiances from Himawari-8 with a regional numerical weather prediction model and to investigate its impac...
The Next Generation Sky Survey and the Quest for Cooler Brown Dwarfs
Kirkpatrick, J. Davy
2002-01-01
The Next Generation Sky Survey (NGSS) is a proposed NASA MIDEX mission to map the entire sky in four infrared bandpasses - 3.5, 4.7, 12, and 23 um. The seven-month mission will use a 50-cm telescope and four-channel imager to survey the sky from a circular orbit above the Earth. Expected sensitivities will be half a million times that of COBE/DIRBE at 3.5 and 4.7 um and a thousand times that of IRAS at 12 and 23 um. NGSS will be particularly sensitive to brown dwarfs cooler than those present...
Planck intermediate results XXIX. All-sky dust modelling with Planck, IRAS, and WISE observations
DEFF Research Database (Denmark)
Ade, P. A. R.; Aghanim, N.; Alves, M. I. R.
2016-01-01
We present all-sky modelling of the high resolution Planck, IRAS, andWISE infrared (IR) observations using the physical dust model presented by Draine & Li in 2007 (DL, ApJ, 657, 810). We study the performance and results of this model, and discuss implications for future dust modelling....... The present work extends the DL dust modelling carried out on nearby galaxies using Herschel and Spitzer data to Galactic dust emission. We employ the DL dust model to generate maps of the dust mass surface density Sigma(Md), the dust optical extinction A(V), and the starlight intensity heating the bulk...... of the dust, parametrized by U-min. The DL model reproduces the observed spectral energy distribution (SED) satisfactorily over most of the sky, with small deviations in the inner Galactic disk and in low ecliptic latitude areas, presumably due to zodiacal light contamination. In the Andromeda galaxy (M31...
All-sky analysis of the general relativistic galaxy power spectrum
Yoo, Jaiyul; Desjacques, Vincent
2013-07-01
We perform an all-sky analysis of the general relativistic galaxy power spectrum using the well-developed spherical Fourier decomposition. Spherical Fourier analysis expresses the observed galaxy fluctuation in terms of the spherical harmonics and spherical Bessel functions that are angular and radial eigenfunctions of the Helmholtz equation, providing a natural orthogonal basis for all-sky analysis of the large-scale mode measurements. Accounting for all the relativistic effects in galaxy clustering, we compute the spherical power spectrum and its covariance matrix and compare it to the standard three-dimensional power spectrum to establish a connection. The spherical power spectrum recovers the three-dimensional power spectrum at each wave number k with its angular dependence μk encoded in angular multipole l, and the contributions of the line-of-sight projection to galaxy clustering such as the gravitational lensing effect can be readily accommodated in the spherical Fourier analysis. A complete list of formulas for computing the relativistic spherical galaxy power spectrum is also presented.
Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.
The Einstein All-Sky IPC slew survey
Elvis, Martin; Plummer, David; Fabbiano, G.
1989-01-01
The construction of the Einstein All-Sky Imaging Proportional Counter (IPC) slew survey is considered. It contains approximately 1000 sources between 10(exp -12) and 10(exp -10) erg/sq cm/s with a concentration toward the ecliptic poles and away from the galactic plane. Several sizable samples of bright soft X-ray selected objects for follow-up ROSAT and ASTRO-D observations and statistical study are presented. The survey source list is expected to be available by late 1989. Both paper and remote access online data base versions are to be available. An identification program is considered.
International Nuclear Information System (INIS)
Goetz, E; Riles, K
2016-01-01
We present a method for coherently combining short data segments from gravitational-wave detectors to improve the sensitivity of semi-coherent searches for continuous gravitational waves. All-sky searches for continuous gravitational waves from unknown sources are computationally limited. The semi-coherent approach reduces the computational cost by dividing the entire observation timespan into short segments to be analyzed coherently, then combined together incoherently. Semi-coherent analyses that attempt to improve sensitivity by coherently combining data from multiple detectors face a computational challenge in accounting for uncertainties in signal parameters. In this article, we lay out a technique to meet this challenge using summed Fourier transform coefficients. Applying this technique to one all-sky search algorithm called TwoSpect, we confirm that the sensitivity of all-sky, semi-coherent searches can be improved by coherently combining the short data segments, e.g., by up to 42% over a single detector for an all-sky search. For misaligned detectors, however, this improvement requires careful attention when marginalizing over unknown polarization parameters. In addition, care must be taken in correcting for differential detector velocity due to the Earth’s rotation for high signal frequencies and widely separated detectors. (paper)
International Nuclear Information System (INIS)
Haslam, C.G.T.; Salter, C.J.; Stoffel, H.
1981-01-01
A brief outline of the results of this survey is presented. The 408 MHz All-sky Survey has been made from four radio continuum surveys observed between 1965 and 1978, using the Jodrell Bank MKI telescope (Haslam et al., 1970), the Effelsberg 100 metre telescope (Haslam et al., 1974) and the Parkes 64 metre telescope (Haslam et al., 1975). A detailed description of the survey data reduction and calibration methods, with preliminary astronomical results will soon be published (Haslam et al., 1980a) and a second paper will give an atlas of maps at the full survey resolution of 51' arc between half power points (Haslam et al., 1980b). A map, smoothed to a gaussian beam with resolution between half power poitns of 3 0 , is presented. (Auth.)
On the COSMO-SkyMed Exploitation for Interferometric DEM Generation
Teresa, C. M.; Raffaele, N.; Oscar, N. D.; Fabio, B.
2011-12-01
DEM products for Earth observation space-borne applications are being to play a role of increasing importance due to the new generation of high resolution sensors (both optical and SAR). These new sensors demand elevation data for processing and, on the other hand, they provide new possibilities for DEM generation. Till now, for what concerns interferometric DEM, the Shuttle Radar Topography Mission (SRTM) has been the reference product for scientific applications all over the world. SRTM mission [1] had the challenging goal to meet the requirements for a homogeneous and reliable DEM fulfilling the DTED-2 specifications. However, new generation of high resolution sensors (including SAR) pose new requirements for elevation data in terms of vertical precision and spatial resolution. DEM are usually used as ancillary input in different processing steps as for instance geocoding and Differential SAR Interferometry. In this context, the recent SAR missions of DLR (TerraSAR-X and TanDEM-X) and ASI (COSMO-SkyMed) can play a promising role thanks to their high resolution both in space and time. In particular, the present work investigates the potentialities of the COSMO/SkyMed (CSK) constellation for ground elevation measurement with particular attention devoted to the impact of the improved spatial resolution wrt the previous SAR sensors. The recent scientific works, [2] and [3], have shown the advantages of using CSK in the monitoring of terrain deformations caused by landslides, earthquakes, etc. On the other hand, thanks to the high spatial resolution, CSK appears to be very promising in monitoring man-made structures, such as buildings, bridges, railways and highways, thus enabling new potential applications (urban applications, precise DEM, etc.). We present results obtained by processing both SPOTLIGHT and STRIPMAP acquisitions through standard SAR Interferometry as well as multi-pass interferometry [4] with the aim of measuring ground elevation. Acknowledgments
Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3
HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.
2018-03-01
Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.
The 105-Month Swift-BAT All-sky Hard X-Ray Survey
Oh, Kyuseok; Koss, Michael; Markwardt, Craig B.; Schawinski, Kevin; Baumgartner, Wayne H.; Barthelmy, Scott D.; Cenko, S. Bradley; Gehrels, Neil; Mushotzky, Richard; Petulante, Abigail; Ricci, Claudio; Lien, Amy; Trakhtenbrot, Benny
2018-03-01
We present a catalog of hard X-ray sources detected in the first 105 months of observations with the Burst Alert Telescope (BAT) coded-mask imager on board the Swift observatory. The 105-month Swift-BAT survey is a uniform hard X-ray all-sky survey with a sensitivity of 8.40× {10}-12 {erg} {{{s}}}-1 {cm}}-2 over 90% of the sky and 7.24× {10}-12 {erg} {{{s}}}-1 {cm}}-2 over 50% of the sky in the 14–195 keV band. The Swift-BAT 105-month catalog provides 1632 (422 new detections) hard X-ray sources in the 14–195 keV band above the 4.8σ significance level. Adding to the previously known hard X-ray sources, 34% (144/422) of the new detections are identified as Seyfert active galactic nuclei (AGNs) in nearby galaxies (zBAT catalog, we release eight-channel spectra and monthly sampled light curves for each object in the online journal and at the Swift-BAT 105-month website.
Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar
Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.
2018-05-01
The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.
Noctilucent cloud particle size determination based on multi-wavelength all-sky analysis
Ugolnikov, Oleg S.; Galkin, Alexey A.; Pilgaev, Sergey V.; Roldugin, Alexey V.
2017-10-01
The article deals with the analysis of color distribution in noctilucent clouds (NLC) in the sky based on multi-wavelength (RGB) CCD-photometry provided with the all-sky camera in Lovozero in the north of Russia (68.0°N, 35.1°E) during the bright expanded NLC performance in the night of August 12, 2016. Small changes in the NLC color across the sky are interpreted as the atmospheric absorption and extinction effects combined with the difference in the Mie scattering functions of NLC particles for the three color channels of the camera. The method described in this paper is used to find the effective monodisperse radius of particles about 55 nm. The result of these simple and cost-effective measurements is in good agreement with previous estimations of comparable accuracy. Non-spherical particles, Gaussian and lognormal distribution of the particle size are also considered.
ASHI: An All Sky Heliospheric Imager for Viewing Thomson-Scattered Light
Buffington, A.; Jackson, B. V.; Yu, H. S.; Hick, P. P.; Bisi, M. M.
2017-12-01
We have developed, and are now making a detailed design for an All-Sky Heliospheric Imager (ASHI), to fly on future deep-space missions. ASHI's principal long-term objective is acquisition of a precision photometric map of the inner heliosphere as viewed from deep space. Photometers on the twin Helios spacecraft, the Solar Mass Ejection Imager (SMEI) upon the Coriolis satellite, and the Heliospheric Imagers (HIs) upon the Solar-TErrestrial RElations Observatory (STEREO) twin spacecraft, all indicate an optimum instrument design for visible-light Thomson-scattering observations. This design views a hemisphere of sky starting a few degrees from the Sun. Two imagers can cover almost all of the whole sky. A key photometric specification for ASHI is 0.1% differential photometry: this enables the three dimensional reconstruction of density starting from near the Sun and extending outward. SMEI analyses have demonstrated the success of this technique: when employed by ASHI, this will provide an order of magnitude better resolution in 3-D density over time. We augment this analysis to include velocity, and these imagers deployed in deep space can thus provide high-resolution comparisons both of direct in-situ density and velocity measurements to remote observations of solar wind structures. In practice we find that the 3-D velocity determinations provide the best tomographic timing depiction of heliospheric structures. We discuss the simple concept behind this, and present recent progress in the instrument design, and its expected performance specifications. A preliminary balloon flight of an ASHI prototype is planned to take place next Summer.
X-RAY-EMITTING STARS IDENTIFIED FROM THE ROSAT ALL-SKY SURVEY AND THE SLOAN DIGITAL SKY SURVEY
International Nuclear Information System (INIS)
Agueeros, Marcel A.; Newsom, Emily R.; Anderson, Scott F.; Hawley, Suzanne L.; Silvestri, Nicole M.; Szkody, Paula; Covey, Kevin R.; Posselt, Bettina; Margon, Bruce; Voges, Wolfgang
2009-01-01
The ROSAT All-Sky Survey (RASS) was the first imaging X-ray survey of the entire sky. Combining the RASS Bright and Faint Source Catalogs yields an average of about three X-ray sources per square degree. However, while X-ray source counterparts are known to range from distant quasars to nearby M dwarfs, the RASS data alone are often insufficient to determine the nature of an X-ray source. As a result, large-scale follow-up programs are required to construct samples of known X-ray emitters. We use optical data produced by the Sloan Digital Sky Survey (SDSS) to identify 709 stellar X-ray emitters cataloged in the RASS and falling within the SDSS Data Release 1 footprint. Most of these are bright stars with coronal X-ray emission unsuitable for SDSS spectroscopy, which is designed for fainter objects (g > 15 [mag]). Instead, we use SDSS photometry, correlations with the Two Micron All Sky Survey and other catalogs, and spectroscopy from the Apache Point Observatory 3.5 m telescope to identify these stellar X-ray counterparts. Our sample of 707 X-ray-emitting F, G, K, and M stars is one of the largest X-ray-selected samples of such stars. We derive distances to these stars using photometric parallax relations appropriate for dwarfs on the main sequence, and use these distances to calculate L X . We also identify a previously unknown cataclysmic variable (CV) as a RASS counterpart. Separately, we use correlations of the RASS and the SDSS spectroscopic catalogs of CVs and white dwarfs (WDs) to study the properties of these rarer X-ray-emitting stars. We examine the relationship between (f X /f g ) and the equivalent width of the Hβ emission line for 46 X-ray-emitting CVs and discuss tentative classifications for a subset based on these quantities. We identify 17 new X-ray-emitting DA (hydrogen) WDs, of which three are newly identified WDs. We report on follow-up observations of three candidate cool X-ray-emitting WDs (one DA and two DB (helium) WDs); we have not
RELIABLE IDENTIFICATIONS OF ACTIVE GALACTIC NUCLEI FROM THE WISE, 2MASS, AND ROSAT ALL-SKY SURVEYS
International Nuclear Information System (INIS)
Edelson, R.; Malkan, M.
2012-01-01
We have developed the ''S IX '' statistic to identify bright, highly likely active galactic nucleus (AGN) candidates solely on the basis of Wide-field Infrared Survey Explorer (WISE), Two Micron All-Sky Survey (2MASS), and ROSAT all-sky survey (RASS) data. This statistic was optimized with data from the preliminary WISE survey and the Sloan Digital Sky Survey, and tested with Lick 3 m Kast spectroscopy. We find that sources with S IX 95% likelihood of being an AGN (defined in this paper as a Seyfert 1, quasar, or blazar). This statistic was then applied to the full WISE/2MASS/RASS dataset, including the final WISE data release, to yield the ''W2R'' sample of 4316 sources with S IX 2 , permitting construction of AGN samples in any sufficiently large region of sky.
A prototype for the PASS Permanent All Sky Survey
Deeg, H. J.; Alonso, R.; Belmonte, J. A.; Horne, K.; Alsubai, K.; Collier Cameron, A.; Doyle, L. R.
2004-10-01
A prototype system for the Permanent All Sky Survey (PASS) project is presented. PASS is a continuous photometric survey of the entire celestial sphere with a high temporal resolution. Its major objectives are the detection of all giant-planet transits (with periods up to some weeks) across stars up to mag 10.5, and to deliver continuously photometry that is useful for the study of any variable stars. The prototype is based on CCD cameras with short focal length optics on a fixed mount. A small dome to house it at Teide Observatory, Tenerife, is currently being constructed. A placement at the antarctic Dome C is also being considered. The prototype will be used for a feasibility study of PASS, to define the best observing strategies, and to perform a detailed characterization of the capabilities and scope of the survey. Afterwards, a first partial sky surveying will be started with it. That first survey may be able to detect transiting planets during its first few hundred hours of operation. It will also deliver a data set around which software modules dealing with the various scientific objectives of PASS will be developed. The PASS project is still in its early phase and teams interested in specific scientific objectives, in providing technical expertise, or in participating with own observations are invited to collaborate.
THE 22 MONTH SWIFT-BAT ALL-SKY HARD X-RAY SURVEY
International Nuclear Information System (INIS)
Tueller, J.; Baumgartner, W. H.; Markwardt, C. B.; Skinner, G. K.; Mushotzky, R. F.; Barthelmy, S.; Cummings, J.; Gehrels, N.; Holland, S.; Ajello, M.; Beardmore, A.; Evans, P.; Godet, O.; Brandt, W. N.; Burrows, D.; Grupe, D.; Chincarini, G.; Campana, S.; Cusumano, G.; Fenimore, E.
2010-01-01
We present the catalog of sources detected in the first 22 months of data from the hard X-ray survey (14-195 keV) conducted with the Burst Alert Telescope (BAT) coded mask imager on the Swift satellite. The catalog contains 461 sources detected above the 4.8σ level with BAT. High angular resolution X-ray data for every source from Swift-XRT or archival data have allowed associations to be made with known counterparts in other wavelength bands for over 97% of the detections, including the discovery of ∼30 galaxies previously unknown as active galactic nuclei and several new Galactic sources. A total of 266 of the sources are associated with Seyfert galaxies (median redshift z ∼ 0.03) or blazars, with the majority of the remaining sources associated with X-ray binaries in our Galaxy. This ongoing survey is the first uniform all-sky hard X-ray survey since HEAO-1 in 1977. Since the publication of the nine-month BAT survey we have increased the number of energy channels from four to eight and have substantially increased the number of sources with accurate average spectra. The BAT 22 month catalog is the product of the most sensitive all-sky survey in the hard X-ray band, with a detection sensitivity (4.8σ) of 2.2 x 10 -11 erg cm -2 s -1 (1 mCrab) over most of the sky in the 14-195 keV band.
The WATCH All-Sky Monitor for the Granat Project
DEFF Research Database (Denmark)
Brandt, Søren; Lund, Niels; Rao, A. R.
1990-01-01
The Watch X-ray all-sky monitor, which is designed to localize strong X-ray sources and follow their development, is examined, focusing on the addition of four Watch units to the Granat satellite project. The components of the Watch instrument are described and the capabilities and potential...... scientific returns of the Granat project are discussed. The applications of the Watch monitor are given, including the study of time variations of known sources and the detection and localization of new, transient sources....
WATCHDOG: A COMPREHENSIVE ALL-SKY DATABASE OF GALACTIC BLACK HOLE X-RAY BINARIES
International Nuclear Information System (INIS)
Tetarenko, B. E.; Sivakoff, G. R.; Heinke, C. O.; Gladstone, J. C.
2016-01-01
With the advent of more sensitive all-sky instruments, the transient universe is being probed in greater depth than ever before. Taking advantage of available resources, we have established a comprehensive database of black hole (and black hole candidate) X-ray binary (BHXB) activity between 1996 and 2015 as revealed by all-sky instruments, scanning surveys, and select narrow-field X-ray instruments on board the INTErnational Gamma-Ray Astrophysics Laboratory, Monitor of All-Sky X-ray Image, Rossi X-ray Timing Explorer, and Swift telescopes; the Whole-sky Alberta Time-resolved Comprehensive black-Hole Database Of the Galaxy or WATCHDOG. Over the past two decades, we have detected 132 transient outbursts, tracked and classified behavior occurring in 47 transient and 10 persistently accreting BHs, and performed a statistical study on a number of outburst properties across the Galactic population. We find that outbursts undergone by BHXBs that do not reach the thermally dominant accretion state make up a substantial fraction (∼40%) of the Galactic transient BHXB outburst sample over the past ∼20 years. Our findings suggest that this “hard-only” behavior, observed in transient and persistently accreting BHXBs, is neither a rare nor recent phenomenon and may be indicative of an underlying physical process, relatively common among binary BHs, involving the mass-transfer rate onto the BH remaining at a low level rather than increasing as the outburst evolves. We discuss how the larger number of these “hard-only” outbursts and detected outbursts in general have significant implications for both the luminosity function and mass-transfer history of the Galactic BHXB population
RXTE All-Sky Monitor Localization of SGR 1627-41
Smith, Donald A.; Bradt, Hale V.; Levine, Alan M.
1999-01-01
The fourth unambiguously identified Soft Gamma Repeater (SGR), SGR1627-41, was discovered with the BATSE instrument on 1998 June 15 (Kouveliotou et al. 1998). Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6 deg segment of a narrow (19") annulus (Hurley et al. 1999; Woods et al. 1998). We present two bursts from this source observed by the All-Sky Monitor (ASM) on RXTE. We use the ASM data to further constrain the source location to a 5'...
THE 70 MONTH SWIFT-BAT ALL-SKY HARD X-RAY SURVEY
Energy Technology Data Exchange (ETDEWEB)
Baumgartner, W. H.; Tueller, J.; Markwardt, C. B.; Skinner, G. K.; Barthelmy, S.; Gehrels, N. [NASA/Goddard Space Flight Center, Astrophysics Science Division, Greenbelt, MD 20771 (United States); Mushotzky, R. F. [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Evans, P. A., E-mail: whbaumga@alum.mit.edu [X-Ray and Observational Astronomy Group/Department of Physics and Astronomy, University of Leicester, Leicester, LE1 7RH (United Kingdom)
2013-08-15
We present the catalog of sources detected in 70 months of observations with the Burst Alert Telescope (BAT) hard X-ray detector on the Swift gamma-ray burst observatory. The Swift-BAT 70 month survey has detected 1171 hard X-ray sources (more than twice as many sources as the previous 22 month survey) in the 14-195 keV band down to a significance level of 4.8{sigma}, associated with 1210 counterparts. The 70 month Swift-BAT survey is the most sensitive and uniform hard X-ray all-sky survey and reaches a flux level of 1.03 Multiplication-Sign 10{sup -11} erg s{sup -1} cm{sup -2} over 50% of the sky and 1.34 Multiplication-Sign 10{sup -11} erg s{sup -1} cm{sup -2} over 90% of the sky. The majority of new sources in the 70 month survey continue to be active galactic nuclei, with over 700 in the catalog. As part of this new edition of the Swift-BAT catalog, we also make available eight-channel spectra and monthly sampled light curves for each object detected in the survey in the online journal and at the Swift-BAT 70 month Web site.
The 105-Month Swift-BAT All-Sky Hard X-Ray Survey
Oh, Kyuseok; Koss, Michael; Markwardt, Craig B.; Schawinski, Kevin; Baumgartner, Wayne H.; Barthelmy, Scott D.; Cenko, S. Bradley; Gehrels, Neil; Mushotzky, Richard; Petulante, Abigail;
2018-01-01
We present a catalog of hard X-ray sources detected in the first 105 months of observations with the Burst Alert Telescope (BAT) coded-mask imager on board the Swift observatory. The 105-month Swift-BAT survey is a uniform hard X-ray all-sky survey with a sensitivity of 8.40 x 10(exp -12) erg s(exp -1) cm(exp -2) over 90% of the sky and 7.24 x 10(exp -12) erg s(exp -1) cm(exp -2) over 50% of the sky in the 14-195 keV band. The Swift-BAT 105-month catalog provides 1632 (422 new detections) hard X-ray sources in the 14-195 keV band above the 4.8 sigma significance level. Adding to the previously known hard X-ray sources, 34% (144/422) of the new detections are identified as Seyfert active galactic nuclei (AGNs) in nearby galaxies (z < 0.2). The majority of the remaining identified sources are X-ray binaries (7%, 31) and blazars/BL Lac objects (10%, 43). As part of this new edition of the Swift-BAT catalog, we release eight-channel spectra and monthly sampled light curves for each object in the online journal and at the Swift-BAT 105-month website.
THE 70 MONTH SWIFT-BAT ALL-SKY HARD X-RAY SURVEY
International Nuclear Information System (INIS)
Baumgartner, W. H.; Tueller, J.; Markwardt, C. B.; Skinner, G. K.; Barthelmy, S.; Gehrels, N.; Mushotzky, R. F.; Evans, P. A.
2013-01-01
We present the catalog of sources detected in 70 months of observations with the Burst Alert Telescope (BAT) hard X-ray detector on the Swift gamma-ray burst observatory. The Swift-BAT 70 month survey has detected 1171 hard X-ray sources (more than twice as many sources as the previous 22 month survey) in the 14-195 keV band down to a significance level of 4.8σ, associated with 1210 counterparts. The 70 month Swift-BAT survey is the most sensitive and uniform hard X-ray all-sky survey and reaches a flux level of 1.03 × 10 –11 erg s –1 cm –2 over 50% of the sky and 1.34 × 10 –11 erg s –1 cm –2 over 90% of the sky. The majority of new sources in the 70 month survey continue to be active galactic nuclei, with over 700 in the catalog. As part of this new edition of the Swift-BAT catalog, we also make available eight-channel spectra and monthly sampled light curves for each object detected in the survey in the online journal and at the Swift-BAT 70 month Web site
Detecting TLEs using a massive all-sky camera network
Garnung, M. B.; Celestin, S. J.
2017-12-01
Transient Luminous Events (TLEs) are large-scale optical events occurring in the upper-atmosphere from the top of thunderclouds up to the ionosphere. TLEs may have important effects in local, regional, and global scales, and many features of TLEs are not fully understood yet [e.g, Pasko, JGR, 115, A00E35, 2010]. Moreover, meteor events have been suggested to play a role in sprite initiation by producing ionospheric irregularities [e.g, Qin et al., Nat. Commun., 5, 3740, 2014]. The French Fireball Recovery and InterPlanetary Observation Network (FRIPON, https://www.fripon.org/?lang=en), is a national all-sky 30 fps camera network designed to continuously detect meteor events. We seek to make use of this network to observe TLEs over unprecedented space and time scales ( 1000×1000 km with continuous acquisition). To do so, we had to significantly modify FRIPON's triggering software Freeture (https://github.com/fripon/freeture) while leaving the meteor detection capability uncompromised. FRIPON has a great potential in the study of TLEs. Not only could it produce new results about spatial and time distributions of TLEs over a very large area, it could also be used to validate and complement observations from future space missions such as ASIM (ESA) and TARANIS (CNES). In this work, we present an original image processing algorithm that can detect sprites using all-sky cameras while strongly limiting the frequency of false positives and our ongoing work on sprite triangulation using the FRIPON network.
International Nuclear Information System (INIS)
Alonso-Montesinos, J.; Batlles, F.J.; Portillo, C.
2015-01-01
Highlights: • The solar resource has been predicted for three hours at 1-min intervals. • Digital image levels and cloud motion vectors are joint for irradiance forecasting. • The three radiation components have been predicted under different sky conditions. • Diffuse and global radiation has an nRMSE value around 10% in all sky conditions. • Beam irradiance is predicted with an nRMSE value of about 15% in overcast skies. - Abstract: In the search for new techniques to predict atmospheric features that might be useful to solar power plant operators, we have carried out solar irradiance forecasting using emerging sky camera technology. Digital image levels are converted into irradiances and then the maximum cross-correlation method is applied to obtain future predictions. This methodology is a step forward in the study of the solar resource, essential to solar plant operators in adapting a plant’s operating procedures to atmospheric conditions and to improve electricity generation. The results are set out using different statistical parameters, in which beam, diffuse and global irradiances give a constant normalized root-mean-square error value over the time interval for all sky conditions. The average measure is 25.44% for beam irradiance; 11.60% for diffuse irradiance and 11.17% for global irradiance.
Discovery of the hard spectrum VHE γ-ray source HESS J1641-463
International Nuclear Information System (INIS)
Abramowski, A.; Ait Benkhali, F.
2014-10-01
This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.
ATLAS: A High-cadence All-sky Survey System
Tonry, J. L.; Denneau, L.; Heinze, A. N.; Stalder, B.; Smith, K. W.; Smartt, S. J.; Stubbs, C. W.; Weiland, H. J.; Rest, A.
2018-06-01
Technology has advanced to the point that it is possible to image the entire sky every night and process the data in real time. The sky is hardly static: many interesting phenomena occur, including variable stationary objects such as stars or QSOs, transient stationary objects such as supernovae or M dwarf flares, and moving objects such as asteroids and the stars themselves. Funded by NASA, we have designed and built a sky survey system for the purpose of finding dangerous near-Earth asteroids (NEAs). This system, the “Asteroid Terrestrial-impact Last Alert System” (ATLAS), has been optimized to produce the best survey capability per unit cost, and therefore is an efficient and competitive system for finding potentially hazardous asteroids (PHAs) but also for tracking variables and finding transients. While carrying out its NASA mission, ATLAS now discovers more bright (m day cadence. ATLAS discovered the afterglow of a gamma-ray burst independent of the high energy trigger and has released a variable star catalog of 5 × 106 sources. This is the first of a series of articles describing ATLAS, devoted to the design and performance of the ATLAS system. Subsequent articles will describe in more detail the software, the survey strategy, ATLAS-derived NEA population statistics, transient detections, and the first data release of variable stars and transient light curves.
Comparison of auroral ovals from all-sky camera studies and from satellite photographs
International Nuclear Information System (INIS)
Bond, F.R.; Akasofu, S.I.
1979-01-01
A comparison is made of the statistical auroral ovals determined by all-sky camera photographs with DMSP photographs for different degrees of geomagnetic activity. It is shown that the agreement between them is excellent. (author)
MOXE: An X-ray all-sky monitor for Soviet Spectrum-X-Gamma Mission
Priedhorsky, W.; Fenimore, E. E.; Moss, C. E.; Kelley, R. L.; Holt, S. S.
1989-01-01
A Monitoring Monitoring X-Ray Equipment (MOXE) is being developed for the Soviet Spectrum-X-Gamma Mission. MOXE is an X-ray all-sky monitor based on array of pinhole cameras, to be provided via a collaboration between Goddard Space Flight Center and Los Alamos National Laboratory. The objectives are to alert other observers on Spectrum-X-Gamma and other platforms of interesting transient activity, and to synoptically monitor the X-ray sky and study long-term changes in X-ray binaries. MOXE will be sensitive to sources as faint as 2 milliCrab (5 sigma) in 1 day, and cover the 2 to 20 KeV band.
2013-02-15
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket Nos. EG13-6-000, et al] North Sky River Energy, LLC, et al; Notice of Effectiveness of Exempt Wholesale Generator Status Docket Nos. North Sky River Energy, LLC EG13-6-000 Black Bear SO, LLC EG13-7-000 Black Bear Development Holdings...
Application of simple all-sky imagers for the estimation of aerosol optical depth
Kazantzidis, Andreas; Tzoumanikas, Panagiotis; Nikitidou, Efterpi; Salamalikis, Vasileios; Wilbert, Stefan; Prahl, Christoph
2017-06-01
Aerosol optical depth is a key atmospheric constituent for direct normal irradiance calculations at concentrating solar power plants. However, aerosol optical depth is typically not measured at the solar plants for financial reasons. With the recent introduction of all-sky imagers for the nowcasting of direct normal irradiance at the plants a new instrument is available which can be used for the determination of aerosol optical depth at different wavelengths. In this study, we are based on Red, Green and Blue intensities/radiances and calculations of the saturated area around the Sun, both derived from all-sky images taken with a low-cost surveillance camera at the Plataforma Solar de Almeria, Spain. The aerosol optical depth at 440, 500 and 675nm is calculated. The results are compared with collocated aerosol optical measurements and the mean/median difference and standard deviation are less than 0.01 and 0.03 respectively at all wavelengths.
Planck early results. VIII. The all-sky early Sunyaev-Zeldovich cluster sample
DEFF Research Database (Denmark)
Poutanen, T.; Natoli, P.; Polenta, G.
2011-01-01
We present the first all-sky sample of galaxy clusters detected blindly by the Planck satellite through the Sunyaev-Zeldovich (SZ) effect from its six highest frequencies. This early SZ (ESZ) sample is comprised of 189 candidates, which have a high signal-to-noise ratio ranging from 6 to 29. Its ...
Kim, Min-Jeong; Jin, Jianjun; McCarty, Will; El Akkraoui, Amal; Todling, Ricardo; Gelaro, Ron
2018-01-01
Many numerical weather prediction (NWP) centers assimilate radiances affected by clouds and precipitation from microwave sensors, with the expectation that these data can provide critical constraints on meteorological parameters in dynamically sensitive regions to make significant impacts on forecast accuracy for precipitation. The Global Modeling and Assimilation Office (GMAO) at NASA Goddard Space Flight Center assimilates all-sky microwave radiance data from various microwave sensors such as all-sky GPM Microwave Imager (GMI) radiance in the Goddard Earth Observing System (GEOS) atmospheric data assimilation system (ADAS), which includes the GEOS atmospheric model, the Gridpoint Statistical Interpolation (GSI) atmospheric analysis system, and the Goddard Aerosol Assimilation System (GAAS). So far, most of NWP centers apply same large data thinning distances, that are used in clear-sky radiance data to avoid correlated observation errors, to all-sky microwave radiance data. For example, NASA GMAO is applying 145 km thinning distances for most of satellite radiance data including microwave radiance data in which all-sky approach is implemented. Even with these coarse observation data usage in all-sky assimilation approach, noticeable positive impacts from all-sky microwave data on hurricane track forecasts were identified in GEOS-5 system. The motivation of this study is based on the dynamic thinning distance method developed in our all-sky framework to use of denser data in cloudy and precipitating regions due to relatively small spatial correlations of observation errors. To investigate the benefits of all-sky microwave radiance on hurricane forecasts, several hurricane cases selected between 2016-2017 are examined. The dynamic thinning distance method is utilized in our all-sky approach to understand the sources and mechanisms to explain the benefits of all-sky microwave radiance data from various microwave radiance sensors like Advanced Microwave Sounder Unit
GASS: THE PARKES GALACTIC ALL-SKY SURVEY. I. SURVEY DESCRIPTION, GOALS, AND INITIAL DATA RELEASE
International Nuclear Information System (INIS)
McClure-Griffiths, N. M.; Calabretta, M. R.; Ford, H. Alyson; Newton-McGee, K.
2009-01-01
The Parkes Galactic All-Sky Survey (GASS) is a survey of Galactic atomic hydrogen (H I) emission in the Southern sky covering declinations δ ≤ 1 0 using the Parkes Radio Telescope. The survey covers 2π steradians with an effective angular resolution of ∼16', at a velocity resolution of 1.0 km s -1 , and with an rms brightness temperature noise of 57 mK. GASS is the most sensitive, highest angular resolution survey of Galactic H I emission ever made in the Southern sky. In this paper, we outline the survey goals, describe the observations and data analysis, and present the first-stage data release. The data product is a single cube at full resolution, not corrected for stray radiation. Spectra from the survey and other data products are publicly available online.
All-sky photogrammetry techniques to georeference a cloud field
Crispel, Pierre; Roberts, Gregory
2018-01-01
In this study, we present a novel method of identifying and geolocalizing cloud field elements from a portable all-sky camera stereo network based on the ground and oriented towards zenith. The methodology is mainly based on stereophotogrammetry which is a 3-D reconstruction technique based on triangulation from corresponding stereo pixels in rectified images. In cases where clouds are horizontally separated, identifying individual positions is performed with segmentation techniques based on hue filtering and contour detection algorithms. Macroscopic cloud field characteristics such as cloud layer base heights and velocity fields are also deduced. In addition, the methodology is fitted to the context of measurement campaigns which impose simplicity of implementation, auto-calibration, and portability. Camera internal geometry models are achieved a priori in the laboratory and validated to ensure a certain accuracy in the peripheral parts of the all-sky image. Then, stereophotogrammetry with dense 3-D reconstruction is applied with cameras spaced 150 m apart for two validation cases. The first validation case is carried out with cumulus clouds having a cloud base height at 1500 m a.g.l. The second validation case is carried out with two cloud layers: a cumulus fractus layer with a base height at 1000 m a.g.l. and an altocumulus stratiformis layer with a base height of 2300 m a.g.l. Velocity fields at cloud base are computed by tracking image rectangular patterns through successive shots. The height uncertainty is estimated by comparison with a Vaisala CL31 ceilometer located on the site. The uncertainty on the horizontal coordinates and on the velocity field are theoretically quantified by using the experimental uncertainties of the cloud base height and camera orientation. In the first cumulus case, segmentation of the image is performed to identify individuals clouds in the cloud field and determine the horizontal positions of the cloud centers.
SPHEREx: Probing the Physics of Inflation with an All-Sky Spectroscopic Galaxy Survey
Dore, Olivier; SPHEREx Science Team
2018-01-01
SPHEREx, a mission in NASA's Medium Explorer (MIDEX) program that was selected for Phase A in August 2017, is an all-sky survey satellite designed to address all three science goals in NASA’s astrophysics division: probe the origin and destiny of our Universe; explore whether planets around other stars could harbor life; and explore the origin and evolution of galaxies. These themes are addressed by a single survey, with a single instrument.In this poster, we describe how SPHEREx can probe the physics of inflationary non-Gaussianity by measuring large-scale structure with galaxy redshifts over a large cosmological volume at low redshifts, complementing high-redshift surveys optimized to constrain dark energy.SPHEREx will be the first all-sky near-infrared spectral survey, creating a legacy archive of spectra. In particular, it will measure the redshifts of over 500 million galaxies of all types, an unprecedented dataset. Using this catalog, SPHEREx will reduce the uncertainty in fNL -- a parameter describing the inflationary initial conditions -- by a factor of more than 10 compared with CMB measurements. At the same time, this catalog will enable strong scientific synergies with Euclid, WFIRST and LSST
Observing floods from space: Experience gained from COSMO-SkyMed observations
Pierdicca, N.; Pulvirenti, L.; Chini, M.; Guerriero, L.; Candela, L.
2013-03-01
The COSMO-SkyMed mission offers a unique opportunity to obtain all weather radar images characterized by short revisit time, thus being useful for flood evolution mapping. The COSMO-SkyMed system has been activated several times in the last few years in occasion of flood events all over the world in order to provide very high resolution X-band SAR images useful for flood detection purposes. This paper discusses the major outcomes of the experience gained, within the framework of the OPERA Pilot Project funded by the Italian Space Agency, from using COSMO-SkyMed data for the purpose of near real time generation of flood maps. A review of the mechanisms which determine the imprints of the inundation on the radar images and of the fundamental simulation tools able to predict these imprints and help image interpretation is provided. The approach developed to process the data and to generate the flood maps is also summarized. Then, the paper illustrates the experience gained with COSMO-SkyMed by describing and discussing a number of significant examples. These examples demonstrate the potential of the COSMO-SkyMed system and the suitability of the approach developed for generating the final products, but they also highlight some critical aspects that require further investigations to improve the reliability of the flood maps.
Automated Meteor Detection by All-Sky Digital Camera Systems
Suk, Tomáš; Šimberová, Stanislava
2017-12-01
We have developed a set of methods to detect meteor light traces captured by all-sky CCD cameras. Operating at small automatic observatories (stations), these cameras create a network spread over a large territory. Image data coming from these stations are merged in one central node. Since a vast amount of data is collected by the stations in a single night, robotic storage and analysis are essential to processing. The proposed methodology is adapted to data from a network of automatic stations equipped with digital fish-eye cameras and includes data capturing, preparation, pre-processing, analysis, and finally recognition of objects in time sequences. In our experiments we utilized real observed data from two stations.
Yang, Yi; Moore, Anna M.; Krisciunas, Kevin; Wang, Lifan; Ashley, Michael C. B.; Fu, Jianning; Brown, Peter J.; Cui, Xiangqun; Feng, Long-Long; Gong, Xuefei; Hu, Zhongwen; Lawrence, Jon S.; Luong-Van, Daniel; Riddle, Reed L.; Shang, Zhaohui; Sims, Geoff; Storey, John W. V.; Suntzeff, Nicholas B.; Tothill, Nick; Travouillon, Tony; Yang, Huigen; Yang, Ji; Zhou, Xu; Zhu, Zhenxi
2017-07-01
The summit of the Antarctic plateau, Dome A, is proving to be an excellent site for optical, near-infrared, and terahertz astronomical observations. Gattini is a wide-field camera installed on the PLATO instrument module as part of the Chinese-led traverse to Dome A in 2009 January. We present here the measurements of sky brightness with the Gattini ultra-large field of view (90^\\circ × 90^\\circ ) in the photometric B-, V-, and R-bands; cloud cover statistics measured during the 2009 winter season; and an estimate of the sky transparency. A cumulative probability distribution indicates that the darkest 10% of the nights at Dome A have sky brightness of S B = 22.98, S V = 21.86, and S R = 21.68 mag arcsec-2. These values were obtained during the year 2009 with minimum aurora, and they are comparable to the faintest sky brightness at Maunakea and the best sites of northern Chile. Since every filter includes strong auroral lines that effectively contaminate the sky brightness measurements, for instruments working around the auroral lines, either with custom filters or with high spectral resolution instruments, these values could be easily obtained on a more routine basis. In addition, we present example light curves for bright targets to emphasize the unprecedented observational window function available from this ground-based site. These light curves will be published in a future paper.
The All-Sky Automated Survey for Supernovae (ASAS-SN) Light Curve Server v1.0
Kochanek, C. S.; Shappee, B. J.; Stanek, K. Z.; Holoien, T. W.-S.; Thompson, Todd A.; Prieto, J. L.; Dong, Subo; Shields, J. V.; Will, D.; Britt, C.; Perzanowski, D.; Pojmański, G.
2017-10-01
The All-Sky Automated Survey for Supernovae (ASAS-SN) is working toward imaging the entire visible sky every night to a depth of V˜ 17 mag. The present data covers the sky and spans ˜2-5 years with ˜100-400 epochs of observation. The data should contain some ˜1 million variable sources, and the ultimate goal is to have a database of these observations publicly accessible. We describe here a first step, a simple but unprecedented web interface https://asas-sn.osu.edu/ that provides an up to date aperture photometry light curve for any user-selected sky coordinate. The V band photometry is obtained using a two-pixel (16.″0) radius aperture and is calibrated against the APASS catalog. Because the light curves are produced in real time, this web tool is relatively slow and can only be used for small samples of objects. However, it also imposes no selection bias on the part of the ASAS-SN team, allowing the user to obtain a light curve for any point on the celestial sphere. We present the tool, describe its capabilities, limitations, and known issues, and provide a few illustrative examples.
First observations from a CCD all-sky spectrograph at Barentsburg (Spitsbergen
Directory of Open Access Journals (Sweden)
S. A. Chernouss
2008-05-01
Full Text Available A digital CCD all-sky spectrograph was made by the Polar Geophysical Institute (PGI to support IPY activity in auroral research. The device was tested at the Barentsburg observatory of PGI during the winter season of 2005–2006. The spectrograph is based on a cooled CCD and a transmission grating. The main features of this spectrograph are: a wide field of view (~180°, a wide spectral range (380–740 nm, a spectral resolution of 0.6 nm, a background level of about 100 R at 1-min exposure time. Several thousand spectra of nightglow and aurora were recorded during the observation season. It was possible to register both the strong auroral emissions, as well as weak ones. Spectra of aurora, including nitrogen and oxygen molecular and atomic emissions, as well as OH emissions of the nightglow are shown. A comparison has been conducted of auroral spectra obtained by the film all-sky spectral camera C-180-S at Spitsbergen during IGY, with spectra obtained at Barentsburg during the last winter season. The relationship between the red (630.0 nm and green (557.7 nm auroral emissions shows that the green emission is dominant near the minimum of the solar cycle activity (2005–2006. The opposite situation is observed during 1958–1959, with a maximum solar cycle activity.
Ground-based search for the brightest transiting planets with the Multi-site All-Sky CAmeRA: MASCARA
Snellen, Ignas A. G.; Stuik, Remko; Navarro, Ramon; Bettonvil, Felix; Kenworthy, Matthew; de Mooij, Ernst; Otten, Gilles; ter Horst, Rik; le Poole, Rudolf
2012-09-01
The Multi-site All-sky CAmeRA MASCARA is an instrument concept consisting of several stations across the globe, with each station containing a battery of low-cost cameras to monitor the near-entire sky at each location. Once all stations have been installed, MASCARA will be able to provide a nearly 24-hr coverage of the complete dark sky, down to magnitude 8, at sub-minute cadence. Its purpose is to find the brightest transiting exoplanet systems, expected in the V=4-8 magnitude range - currently not probed by space- or ground-based surveys. The bright/nearby transiting planet systems, which MASCARA will discover, will be the key targets for detailed planet atmosphere observations. We present studies on the initial design of a MASCARA station, including the camera housing, domes, and computer equipment, and on the photometric stability of low-cost cameras showing that a precision of 0.3-1% per hour can be readily achieved. We plan to roll out the first MASCARA station before the end of 2013. A 5-station MASCARA can within two years discover up to a dozen of the brightest transiting planet systems in the sky.
Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes
International Nuclear Information System (INIS)
Mirzoyan, R.
2000-01-01
The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV
Directory of Open Access Journals (Sweden)
Chun Yang
2016-06-01
Full Text Available A method to assimilate all-sky radiances from the Advanced Microwave Scanning Radiometer 2 (AMSR2 was developed within the Weather Research and Forecasting (WRF model's data assimilation (WRFDA system. The four essential elements are: (1 extending the community radiative transform model's (CRTM interface to include hydrometeor profiles; (2 using total water Qt as the moisture control variable; (3 using a warm-rain physics scheme for partitioning the Qt increment into individual increments of water vapour, cloud liquid water and rain; and (4 adopting a symmetric observation error model for all-sky radiance assimilation.Compared to a benchmark experiment with no AMSR2 data, the impact of assimilating clear-sky or all-sky AMSR2 radiances on the analysis and forecast of Hurricane Sandy (2012 was assessed through analysis/forecast cycling experiments using WRF and WRFDA's three-dimensional variational (3DVAR data assimilation scheme. With more cloud/precipitation-affected data being assimilated around tropical cyclone (TC core areas in the all-sky AMSR2 assimilation experiment, better analyses were obtained in terms of the TC's central sea level pressure (CSLP, warm-core structure and cloud distribution. Substantial (>20 % error reduction in track and CSLP forecasts was achieved from both clear-sky and all-sky AMSR2 assimilation experiments, and this improvement was consistent from the analysis time to 72-h forecasts. Moreover, the all-sky assimilation experiment consistently yielded better track and CSLP forecasts than the clear-sky did for all forecast lead times, due to a better analysis in the TC core areas. Positive forecast impact from assimilating AMSR2 radiances is also seen when verified against the European Center for Medium-Range Weather Forecasts (ECMWF analysis and the Stage IV precipitation analysis, with an overall larger positive impact from the all-sky assimilation experiment.
The pre-launch Planck Sky Model: a model of sky emission at submillimetre to centimetre wavelengths
Delabrouille, J.; Melin, J.-B.; Miville-Deschenes, M.-A.; Gonzalez-Nuevo, J.; Jeune, M.Le; Castex, G.; de Zotti, G.; Basak, S.; Ashdown, M.; Aumont, J.; Baccigalupi, C.; Banday, A.; Bernard, J.-P.; Bouchet, F.R.; Clements, D.L.; da Silva, A.; Dickinson, C.; Dodu, F.; Dolag, K.; Elsner, F.; Fauvet, L.; Fay, G.; Giardino, G.; Leach, S.; Lesgourgues, J.; Liguori, M.; Macias-Perez, J.F.; Massardi, M.; Matarrese, S.; Mazzotta, P.; Montier, L.; Mottet, S.; Paladini, R.; Partridge, B.; Piffaretti, R.; Prezeau, G.; Prunet, S.; Ricciardi, S.; Roman, M.; Schaefer, B.; Toffolatti, L.
2012-01-01
We present the Planck Sky Model (PSM), a parametric model for the generation of all-sky, few arcminute resolution maps of sky emission at submillimetre to centimetre wavelengths, in both intensity and polarisation. Several options are implemented to model the cosmic microwave background, Galactic diffuse emission (synchrotron, free-free, thermal and spinning dust, CO lines), Galactic H-II regions, extragalactic radio sources, dusty galaxies, and thermal and kinetic Sunyaev-Zeldovich signals from clusters of galaxies. Each component is simulated by means of educated interpolations/extrapolations of data sets available at the time of the launch of the Planck mission, complemented by state-of-the-art models of the emission. Distinctive features of the simulations are: spatially varying spectral properties of synchrotron and dust; different spectral parameters for each point source; modeling of the clustering properties of extragalactic sources and of the power spectrum of fluctuations in the cosmic infrared back...
Multiband photometry and spectroscopy of an all-sky sample of bright white dwarfs
Raddi, R.; Gentile Fusillo, N. P.; Pala, A. F.; Hermes, J. J.; Gänsicke, B. T.; Chote, P.; Hollands, M. A.; Henden, A.; Catalán, S.; Geier, S.; Koester, D.; Munari, U.; Napiwotzki, R.; Tremblay, P.-E.
2017-12-01
The upcoming NASA Transiting Exoplanet Survey Satellite (TESS) will obtain space-based uninterrupted light curves for a large sample of bright white dwarfs distributed across the entire sky, providing a very rich resource for asteroseismological studies and the search for transits from planetary debris. We have compiled an all-sky catalogue of ultraviolet, optical and infrared photometry as well as proper motions, which we propose as an essential tool for the preliminary identification and characterization of potential targets. We present data for 1864 known white dwarfs and 305 high-probability white dwarf candidates brighter than 17 mag. We describe the spectroscopic follow-up of 135 stars, of which 82 are white dwarfs and 25 are hot subdwarfs. The new confirmed stars include six pulsating white dwarf candidates (ZZ Cetis), and nine white dwarf binaries with a cool main-sequence companion. We identify one star with a spectroscopic distance of only 25 pc from the Sun. Around the time TESS is launched, we foresee that all white dwarfs in this sample will have trigonometric parallaxes measured by the ESA Gaia mission next year.
Dusty WDs in the WISE all sky survey ∩ SDSS
Energy Technology Data Exchange (ETDEWEB)
Barber, Sara D.; Kilic, Mukremin; Gianninas, A. [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W. Brooks St., Norman, OK 73019 (United States); Brown, Warren R., E-mail: barber@nhn.ou.edu [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States)
2014-05-10
A recent cross-correlation between the Sloan Digital Sky Survey (SDSS) Data Release 7 White Dwarf Catalog with the Wide-Field Infrared Survey Explorer (WISE) all-sky photometry at 3.4, 4.6, 12, and 22 μm performed by Debes et al. resulted in the discovery of 52 candidate dusty white dwarfs (WDs). However, the 6'' WISE beam allows for the possibility that many of the excesses exhibited by these WDs may be due to contamination from a nearby source. We present MMT+SAO Wide-Field InfraRed Camera J- and H-band imaging observations (0.''5-1.''5 point spread function) of 16 of these candidate dusty WDs and confirm that four have spectral energy distributions (SEDs) consistent with a dusty disk and are not accompanied by a nearby source contaminant. The remaining 12 WDs have contaminated WISE photometry and SEDs inconsistent with a dusty disk when the contaminating sources are not included in the photometry measurements. We find the frequency of disks around single WDs in the WISE ∩ SDSS sample to be 2.6%-4.1%. One of the four new dusty WDs has a mass of 1.04 M {sub ☉} (progenitor mass 5.4 M {sub ☉}) and its discovery offers the first confirmation that massive WDs (and their massive progenitor stars) host planetary systems.
DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others
2014-10-10
This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.
A new all-sky map of Galactic high-velocity clouds from the 21-cm HI4PI survey
Westmeier, Tobias
2018-02-01
High-velocity clouds (HVCs) are neutral or ionized gas clouds in the vicinity of the Milky Way that are characterized by high radial velocities inconsistent with participation in the regular rotation of the Galactic disc. Previous attempts to create a homogeneous all-sky H I map of HVCs have been hampered by a combination of poor angular resolution, limited surface brightness sensitivity and suboptimal sampling. Here, a new and improved H I map of Galactic HVCs based on the all-sky HI4PI survey is presented. The new map is fully sampled and provides significantly better angular resolution (16.2 versus 36 arcmin) and column density sensitivity (2.3 versus 3.7 × 1018 cm-2 at the native resolution) than the previously available LAB survey. The new HVC map resolves many of the major HVC complexes in the sky into an intricate network of narrow H I filaments and clumps that were not previously resolved by the LAB survey. The resulting sky coverage fraction of high-velocity H I emission above a column density level of 2 × 1018 cm-2 is approximately 15 per cent, which reduces to about 13 per cent when the Magellanic Clouds and other non-HVC emission are removed. The differential sky coverage fraction as a function of column density obeys a truncated power law with an exponent of -0.93 and a turnover point at about 5 × 1019 cm-2. H I column density and velocity maps of the HVC sky are made publicly available as FITS images for scientific use by the community.
Directory of Open Access Journals (Sweden)
Michel Eric
2015-01-01
Full Text Available CoRoT and Kepler have brought a new and deep experience in long-term photometric surveys and how to use them. This is true for exoplanets characterizing, stellar seismology and beyond for studying several other phenomena, like granulation or activity. Based on this experience, it has been possible to propose new generation projects, like TESS and PLATO, with more specific scientific objectives and more ambitious observational programs in terms of sky coverage and/or duration of the observations. In this context and as a prospective exercise, we explore here the possibility to set up an all-sky survey optimized for seismic indices measurement, providing masses, radii and evolution stages for half a million solar-type pulsators (subgiants and red giants, in our galactic neighborhood and allowing unprecedented stellar population studies.
RXTE All-Sky Monitor Localization of SGR 1627-41
Smith, D. A.; Bradt, H. V.; Levine, A. M.
1999-09-01
The fourth unambiguously identified Soft Gamma Repeater (SGR), SGR 1627--41, was discovered with the BATSE instrument on 1998 June 15 (Kouveliotou et al. 1998). Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6(deg) segment of a narrow (19('') ) annulus (Hurley et al. 1999; Woods et al. 1998). We report on two bursts from this source observed by the All-Sky Monitor (ASM) on RXTE. We use the ASM data to further constrain the source location to a 5(') long segment of the BATSE/IPN error box. The ASM/IPN error box lies within 0.3(') of the supernova remnant (SNR) G337.0--0.1. The probability that a SNR would fall so close to the error box purely by chance is ~ 5%.
The ROSAT All-Sky Survey view of the Large Magellanic Cloud (LMC)
Pietsch, W.; Denner, K.; Kahabka, P.; Pakull, M.; Schaeidt, S.
1996-01-01
During the Rosat all sky survey, centered on the Large Magellanic Cloud (LMC), 516 X-ray sources were detected. The field was covered from July 1990 to January 1991. The X-ray parameters of the sources, involving position, count rates, hardness ratios, extent, and time variability during the observations, are discussed. Identifications with objects from optical, radio and infrared wavelength allow the LMC candidates to be separated from the foreground stars and the background objects.
Imaging and mapping the impact of clouds on skyglow with all-sky photometry.
Jechow, Andreas; Kolláth, Zoltán; Ribas, Salvador J; Spoelstra, Henk; Hölker, Franz; Kyba, Christopher C M
2017-07-27
Artificial skyglow is constantly growing on a global scale, with potential ecological consequences ranging up to affecting biodiversity. To understand these consequences, worldwide mapping of skyglow for all weather conditions is urgently required. In particular, the amplification of skyglow by clouds needs to be studied, as clouds can extend the reach of skyglow into remote areas not affected by light pollution on clear nights. Here we use commercial digital single lens reflex cameras with fisheye lenses for all-sky photometry. We track the reach of skyglow from a peri-urban into a remote area on a clear and a partly cloudy night by performing transects from the Spanish town of Balaguer towards Montsec Astronomical Park. From one single all-sky image, we extract zenith luminance, horizontal and scalar illuminance. While zenith luminance reaches near-natural levels at 5 km distance from the town on the clear night, similar levels are only reached at 27 km on the partly cloudy night. Our results show the dramatic increase of the reach of skyglow even for moderate cloud coverage at this site. The powerful and easy-to-use method promises to be widely applicable for studies of ecological light pollution on a global scale also by non-specialists in photometry.
Data analysis of gravitational-wave signals from spinning neutron stars. IV. An all-sky search
International Nuclear Information System (INIS)
Astone, Pia; Borkowski, Kazimierz M.; Jaranowski, Piotr; Krolak, Andrzej
2002-01-01
We develop a set of data analysis tools for a realistic all-sky search for continuous gravitational-wave signals and we test our tools against simulated data. The aim of the paper is to prepare for an analysis of the real data from the EXPLORER bar detector; however, the methods that we present apply both to data from the resonant bar detectors that are currently in operation and the laser interferometric detectors that are in the final stages of construction and commissioning. With our techniques we shall be able to perform an all-sky coherent search of 2 days of data from the EXPLORER detector for a frequency bandwidth of 0.76 Hz in one month with 250 Mflops computing power. This search will detect all the continuous gravitational-wave signals with the dimensionless amplitude larger than 2.8x10 -23 with 99% confidence, assuming that the noise in the detector is Gaussian
Dark Sky Protection and Education - Izera Dark Sky Park
Berlicki, Arkadiusz; Kolomanski, Sylwester; Mrozek, Tomasz; Zakowicz, Grzegorz
2015-08-01
Darkness of the night sky is a natural component of our environment and should be protected against negative effects of human activities. The night darkness is necessary for balanced life of plants, animals and people. Unfortunately, development of human civilization and technology has led to the substantial increase of the night-sky brightness and to situation where nights are no more dark in many areas of the World. This phenomenon is called "light pollution" and it can be rank among such problems as chemical pollution of air, water and soil. Besides the environment, the light pollution can also affect e.g. the scientific activities of astronomers - many observatories built in the past began to be located within the glow of city lights making the night observations difficult, or even impossible.In order to protect the natural darkness of nights many so-called "dark sky parks" were established, where the darkness is preserved, similar to typical nature reserves. The role of these parks is not only conservation but also education, supporting to make society aware of how serious the problem of the light pollution is.History of the dark sky areas in Europe began on November 4, 2009 in Jizerka - a small village situated in the Izera Mountains, when Izera Dark Sky Park (IDSP) was established - it was the first transboundary dark sky park in the World. The idea of establishing that dark sky park in the Izera Mountains originated from a need to give to the society in Poland and Czech Republic the knowledge about the light pollution. Izera Dark Sky Park is a part of the astro-tourism project "Astro Izery" that combines tourist attraction of Izera Valley and astronomical education under the wonderful starry Izera sky. Besides the IDSP, the project Astro Izery consists of the set of simple astronomical instruments (gnomon, sundial), natural educational trail "Solar System Model", and astronomical events for the public. In addition, twice a year we organize a 3-4 days
All-sky search for short gravitational-wave bursts in the first Advanced LIGO run
Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Phythian-Adams, A.T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.T.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allocca, A.; Altin, P. A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, R.D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Beer, C.; Bejger, M.; Belahcene, I.; Belgin, M.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, M.J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, A.L.S.; Bock, O.; Boer, M.; Bogaert, J.G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, A.D.; Brown, D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Bustillo, J. Calderon; Callister, T. A.; Calloni, E.; Camp, J. B.; Canepa, M.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, D. S.; Charlton, P.; Chassande-Mottin, E.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y; Cheng, H. -P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Qian; Chua, A. J. K.; Chua, S. E.; Chung, E.S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Cominsky, L.; Constancio, M., Jr.; Conti, L.; Cooper, S. J.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, A.C.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, A.L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Costa, C. F. Da Silva; Dattilo, V.; Dave, I.; Davier, M.; Davies, G. S.; Davis, D.; Daw, E. J.; Day, B.; Day, R.; De, S.; Debra, D.; Debreczeni, G.; Degallaix, J.; De laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.A.; Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Diaz, M. C.; Di Fiore, L.; Giovanni, M.G.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Virgilio, A.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Alvarez, M. Dovale; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H. -B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Etienne, Z.; Etzel, T.; Evans, M.C.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.M.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Galiana, A. Fernandez; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M; Fong, H.; Forsyth, S. S.; Fournier, J. -D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garufi, F.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.P.; Glaefke, A.; Goetz, E.; Goetz, R.; Gondan, L.; Gonzalez, R.G.; Castro, J. M. Gonzalez; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Lee-Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.M.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Buffoni-Hall, R.; Hall, E. D.; Hammond, G.L.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hanson, P.J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C. -J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.A.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J. -M.; Isi, M.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jimenez-Forteza, F.; Johnson, W.; Jones, I.D.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kandhasamy, S.; Kang, G.H.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kefelian, F.; Keitel, D.; Kelley, D. B.; Kennedy, R.E.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan., S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, Whansun; Kim, W.; Kim, Y.M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Klein, B.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kraemer, H.C.; Kringel, V.; Krishnan, B.; Krolak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C.H.; Lee, K.H.; Lee, M.H.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lockerbie, N. A.; Lombardi, A. L.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Luck, H.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magana-Sandoval, F.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Marka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGrath Hoareau, C.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mendell, G.; Mendoza-Gandara, D.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, F.A.; Miller, B.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B.C.; Moore, J.C.; Moraru, D.; Gutierrez Moreno, M.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, S.D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P.G.; Mytidis, A.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nelemans, G.; Nelson, T. J. N.; Gutierrez-Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton-Howes, G.; Nguyen, T. T.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J.; Oh, S. H.; Ohme, F.; Oliver, M. B.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.S; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Castro-Perez, J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poe, M.; Poggiani, R.; Popolizio, P.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Puerner, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Rhoades, E.; Ricci, F.; Riles, K.; Rizzo, D.M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romie, J. H.; Rosinska, D.; Rowan, S.; Ruediger, A.; Ruggi, P.; Ryan, K.A.; Sachdev, P.S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J; Schmidt, P.; Schnabel, R.B.; Schofield, R. M. S.; Schoenbeck, A.; Schreiber, K.E.C.; Schuette, D.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, M.S.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Setyawati, Y.; Shaddock, D. A.; Shaffer, T. J.; Shahriar, M. S.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, António Dias da; Singer, A; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J.R.; Smith, R. J. E.; Son, E. J.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stevenson-Moore, P.; Stone, J.R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepanczyk, M. J.; Tacca, M.D.; Talukder, D.; Tanner, D. B.; Tapai, M.; Taracchini, A.; Taylor, W.R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thrane, E.; Tippens, T.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tomlinson, C.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Torya, D.; Travasso, F.; Traylor, G.; Trifiro, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tse, M.; Tso, R.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.G.; van den Brand, J. F. J.; Van Den Broeck, C.F.F.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasuth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P.J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Vicere, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, MT; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, M.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.M.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, D.R.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Worden, J.; Wright, J.L.; Wu, D.S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; Zadrozny, A.; Zangrando, L.; Zanolin, M.; Zendri, J. -P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S.J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.
2017-01-01
We present the results from an all-sky search for short-duration gravitational waves in the data of the first run of the Advanced LIGO detectors between September 2015 and January 2016. The search algorithms use minimal assumptions on the signal morphology, so they are sensitive to a wide range of
Long term variability of Cygnus X-1. V. State definitions with all sky monitors
Grinberg, V.; Hell, N.; Pottschmidt, K.; Böck, M.; Nowak, M.A.; Rodriguez, J.; Bodaghee, A.; Cadolle Bel, M.; Case, G.L.; Hanke, M.; Kühnel, M.; Markoff, S.; Pooley, G.G.; Rothschild, R.E.; Tomsick, J.A.; Wilson-Hodge, C.A.; Wilms, J.
2013-01-01
We present a scheme for determining the spectral state of the canonical black hole Cyg X-1 using data from previous and current X-ray all sky monitors (RXTE-ASM, Swift-BAT, MAXI, and Fermi-GBM). Determinations of the hard/intermediate and soft state agree to better than 10% between different
The night sky companion a yearly guide to sky-watching 2008-2009
Plotner, Tammy
2007-01-01
The Night Sky Companion is a comprehensive guide to what can be explored in the heavens on a nightly basis. Designed to appeal to readers at all skill levels, it provides a digest for sky watchers interested in all types of astronomical information.
Sky Subtraction with Fiber-Fed Spectrograph
Rodrigues, Myriam
2017-09-01
"Historically, fiber-fed spectrographs had been deemed inadequate for the observation of faint targets, mainly because of the difficulty to achieve high accuracy on the sky subtraction. The impossibility to sample the sky in the immediate vicinity of the target in fiber instruments has led to a commonly held view that a multi-object fibre spectrograph cannot achieve an accurate sky subtraction under 1% contrary to their slit counterpart. The next generation of multi-objects spectrograph at the VLT (MOONS) and the planed MOS for the E-ELT (MOSAIC) are fiber-fed instruments, and are aimed to observed targets fainter than the sky continuum level. In this talk, I will present the state-of-art on sky subtraction strategies and data reduction algorithm specifically developed for fiber-fed spectrographs. I will also present the main results of an observational campaign to better characterise the sky spatial and temporal variations ( in particular the continuum and faint sky lines)."
Retrieval of Garstang's emission function from all-sky camera images
Kocifaj, Miroslav; Solano Lamphar, Héctor Antonio; Kundracik, František
2015-10-01
The emission function from ground-based light sources predetermines the skyglow features to a large extent, while most mathematical models that are used to predict the night sky brightness require the information on this function. The radiant intensity distribution on a clear sky is experimentally determined as a function of zenith angle using the theoretical approach published only recently in MNRAS, 439, 3405-3413. We have made the experiments in two localities in Slovakia and Mexico by means of two digital single lens reflex professional cameras operating with different lenses that limit the system's field-of-view to either 180º or 167º. The purpose of using two cameras was to identify variances between two different apertures. Images are taken at different distances from an artificial light source (a city) with intention to determine the ratio of zenith radiance relative to horizontal irradiance. Subsequently, the information on the fraction of the light radiated directly into the upward hemisphere (F) is extracted. The results show that inexpensive devices can properly identify the upward emissions with adequate reliability as long as the clear sky radiance distribution is dominated by a largest ground-based light source. Highly unstable turbidity conditions can also make the parameter F difficult to find or even impossible to retrieve. The measurements at low elevation angles should be avoided due to a potentially parasitic effect of direct light emissions from luminaires surrounding the measuring site.
RELIABLE IDENTIFICATIONS OF ACTIVE GALACTIC NUCLEI FROM THE WISE, 2MASS, AND ROSAT ALL-SKY SURVEYS
Energy Technology Data Exchange (ETDEWEB)
Edelson, R. [Department of Astronomy, University of Maryland, College Park, MD 20742-2421 (United States); Malkan, M., E-mail: rickedelson@gmail.com [Department of Physics and Astronomy, University of California Los Angeles, Los Angeles, CA 90095-1547 (United States)
2012-05-20
We have developed the ''S{sub IX}'' statistic to identify bright, highly likely active galactic nucleus (AGN) candidates solely on the basis of Wide-field Infrared Survey Explorer (WISE), Two Micron All-Sky Survey (2MASS), and ROSAT all-sky survey (RASS) data. This statistic was optimized with data from the preliminary WISE survey and the Sloan Digital Sky Survey, and tested with Lick 3 m Kast spectroscopy. We find that sources with S{sub IX} < 0 have a {approx}>95% likelihood of being an AGN (defined in this paper as a Seyfert 1, quasar, or blazar). This statistic was then applied to the full WISE/2MASS/RASS dataset, including the final WISE data release, to yield the ''W2R'' sample of 4316 sources with S{sub IX} < 0. Only 2209 of these sources are currently in the Veron-Cetty and Veron (VCV) catalog of spectroscopically confirmed AGNs, indicating that the W2R sample contains nearly 2000 new, relatively bright (J {approx}< 16) AGNs. We utilize the W2R sample to quantify biases and incompleteness in the VCV catalog. We find that it is highly complete for bright (J < 14), northern AGNs, but the completeness drops below 50% for fainter, southern samples and for sources near the Galactic plane. This approach also led to the spectroscopic identification of 10 new AGNs in the Kepler field, more than doubling the number of AGNs being monitored by Kepler. The W2R sample contains better than 1 bright AGN every 10 deg{sup 2}, permitting construction of AGN samples in any sufficiently large region of sky.
The use of a sky camera for solar radiation estimation based on digital image processing
International Nuclear Information System (INIS)
Alonso-Montesinos, J.; Batlles, F.J.
2015-01-01
The necessary search for a more sustainable global future means using renewable energy sources to generate pollutant-free electricity. CSP (Concentrated solar power) and PV (photovoltaic) plants are the systems most in demand for electricity production using solar radiation as the energy source. The main factors affecting final electricity generation in these plants are, among others, atmospheric conditions; therefore, knowing whether there will be any change in the solar radiation hitting the plant's solar field is of fundamental importance to CSP and PV plant operators in adapting the plant's operation mode to these fluctuations. Consequently, the most useful technology must involve the study of atmospheric conditions. This is the case for sky cameras, an emerging technology that allows one to gather sky information with optimal spatial and temporal resolution. Hence, in this work, a solar radiation estimation using sky camera images is presented for all sky conditions, where beam, diffuse and global solar radiation components are estimated in real-time as a novel way to evaluate the solar resource from a terrestrial viewpoint. - Highlights: • Using a sky camera, the solar resource has been estimated for one minute periods. • The sky images have been processed to estimate the solar radiation at pixel level. • The three radiation components have been estimated under all sky conditions. • Results have been presented for cloudless, partially-cloudy and overcast conditions. • For beam and global radiation, the nRMSE value is of about 11% under overcast skies.
Pipkin, Ashley; Duriscoe, Dan M.; Lughinbuhl, Christian
2017-01-01
Artificial light at night, when observed at some distance from a city, results in a dome of sky glow, brightest at the horizon. The spectral power distribution of electric light utilized will determine its color of the light dome and the amount of light will determine its brightness. Recent outdoor lighting technologies have included blue-rich light emitting diode (LED) sources that may increase the relative amount of blue to green light in sky glow compared to typical high pressure sodium (HPS) sources with warmer spectra. Measuring and monitoring this effect is important to the preservation of night sky visual quality as seen from undeveloped areas outside the city, such as parks or other protected areas, since the dark-adapted human eye is more sensitive to blue and green. We present a method using a wide field CCD camera which images the entire sky in both Johnson V and B photometric bands. Standard stars within the images are used for calibration. The resulting all-sky brightness maps, and a derived B-V color index map, provide a means to assess and track the impact of specific outdoor lighting practices. We also present example data from several cities, including Las Vegas, Nevada, Flagstaff, Arizona, and Cheyenne, Wyoming.
International Nuclear Information System (INIS)
Turner, Monica L.; Rutledge, Robert E.; Letcavage, Ryan; Shevchuk, Andrew S. H.; Fox, Derek B.
2010-01-01
Using new and archival observations made with the Swift satellite and other facilities, we examine 147 X-ray sources selected from the ROSAT All-Sky-Survey Bright Source Catalog (RASS/BSC) to produce a new limit on the number of isolated neutron stars (INSs) in the RASS/BSC, the most constraining such limit to date. Independent of X-ray spectrum and variability, the number of INSs is ≤48 (90% confidence). Restricting attention to soft (kT eff < 200 eV), non-variable X-ray sources-as in a previous study-yields an all-sky limit of ≤31 INSs. In the course of our analysis, we identify five new high-quality INS candidates for targeted follow-up observations. A future all-sky X-ray survey with eROSITA, or another mission with similar capabilities, can be expected to increase the detected population of X-ray-discovered INSs from the 8-50 in the BSC, to (for a disk population) 240-1500, which will enable a more detailed study of neutron star population models.
Sky camera imagery processing based on a sky classification using radiometric data
International Nuclear Information System (INIS)
Alonso, J.; Batlles, F.J.; López, G.; Ternero, A.
2014-01-01
As part of the development and expansion of CSP (concentrated solar power) technology, one of the most important operational requirements is to have complete control of all factors which may affect the quantity and quality of the solar power produced. New developments and tools in this field are focused on weather forecasting improving both operational security and electricity production. Such is the case with sky cameras, devices which are currently in use in some CSP plants and whose use is expanding in the new technology sector. Their application is mainly focused on cloud detection, estimating their movement as well as their influence on solar radiation attenuation indeed, the presence of clouds is the greatest factor involved in solar radiation attenuation. The aim of this work is the detection and analysis of clouds from images taken by a TSI-880 model sky. In order to obtain accurate image processing, three different models were created, based on a previous sky classification using radiometric data and representative sky conditions parameters. As a consequence, the sky can be classified as cloudless, partially-cloudy or overcast, delivering an average success rate of 92% in sky classification and cloud detection. - Highlights: • We developed a methodology for detection of clouds in total sky imagery (TSI-880). • A classification of sky is presented according to radiometric data and sky parameters. • The sky can be classified as cloudless, partially cloudy and overcast. • The images processing is based on the sky classification for the detection of clouds. • The average success of the developed model is around 92%
SCANDI – an all-sky Doppler imager for studies of thermospheric spatial structure
Directory of Open Access Journals (Sweden)
A. L. Aruliah
2010-02-01
Full Text Available A new all-sky Fabry-Perot Interferometer called the Scanning Doppler Imager (SCANDI was built and installed at Longyearbyen in December 2006. Observations have been made of the Doppler shifts and Doppler broadening of the 630 nm airglow and aurora, from which upper thermospheric winds and temperatures are calculated. SCANDI allows measurements over a field-of-view (FOV with a horizontal radius of nearly 600 km for observations at an altitude of 250 km using a time resolution of 8 min. The instrument provides the ability to observe thermospheric spatial structure within a FOV which overlaps that of the EISCAT Svalbard radar and CUTLASS SuperDARN radars. Coordinating with these instruments provides an important opportunity for studying ion-neutral coupling. The all-sky image is divided into several sectors to provide a horizontal spatial resolution of between 100–300 km. This is a powerful extension in observational capability but requires careful calibration and data analysis, as described here. Two observation modes were used: a fixed and a scanning etalon gap. SCANDI results are corroborated using the Longyearbyen single look direction FPI, and ESR measurements of the ion temperatures. The data show thermospheric temperature gradients of a few Kelvins per kilometre, and a great deal of meso-scale variability on spatial scales of several tens of kilometres.
Dark Skies are a Universal Resource. So are Quiet Skies!
Maddalena, Ronald J.; Heatherly, S.
2008-05-01
You've just purchased your first telescope. But where to set it up? Certainly not a WalMart parking lot. Too much light pollution! In the same way that man-made light obscures our night sky and blinds ground-based optical telescopes, man-made radio signals blind radio telescopes as well. NRAO developed the Quiet Skies project to increase awareness of radio frequency interference (RFI) and radio astronomy in general by engaging students in local studies of RFI. To do that we created a sensitive detector which measures RFI. We produced 20 of these, and assembled kits containing detectors and supplementary materials for loan to schools. Students conduct experiments to measure the properties of RFI in their area, and input their measurements into a web-based data base. The Quiet Skies project is a perfect complement to the IYA Dark Skies Awareness initiative. We hope to place 500 Quiet Skies detectors into the field through outreach to museums and schools around the world. Should we be successful, we will sustain this global initiative via a continuing loan program. One day we hope to have a publicly generated image of the Earth which shows RFI much as the Earth at Night image illustrates light pollution. The poster will present the components of the project in detail, including our plans for IYA, and various low-cost alternative strategies for introducing RFI and radio astronomy to the public. We will share the results of some of the experiments already being performed by high school students. Development of the Quiet Skies project was funded by a NASA IDEAS grant. The National Radio Astronomy Observatory is a facility of the National Science Foundation, operated under cooperative agreement by Associated Universities, Inc.
Review of all-sky camera data for the period Sep. 1 to Dec. 1, 1976
International Nuclear Information System (INIS)
1978-02-01
The auroral and cloud conditions are presented in the form of a numerical code, in coordinate tables, the coordinates representing the date and universal time respectively. The compilation is intended to be a guide to available all-sky camera films, copies of which are supplied at self-cost prices by the Auroral Observatory. (JIW)
Infrared Sky Imager (IRSI) Instrument Handbook
Energy Technology Data Exchange (ETDEWEB)
Morris, Victor R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-04-01
The Infrared Sky Imager (IRSI) deployed at the Atmospheric Radiation Measurement (ARM) Climate Research Facility is a Solmirus Corp. All Sky Infrared Visible Analyzer. The IRSI is an automatic, continuously operating, digital imaging and software system designed to capture hemispheric sky images and provide time series retrievals of fractional sky cover during both the day and night. The instrument provides diurnal, radiometrically calibrated sky imagery in the mid-infrared atmospheric window and imagery in the visible wavelengths for cloud retrievals during daylight hours. The software automatically identifies cloudy and clear regions at user-defined intervals and calculates fractional sky cover, providing a real-time display of sky conditions.
Current Status of The Low Frequency All Sky Monitor
Dartez, Louis; Creighton, Teviet; Jenet, Fredrick; Dolch, Timothy; Boehler, Keith; Bres, Luis; Cole, Brent; Luo, Jing; Miller, Rossina; Murray, James; Reyes, Alex; Rivera, Jesse
2018-01-01
The Low Frequency All Sky Monitor (LoFASM) is a distributed array of cross-dipole antennas that are sensitive to radio frequencies from 10 to 88 MHz. LoFASM consists of antennas and front end electronics that were originally developed for the Long Wavelength Array by the U.S. Naval Research Lab, the University of New Mexico, Virginia Tech, and the Jet Propulsion Laboratory. LoFASM, funded by the U.S. Department of Defense, will initially consist of 4 stations, each consisting of 12 dual- polarization dipole antenna stands. The primary science goals of LoFASM will be the detection and study of low-frequency radio transients, a high priority science goal as deemed by the National Research Council’s ASTRO2010 decadal survey. The data acquisition system for the LoFASM antenna array uses Field Programmable Gate Array (FPGA) technology to implement a real time full Stokes spectrometer and data recorder. This poster presents an overview of the LoFASM Radio Telescope as well as the status of data analysis of initial commissioning observations.
Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allen, G.; Allocca, A.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bawaj, M.; Bazzan, M.; Becsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Bustillo, J. Calderon; Callister, T. A.; Calloni, E.; Camp, J. B.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chatterjee, D.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H. -P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M., Jr.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Costa, C. F. Da Silva; Dattilo, V.; Dave, I.; Davier, M.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Deelman, E.; Degallaix, J.; De Laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Diaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Alvarez, M. Dovale; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Duncan, J.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H. -B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Etienne, Z. B.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J. -D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gabel, M.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garufi, F.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; Gonzalez, G.; Castro, J. M. Gonzalez; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C. -J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J. -M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jimenez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kefelian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, W.; Kim, W. S.; Kim, Y. -M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kraemer, C.; Kringel, V.; Krishnan, B.; Krolak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lo, R. K. L.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Lueck, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Hernandez, I. Magana; Magana-Sandoval, F.; Zertuche, L. Magana; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Marka, Z.; Markakis, C.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mayani, R.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Ng, K. K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Puerrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Ramirez, K. E.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosinska, D.; Ross, M. P.; Rowan, S.; Ruediger, A.; Ruggi, P.; Ryan, K.; Rynge, M.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schoenbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, R. J. E.; Smith, R. J. E.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepanczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tapai, M.; Taracchini, A.; Taylor, J. A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Toyra, D.; Travasso, F.; Traylor, G.; Trifiro, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahi, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasuth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Vicere, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, M.; Wang, Y. -F.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, K. W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; Zadrozny, A.; Zanolin, M.; Zelenova, T.; Zendri, J. -P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y. -H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S. J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; Anderson, D. P.
2017-01-01
We report results of a deep all-sky search for periodic gravitational waves from isolated neutron stars in data from the first Advanced LIGO observing run. This search investigates the low frequency range of Advanced LIGO data, between 20 and 100 Hz, much of which was not explored in initial LIGO.
Predicting daylight illuminance on inclined surfaces using sky luminance data
Energy Technology Data Exchange (ETDEWEB)
Li, D.H.W.; Lau, C.C.S.; Lam, J.C. [City University of Hong Kong, Kowloon (China). Dept. of Building and Construction
2005-07-01
Daylight illuminance, particularly on vertical surfaces, plays a major role in determining and evaluating the daylighting performance of a building. In many parts of the world, however, the basic daylight illuminance data for various vertical planes are not always readily available. The usual method to obtain diffuse illuminance on tilted planes would be based on inclined surface models using data from the horizontal measurements. Alternatively, the diffuse illuminance on a sloping plane can be computed by integrating the luminance distribution of the sky 'seen' by the plane. This paper presents an approach to estimate the vertical outdoor illuminance from sky luminance data and solar geometry. Sky luminance data recorded from January 1999 to December 2001 in Hong Kong and generated by two well-known sky luminance models (Kittler and Perez) were used to compute the outdoor illuminance for the four principal vertical planes (N, E, S and W). The performance of this approach was evaluated against data measured in the same period. Statistical analysis indicated that using sky luminance distributions to predict outdoor illuminance can give reasonably good agreement with measured data for all vertical surfaces. The findings provide an accurate alternative to determine the amount of daylight on vertical as well as other inclined surfaces when sky luminance data are available. (author)
Planck early results. XXIII. The first all-sky survey of Galactic cold clumps
DEFF Research Database (Denmark)
Poutanen, T.; Natoli, P.; Polenta, G.
2011-01-01
We present the statistical properties of the Cold Clump Catalogue of Planck Objects (C3PO), the first all-sky catalogue of cold objects, in terms of their spatial distribution, dust temperature, distance, mass, and morphology. We have combined Planck and IRAS data to extract 10342 cold sources...... dark clouds where the latter have been catalogued. These cold clumps are not isolated but clustered in groups. Dust temperature and emissivity spectral index values are derived from their spectral energy distributions using both Planck and IRAS data. The temperatures range from 7K to 19K...
A catalogue of clusters of galaxies identified from all sky surveys of 2MASS, WISE, and SuperCOSMOS
Wen, Z. L.; Han, J. L.; Yang, F.
2018-03-01
We identify 47 600 clusters of galaxies from photometric data of Two Micron All Sky Survey (2MASS), Wide-field Infrared Survey Explorer (WISE), and SuperCOSMOS, among which 26 125 clusters are recognized for the first time and mostly in the sky outside the Sloan Digital Sky Survey (SDSS) area. About 90 per cent of massive clusters of M500 > 3 × 1014 M⊙ in the redshift range of 0.025 < z < 0.3 have been detected from such survey data, and the detection rate drops down to 50 per cent for clusters with a mass of M500 ˜ 1 × 1014 M⊙. Monte Carlo simulations show that the false detection rate for the whole cluster sample is less than 5 per cent. By cross-matching with ROSAT and XMM-Newton sources, we get 779 new X-ray cluster candidates which have X-ray counterparts within a projected offset of 0.2 Mpc.
Equatorial All Sky Imager Images from the Seychelles during the March 17th, 2015 geomagnetic storm.
Curtis, B.
2015-12-01
An all sky imager was installed in the Seychelles earlier this year. The Seychelles islands are located northeast of Madagascar and east of Somalia in the equatorial Indian Ocean. The all sky imager is located on the island of Mahe (4.6667°S, 55.4667°E geographic), (10.55°S, 127.07°E geomagnetic), with filters of 557.7, 620.0, 630.0, 765.0 and 777.4 nm. Images with a 90 second exposure from Seychelles in 777.4nm and 630.0nm from the night before and night of the March 17th geomagnetic storm are discussed in comparison to solar wind measurements at ACE and the disturbance storm time (Dst) index. These images show line-of-sight intensities of photons received dependent on each filters wavelength. A time series of these images sometimes will show the movement of relatively dark areas, or depletions, in each emission. The depletion regions are known to cause scintillation in GPS signals. The direction and speed of movement of these depletions are related to changes observed in the solar wind.
Ackermann, M.; Ajello, M.; Albert, A.; Allafort, A.; Antolini, E.; Baldini, L.; Ballet, J.; Barbiellini, G; Bastieri, D.; Bechtol, K.;
2013-01-01
In this paper, we present the Fermi All-sky Variability Analysis (FAVA), a tool to systematically study the variability of the gamma-ray sky measured by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope.For each direction on the sky, FAVA compares the number of gamma-rays observed in a given time window to the number of gamma-rays expected for the average emission detected from that direction. This method is used in weekly time intervals to derive a list of 215 flaring gamma-ray sources. We proceed to discuss the 27 sources found at Galactic latitudes smaller than 10 and show that, despite their low latitudes, most of them are likely of extragalactic origin.
Kim, S.; Kim, H.; Choi, M.; Kim, K.
2016-12-01
Estimating spatiotemporal variation of soil moisture is crucial to hydrological applications such as flood, drought, and near real-time climate forecasting. Recent advances in space-based passive microwave measurements allow the frequent monitoring of the surface soil moisture at a global scale and downscaling approaches have been applied to improve the spatial resolution of passive microwave products available at local scale applications. However, most downscaling methods using optical and thermal dataset, are valid only in cloud-free conditions; thus renewed downscaling method under all sky condition is necessary for the establishment of spatiotemporal continuity of datasets at fine resolution. In present study Support Vector Machine (SVM) technique was utilized to downscale a satellite-based soil moisture retrievals. The 0.1 and 0.25-degree resolution of daily Land Parameter Retrieval Model (LPRM) L3 soil moisture datasets from Advanced Microwave Scanning Radiometer 2 (AMSR2) were disaggregated over Northeast Asia in 2015. Optically derived estimates of surface temperature (LST), normalized difference vegetation index (NDVI), and its cloud products were obtained from MODerate Resolution Imaging Spectroradiometer (MODIS) for the purpose of downscaling soil moisture in finer resolution under all sky condition. Furthermore, a comparison analysis between in situ and downscaled soil moisture products was also conducted for quantitatively assessing its accuracy. Results showed that downscaled soil moisture under all sky condition not only preserves the quality of AMSR2 LPRM soil moisture at 1km resolution, but also attains higher spatial data coverage. From this research we expect that time continuous monitoring of soil moisture at fine scale regardless of weather conditions would be available.
Improved analysis of all-sky meteor radar measurements of gravity wave variances and momentum fluxes
Directory of Open Access Journals (Sweden)
V. F. Andrioli
2013-05-01
Full Text Available The advantages of using a composite day analysis for all-sky interferometric meteor radars when measuring mean winds and tides are widely known. On the other hand, problems arise if this technique is applied to Hocking's (2005 gravity wave analysis for all-sky meteor radars. In this paper we describe how a simple change in the procedure makes it possible to use a composite day in Hocking's analysis. Also, we explain how a modified composite day can be constructed to test its ability to measure gravity wave momentum fluxes. Test results for specified mean, tidal, and gravity wave fields, including tidal amplitudes and gravity wave momentum fluxes varying strongly with altitude and/or time, suggest that the modified composite day allows characterization of monthly mean profiles of the gravity wave momentum fluxes, with good accuracy at least at the altitudes where the meteor counts are large (from 89 to 92.5 km. In the present work we also show that the variances measured with Hocking's method are often contaminated by the tidal fields and suggest a method of empirical correction derived from a simple simulation model. The results presented here greatly increase our confidence because they show that our technique is able to remove the tide-induced false variances from Hocking's analysis.
Search for neutrino point sources with an all-sky autocorrelation analysis in IceCube
Energy Technology Data Exchange (ETDEWEB)
Turcati, Andrea; Bernhard, Anna; Coenders, Stefan [TU, Munich (Germany); Collaboration: IceCube-Collaboration
2016-07-01
The IceCube Neutrino Observatory is a cubic kilometre scale neutrino telescope located in the Antarctic ice. Its full-sky field of view gives unique opportunities to study the neutrino emission from the Galactic and extragalactic sky. Recently, IceCube found the first signal of astrophysical neutrinos with energies up to the PeV scale, but the origin of these particles still remains unresolved. Given the observed flux, the absence of observations of bright point-sources is explainable with the presence of numerous weak sources. This scenario can be tested using autocorrelation methods. We present here the sensitivities and discovery potentials of a two-point angular correlation analysis performed on seven years of IceCube data, taken between 2008 and 2015. The test is applied on the northern and southern skies separately, using the neutrino energy information to improve the effectiveness of the method.
Gendler, Robert; Malin, David
2011-01-01
In these pages, the reader can follow the engaging saga of astronomical exploration in the southern hemisphere, in a modern merger of aesthetics, science, and a story of human endeavor. This book is truly a celebration of southern skies. Jerry Bonnell, Editor - Astronomy Picture of the Day The southern sky became accessible to scientific scrutiny only a few centuries ago, after the first European explorers ventured south of the equator. Modern observing and imaging techniques have since revealed what seems like a new Universe, previously hidden below the horizon, a fresh astronomical bounty of beauty and knowledge uniquely different from the northern sky. The authors have crafted a book that brings this hidden Universe to all, regardless of location or latitude. Treasures of the Southern Sky celebrates the remarkable beauty and richness of the southern sky in words and with world-class imagery. In part, a photographic anthology of deep sky wonders south of the celestial equator, this book also celebrates th...
Lomb, Nick
2013-01-01
Compact, easy to use and reliable, this popular guide contains everything you need to know about the southern night sky with monthly astronomy maps, viewing tips and highlights, and details of all the year's exciting celestial events. Wherever you are in Australia or New Zealand, easy calculations allow you to estimate local rise and set times for the Sun, Moon and planets. The 2014 Australasian Sky Guide also provides information on the solar system, updated with the latest findings from space probes. Published annually since 1991, the Sky Guide continues to be a favourite with photographers,
Energy Technology Data Exchange (ETDEWEB)
Ackermann, M. [Deutsches Elektronen Synchrotron DESY, D-15738 Zeuthen (Germany); Ajello, M. [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720-7450 (United States); Albert, A. [Department of Physics, Center for Cosmology and Astro-Particle Physics, The Ohio State University, Columbus, OH 43210 (United States); Allafort, A.; Bechtol, K.; Blandford, R. D.; Bloom, E. D.; Bottacini, E. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Antolini, E.; Bonamente, E. [Dipartimento di Fisica, Universita degli Studi di Perugia, I-06123 Perugia (Italy); Baldini, L. [Universita di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Universite Paris Diderot, Service d' Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Bastieri, D. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Bellazzini, R.; Bregeon, J. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bouvier, A. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Brandt, T. J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Brigida, M. [Dipartimento di Fisica ' ' M. Merlin' ' dell' Universita e del Politecnico di Bari, I-70126 Bari (Italy); Bruel, P., E-mail: majello@slac.stanford.edu, E-mail: allafort@stanford.edu, E-mail: rolf.buehler@desy.de [Laboratoire Leprince-Ringuet, Ecole polytechnique, CNRS/IN2P3, Palaiseau (France); and others
2013-07-01
In this paper, we present the Fermi All-sky Variability Analysis (FAVA), a tool to systematically study the variability of the gamma-ray sky measured by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. For each direction on the sky, FAVA compares the number of gamma-rays observed in a given time window to the number of gamma-rays expected for the average emission detected from that direction. This method is used in weekly time intervals to derive a list of 215 flaring gamma-ray sources. We proceed to discuss the 27 sources found at Galactic latitudes smaller than 10 Degree-Sign and show that, despite their low latitudes, most of them are likely of extragalactic origin.
International Nuclear Information System (INIS)
Ackermann, M.; Ajello, M.; Albert, A.; Allafort, A.; Bechtol, K.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Antolini, E.; Bonamente, E.; Baldini, L.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bellazzini, R.; Bregeon, J.; Bouvier, A.; Brandt, T. J.; Brigida, M.; Bruel, P.
2013-01-01
In this paper, we present the Fermi All-sky Variability Analysis (FAVA), a tool to systematically study the variability of the gamma-ray sky measured by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. For each direction on the sky, FAVA compares the number of gamma-rays observed in a given time window to the number of gamma-rays expected for the average emission detected from that direction. This method is used in weekly time intervals to derive a list of 215 flaring gamma-ray sources. We proceed to discuss the 27 sources found at Galactic latitudes smaller than 10° and show that, despite their low latitudes, most of them are likely of extragalactic origin.
Observation of the Coma cluster of galaxies with ROSAT during the all-sky survey
Briel, U. G.; Henry, J. P.; Boehringer, H.
1992-01-01
The Coma cluster of galaxies was observed with the position sensitive proportional counter (PSPC) during the ROSAT all sky survey. We find evidence for substructure in this cluster. Diffuse X-ray emission is detected from the regions of the NGC 4839 and 4911 subgroups at 6 percent and 1 percent of the total cluster emission respectively. There may be emission associated with the NGC 4874 and 4889 subgroups as well. The NGC 4839 group appears to be in the process of merging with the cluster. These X-ray data show that at least some of the groups previously found in projection are in fact physical objects possessing potential wells deep enough to trap their own X-ray gas. Because of the unlimited field of view of the all sky survey and the low background of the PSPC, we were able to measure the azimuthally averaged surface brightness of Coma out to approximately 100 arcmin, twice as far as was previously possible. Given the validity of our mass models, these new X-ray data imply that within 5/h(50) Mpc the binding mass of the Coma cluster is 1.8 +/- 0.6 x 10 exp 15/h(50) solar mass, and the fraction of cluster mass contained in hot gas is 0.30 +/- 0.14h(50) exp -3/2. Furthermore, the binding mass is more centrally concentrated than is the X-ray gas.
Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.
Energy Technology Data Exchange (ETDEWEB)
Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)
2010-07-01
The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.
First all-sky search for continuous gravitational waves from unknown sources in binary systems
Aasi, J.; Abbott, B.; Abbott, R.; Abbott, T.; Abernathy, M.; Accadia, T.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R.; Affeldt, C.; Agathos, M.; Aggarwal, N.
2014-01-01
We present the first results of an all-sky search for continuous gravitational waves from unknown spinning neutron stars in binary systems using LIGO and Virgo data. Using a specially developed analysis program, the TwoSpect algorithm, the search was carried out on data from the sixth LIGO Science Run and the second and third Virgo Science Runs. The search covers a range of frequencies from 20 Hz to 520 Hz, a range of orbital periods from 2 to ~2,254 h and a frequency- and period-dependent ra...
Predicting Downward Longwave Radiation for Various Land Use in All-Sky Condition: Northeast Florida
Directory of Open Access Journals (Sweden)
Chi-Han Cheng
2014-01-01
Full Text Available Accurate estimate of the surface longwave radiation is important for the surface radiation budget, which in turn controls evaporation and sensible heat fluxes. Regional land use changes can impact local weather conditions; for example, heterogeneous land use patterns and temporal changes in atmospheric circulation patterns would affect air temperature and water vapor pressure, which are more commonly used as inputs in existing models for estimating downward longwave radiation (LWd. In this study, first, we analyzed the cloud cover and land use covers impacts on LWd. Next, LWd on all-sky conditions were developed by using the existing land use-adapted model and cloud cover data from the region of Saint Johns River Water Management District (SJRWMD, FL. The results show that factors, such as, seasonal effects, cloud cover, and land use, are of importance in the estimation of LWd and they cannot be ignored when developing a model for LWd prediction. The all-sky land use-adapted model with all factors taken into account performs better than other existing models statistically. The results of the statistical analyses indicated that the BIAS, RMSE, MAE, and PMRE are −0.18 Wm−2, 10.81 Wm−2, 8.00 Wm−2, and 2.30%; −2.61 Wm−2, 14.45 Wm−2, 10.64 Wm−2, and 3.19%; −0.07 Wm−2, 10.53 Wm−2, 8.03 Wm−2, and 2.27%; and −0.62 Wm−2, 13.97 Wm−2, 9.76 Wm−2, and 2.87% for urban, rangeland, agricultural, and wetland areas, respectively.
Energy Technology Data Exchange (ETDEWEB)
Agueros, Marcel A.; Anderson, Scott F.; /Washington U., Seattle, Astron. Dept.; Margon, Bruce; /Baltimore, Space Telescope Sci.; Haberl, Frank; Voges, Wolfgang; /Garching,; Annis, James; /Fermilab; Schneider, Donald P.; /Penn State U., Astron. Astrophys.; Brinkmann, Jonathan; /Apache Point Observ.
2005-11-01
Only seven radio-quiet isolated neutron stars (INSs) emitting thermal X rays are known, a sample that has yet to definitively address such fundamental issues as the equation of state of degenerate neutron matter. We describe a selection algorithm based on a cross-correlation of the ROSAT All-Sky Survey (RASS) and the Sloan Digital Sky Survey (SDSS) that identifies X-ray error circles devoid of plausible optical counterparts to the SDSS g {approx} 22 magnitudes limit. We quantitatively characterize these error circles as optically blank; they may host INSs or other similarly exotic X-ray sources such as radio-quiet BL Lacs, obscured AGN, etc. Our search is an order of magnitude more selective than previous searches for optically blank RASS error circles, and excludes the 99.9% of error circles that contain more common X-ray-emitting subclasses. We find 11 candidates, nine of which are new. While our search is designed to find the best INS candidates and not to produce a complete list of INSs in the RASS, it is reassuring that our number of candidates is consistent with predictions from INS population models. Further X-ray observations will obtain pinpoint positions and determine whether these sources are entirely optically blank at g {approx} 22, supporting the presence of likely isolated neutron stars and perhaps enabling detailed follow-up studies of neutron star physics.
Inferences of all-sky solar irradiance using Terra and Aqua MODIS satellite data
DEFF Research Database (Denmark)
Houborg, Rasmus Møller; Søgaard, Henrik; Emmerich, W.
2007-01-01
-sky solar irradiance components, which links a physically based clear-sky model with a neural network version of a rigorous radiative transfer model. The scheme exploits the improved cloud characterization and retrieval capabilities of the MODerate resolution Imaging Spectroradiometer (MODIS) onboard...... contrasting climates and cloud environments. Information on the atmospheric state was provided by MODIS data products and verifications against AErosol RObotic NETwork (AERONET) data demonstrated usefulness of MODIS aerosol optical depth and total precipitable water vapour retrievals for the delineation...... and become unusable above approximately 60° latitude. However, in principle, the scheme can be applied anywhere on the globe, and a synergistic use of MODIS and geostationary satellite datasets may be envisaged for some applications....
VLITE Surveys the Sky: A 340 MHz Companion to the VLA Sky Survey (VLASS)
Peters, Wendy; Clarke, Tracy; Brisken, Walter; Cotton, William; Richards, Emily E.; Giacintucci, Simona; Kassim, Namir
2018-01-01
The VLA Low Band Ionosphere and Transient Experiment (VLITE; ) is a commensal observing system on the Karl G. Janksy Very Large Array (VLA) which was developed by the Naval Research Laboratory and NRAO. A 64 MHz sub-band from the prime focus 240-470 MHz dipoles is correlated during nearly all regular VLA observations. VLITE uses dedicated samplers and fibers, as well as a custom designed, real-time DiFX software correlator, and requires no additional resources from the VLA system running the primary science program. The experiment has been operating since November 2014 with 10 antennas; a recent expansion in summer 2017 increased that number to 16 and more than doubled the number of baselines.The VLA Sky Survey (VLASS; ), is an ongoing survey of the entire sky visible to the VLA at a frequency of 2-4 GHz. The observations are made using an "on-the-fly" (OTF) continuous RA scanning technique which fills in the sky by observing along rows of constant declination. VLITE breaks the data into 2-second integrations and correlates these at a central position every 1.5 degrees. All data for each correlator position is imaged separately, corrected and weighted by an appropriately elongated primary beam model, and then combined in the image plane to create a mosaic of the sky. A catalog of the sources is extracted to provide a 340 MHz sky model.We present preliminary images and catalogs from the 2017 VLASS observations which began in early September, 2017, and continued on a nearly daily basis throughout the fall. In addition to providing a unique sky model at 340 MHz, these data complement VLASS by providing spectral indices for all cataloged sources.
Directory of Open Access Journals (Sweden)
André Luiz Bortoliero
2006-04-01
Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari
International Nuclear Information System (INIS)
Abbott, B.; Adhikari, R.; Agresti, J.; Anderson, S.B.; Araya, M.; Armandula, H.; Asiri, F.; Barish, B.C.; Barnes, M.; Barton, M.A.; Bhawal, B.; Billingsley, G.; Black, E.; Blackburn, K.; Bork, R.; Brown, D.A.; Busby, D.; Cardenas, L.; Chandler, A.; Chapsky, J.
2005-01-01
We perform a wide parameter-space search for continuous gravitational waves over the whole sky and over a large range of values of the frequency and the first spin-down parameter. Our search method is based on the Hough transform, which is a semicoherent, computationally efficient, and robust pattern recognition technique. We apply this technique to data from the second science run of the LIGO detectors and our final results are all-sky upper limits on the strength of gravitational waves emitted by unknown isolated spinning neutron stars on a set of narrow frequency bands in the range 200-400 Hz. The best upper limit on the gravitational-wave strain amplitude that we obtain in this frequency range is 4.43x10 -23
National Oceanic and Atmospheric Administration, Department of Commerce — The AVHRR Clear-Sky Processor over Oceans, jointly developed between NESDIS STAR and OSDPD, produces AVHRR clear-sky products over oceans. ACSPO generates output...
Sky cover from MFRSR observations
Directory of Open Access Journals (Sweden)
E. Kassianov
2011-07-01
Full Text Available The diffuse all-sky surface irradiances measured at two nearby wavelengths in the visible spectral range and their modeled clear-sky counterparts are the main components of a new method for estimating the fractional sky cover of different cloud types, including cumuli. The performance of this method is illustrated using 1-min resolution data from a ground-based Multi-Filter Rotating Shadowband Radiometer (MFRSR. The MFRSR data are collected at the US Department of Energy Atmospheric Radiation Measurement (ARM Climate Research Facility (ACRF Southern Great Plains (SGP site during the summer of 2007 and represent 13 days with cumuli. Good agreement is obtained between estimated values of the fractional sky cover and those provided by a well-established independent method based on broadband observations.
SkyNet: Modular nuclear reaction network library
Lippuner, Jonas; Roberts, Luke F.
2017-10-01
The general-purpose nuclear reaction network SkyNet evolves the abundances of nuclear species under the influence of nuclear reactions. SkyNet can be used to compute the nucleosynthesis evolution in all astrophysical scenarios where nucleosynthesis occurs. Any list of isotopes can be evolved and SkyNet supports various different types of nuclear reactions. SkyNet is modular, permitting new or existing physics, such as nuclear reactions or equations of state, to be easily added or modified.
Day, B. H.; Bland, P.
2016-12-01
Fireballs in the Sky is an innovative Australian citizen science program that connects the public with the research of the Desert Fireball Network (DFN). This research aims to understand the early workings of the solar system, and Fireballs in the Sky invites people around the world to learn about this science, contributing fireball sightings via a user-friendly app. To date, more than 23,000 people have downloaded the app world-wide and participated in planetary science. The Fireballs in the Sky app allows users to get involved with the Desert Fireball Network research, supplementing DFN observations and providing enhanced coverage by reporting their own meteor sightings to DFN scientists. Fireballs in the Sky reports are used to track the trajectories of meteors - from their orbit in space to where they might have landed on Earth. Led by Phil Bland at Curtin University in Australia, the Desert Fireball Network (DFN) uses automated observatories across Australia to triangulate trajectories of meteorites entering the atmosphere, determine pre-entry orbits, and pinpoint their fall positions. Each observatory is an autonomous intelligent imaging system, taking 1000×36Megapixel all-sky images throughout the night, using neural network algorithms to recognize events. They are capable of operating for 12 months in a harsh environment, and store all imagery collected. We developed a completely automated software pipeline for data reduction, and built a supercomputer database for storage, allowing us to process our entire archive. The DFN currently stands at 50 stations distributed across the Australian continent, covering an area of 2.5 million km^2. Working with DFN's partners at NASA's Solar System Exploration Research Virtual Institute, the team is expanding the network beyond Australia to locations around the world. Fireballs in the Sky allows a growing public base to learn about and participate in this exciting research.
DEFF Research Database (Denmark)
Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.
2014-01-01
We have constructed the first all-sky map of the thermal Sunyaev-Zeldovich (tSZ) effect by applying specifically tailored component separation algorithms to the 100 to 857 GHz frequency channel maps from the Planck survey. This map shows an obvious galaxy cluster tSZ signal that is well matched w...
International Nuclear Information System (INIS)
Fuessling, Matthias
2012-01-01
This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.
PROBING THE DARK AGES AT z ∼ 20: THE SCI-HI 21 cm ALL-SKY SPECTRUM EXPERIMENT
Energy Technology Data Exchange (ETDEWEB)
Voytek, Tabitha C.; Natarajan, Aravind; Peterson, Jeffrey B. [McWilliams Center for Cosmology, Department of Physics, Carnegie Mellon University, 5000 Forbes Ave., Pittsburgh, PA 15213 (United States); Jáuregui García, José Miguel; López-Cruz, Omar, E-mail: tcv@andrew.cmu.edu [Instituto Nacional de Astrofísica, Optica y Electrónica (INAOE), Coordinación de Astrofísica, Luis Enrique Erro No. 1 Sta. Ma. Tonantzintla, Puebla, 72840 Mexico (Mexico)
2014-02-10
We present first results from the SCI-HI experiment, which we used to measure the all-sky-averaged 21 cm brightness temperature in the redshift range 14.8 < z < 22.7. The instrument consists of a single broadband sub-wavelength size antenna and a sampling system for real-time data processing and recording. Preliminary observations were completed in 2013 June at Isla Guadalupe, a Mexican biosphere reserve located in the Pacific Ocean. The data was cleaned to excise channels contaminated by radio frequency interference, and the system response was calibrated by comparing the measured brightness temperature to the Global Sky Model of the Galaxy and by independent measurement of Johnson noise from a calibration terminator. We present our results, discuss the cosmological implications, and describe plans for future work.
Blue Sky Funders Forum - Advancing Environmental Literacy through Funder Collaboration
Chen, A.
2015-12-01
The Blue Sky Funders Forum inspires, deepens, and expands private funding and philanthropic leadership to promote learning opportunities that connect people and nature and promote environmental literacy. Being prepared for the future requires all of us to understand the consequences of how we live on where we live - the connection between people and nature. Learning about the true meaning of that connection is a process that starts in early childhood and lasts a lifetime. Blue Sky brings supporters of this work together to learn from one another and to strategize how to scale up the impact of the effective programs that transform how people interact with their surroundings. By making these essential learning opportunities more accessible in all communities, we broaden and strengthen the constituency that makes well-informed choices, balancing the needs of today with the needs of future generations.
SPIDERS: selection of spectroscopic targets using AGN candidates detected in all-sky X-ray surveys
Dwelly, T.; Salvato, M.; Merloni, A.; Brusa, M.; Buchner, J.; Anderson, S. F.; Boller, Th.; Brandt, W. N.; Budavári, T.; Clerc, N.; Coffey, D.; Del Moro, A.; Georgakakis, A.; Green, P. J.; Jin, C.; Menzel, M.-L.; Myers, A. D.; Nandra, K.; Nichol, R. C.; Ridl, J.; Schwope, A. D.; Simm, T.
2017-07-01
SPIDERS (SPectroscopic IDentification of eROSITA Sources) is a Sloan Digital Sky Survey IV (SDSS-IV) survey running in parallel to the Extended Baryon Oscillation Spectroscopic Survey (eBOSS) cosmology project. SPIDERS will obtain optical spectroscopy for large numbers of X-ray-selected active galactic nuclei (AGN) and galaxy cluster members detected in wide-area eROSITA, XMM-Newton and ROSAT surveys. We describe the methods used to choose spectroscopic targets for two sub-programmes of SPIDERS X-ray selected AGN candidates detected in the ROSAT All Sky and the XMM-Newton Slew surveys. We have exploited a Bayesian cross-matching algorithm, guided by priors based on mid-IR colour-magnitude information from the Wide-field Infrared Survey Explorer survey, to select the most probable optical counterpart to each X-ray detection. We empirically demonstrate the high fidelity of our counterpart selection method using a reference sample of bright well-localized X-ray sources collated from XMM-Newton, Chandra and Swift-XRT serendipitous catalogues, and also by examining blank-sky locations. We describe the down-selection steps which resulted in the final set of SPIDERS-AGN targets put forward for spectroscopy within the eBOSS/TDSS/SPIDERS survey, and present catalogues of these targets. We also present catalogues of ˜12 000 ROSAT and ˜1500 XMM-Newton Slew survey sources that have existing optical spectroscopy from SDSS-DR12, including the results of our visual inspections. On completion of the SPIDERS programme, we expect to have collected homogeneous spectroscopic redshift information over a footprint of ˜7500 deg2 for >85 per cent of the ROSAT and XMM-Newton Slew survey sources having optical counterparts in the magnitude range 17 < r < 22.5, producing a large and highly complete sample of bright X-ray-selected AGN suitable for statistical studies of AGN evolution and clustering.
2009-01-01
Ecole de physique - Département de physique nucléaire et corspusculaire 24, Quai Ernest-Ansermet 1211 GENEVE 4 Tél: (022) 379 62 73 - Fax: (022) 379 69 92 Wednesday 25 February 2009 PARTICLE PHYSICS SEMINAR at 17:00 – Stückelberg Auditorium Physics insights from recent HESS AGN observations by Dr. Francesca Volpe, Max-Planck-Institute for Nuclear Physics, Heidelberg The extragalactic sources are still the most powerful, variable and brightest objects in the VHE gamma-ray sky. The improved sensitivity of the new generation of ground-based instruments have increased the VHE emitting population, providing information about cosmology and giving new clues about particle acceleration mechanisms at play in active galactic nuclei. Emphasis will be put on the contribution of the H.E.S.S. experiment to the temporal variability of extragalactic gamma-ray sources, including an update on the most recent detections and on the giant flares from PKS 2155-304. Information : http://dpnc.unige.ch/seminaire/annonce.htmlOr...
2009-01-01
École de physique - Département de physique nucléaire et corspusculaire 24, quai Ernest-Ansermet 1211 GENÈVE 4 Tél: (022) 379 62 73 - Fax: (022) 379 69 92 Wednesday 25 February 2009 PARTICLE PHYSICS SEMINAR at 17:00 – Stückelberg Auditorium Physics insights from recent HESS AGN observations by Dr. Francesca Volpe / Max-Planck-Institute for Nuclear Physics, Heidelberg The extragalactic sources are still the most powerful, variable and brightest objects in the VHE gamma-ray sky. The improved sensitivity of the new generation of ground-based instruments have increased the VHE emitting population, providing information about cosmology and giving new clues about particle acceleration mechanisms at play in active galactic nuclei. Emphasis will be put on the contribution of the H.E.S.S. experiment to the temporal variability of extragalactic gamma-ray sources, including an update on the most recent detections and on the giant flares from PKS 2155-304. Information: http://d...
Salvato, M.; Buchner, J.; Budavári, T.; Dwelly, T.; Merloni, A.; Brusa, M.; Rau, A.; Fotopoulou, S.; Nandra, K.
2018-02-01
We release the AllWISE counterparts and Gaia matches to 106 573 and 17 665 X-ray sources detected in the ROSAT 2RXS and XMMSL2 surveys with |b| > 15°. These are the brightest X-ray sources in the sky, but their position uncertainties and the sparse multi-wavelength coverage until now rendered the identification of their counterparts a demanding task with uncertain results. New all-sky multi-wavelength surveys of sufficient depth, like AllWISE and Gaia, and a new Bayesian statistics based algorithm, NWAY, allow us, for the first time, to provide reliable counterpart associations. NWAY extends previous distance and sky density based association methods and, using one or more priors (e.g. colours, magnitudes), weights the probability that sources from two or more catalogues are simultaneously associated on the basis of their observable characteristics. Here, counterparts have been determined using a Wide-field Infrared Survey Explorer (WISE) colour-magnitude prior. A reference sample of 4524 XMM/Chandra and Swift X-ray sources demonstrates a reliability of ∼94.7 per cent (2RXS) and 97.4 per cent (XMMSL2). Combining our results with Chandra-COSMOS data, we propose a new separation between stars and AGN in the X-ray/WISE flux-magnitude plane, valid over six orders of magnitude. We also release the NWAY code and its user manual. NWAY was extensively tested with XMM-COSMOS data. Using two different sets of priors, we find an agreement of 96 per cent and 99 per cent with published Likelihood Ratio methods. Our results were achieved faster and without any follow-up visual inspection. With the advent of deep and wide area surveys in X-rays (e.g. SRG/eROSITA, Athena/WFI) and radio (ASKAP/EMU, LOFAR, APERTIF, etc.) NWAY will provide a powerful and reliable counterpart identification tool.
Albert, A.; André, M.; Anghinolfi, M.; Anton, G.; Ardid, M.; Aubert, J.-J.; Avgitas, T.; Baret, B.; Barrios-Martí, J.; Basa, S.; Belhorma, B.; Bertin, V.; Biagi, S.; Bormuth, R.; Bourret, S.; Bouwhuis, M.C.; Brânzas, H.; Bruijn, R.; Brunner, J.; Busto, J.; Capone, A.; Caramete, L.; Carr, J.; Celli, S.; Cherkaoui El Moursli, R.; Chiarusi, T.; Circella, M.; Coelho, J.A.B.; Coleiro, A.; Coniglione, R.; Costantini, H.; Coyle, P.; Creusot, A.; Díaz, A.F.; Deschamps, A.; De Bonis, G.; Distefano, C.; Di Palma, I.; Domi, A.; Donzaud, C.; Dornic, D.; Drouhin, D.; Eberl, T.; El Bojaddaini, I.; El Khayati, N.; Elsässer, D.; Enzenhöfer, A.; Ettahiri, A.; Fassi, F.; Felis, I.; Fusco, L.A.; Gay, P.; Giordano, V.; Glotin, H.; Grégoire, T.; Gracia-Ruiz, R.; Graf, K.; Hallmann, S.; van Haren, H.; Heijboer, A.J.; Hello, Y.; Hernandez-Rey, J.J.; Hößl, J.; Hofestädt, J.; Hugon, C.; Illuminati, G.; James, C.W.; de Jong, M.; Jongen, M.; Kadler, M.; Kalekin, O.; Katz, U.; Kießling, D.; Kouchner, A.; Kreter, M.; Kreykenbohm, I.; Kulikovskiy, V.; Lachaud, C.; Lahmann, R.; Lefèvre, D.; Leonora, E.; Lotze, M.; Loucatos, S.; Marcelin, M.; Margiotta, A.; Marinelli, A.; Martínez-Mora, J.A.; Mele, R.; Melis, K.; Michael, T.; Migliozzi, P.; Moussa, A.; Navas, S.; Nezri, E.; Organokov, M.; Pavalas, G.E.; Pellegrino, C.; Perrina, C.; Piattelli, P.; Popa, V.; Pradier, T.; Quinn, L.; Racca, C.; Riccobene, G.; Sánchez-Losa, A.; Saldaña, M.; Salvadori, I.; Samtleben, D.F.E.; Sanguineti, M.; Sapienza, P.; Schüssler, F.; Sieger, C.; Spurio, M.; Stolarczyk, Th.; Taiuti, M.; Tayalati, Y.; Trovato, A.; Turpin, D.; Tönnis, C.; Vallage, B.; Van Elewyck, V.; Versari, F.; Vivolo, D.; Vizzoca, A.; Wilms, J.; Zornoza, J.D.; Zúñiga, J.
2017-01-01
Advanced LIGO detected a significant gravitational wave signal (GW170104) originating from the coalescence of two black holes during the second observation run on January 4th, 2017. An all-sky high-energy neutrino follow-up search has been made using data from the Antares neutrino telescope,
Rossi X-Ray Timing Explorer All-Sky Monitor Localization of SGR 1627-41
Smith, Donald A.; Bradt, Hale V.; Levine, Alan M.
1999-07-01
The fourth unambiguously identified soft gamma repeater (SGR), SGR 1627-41, was discovered with the BATSE instrument on 1998 June 15. Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6° segment of a narrow (19") annulus. We present two bursts from this source observed by the All-Sky Monitor (ASM) on the Rossi X-Ray Timing Explorer. We use the ASM data to further constrain the source location to a 5' long segment of the BATSE/IPN error box. The ASM/IPN error box lies within 0.3 arcmin of the supernova remnant G337.0-0.1. The probability that a supernova remnant would fall so close to the error box purely by chance is ~5%.
International Nuclear Information System (INIS)
Min, Min; Zhang, Zhibo
2014-01-01
The objective of this study is to understand how cloud fraction diurnal cycle and sub-grid cloud optical thickness variability influence the all-sky direct aerosol radiative forcing (DARF). We focus on the southeast Atlantic region where transported smoke is often observed above low-level water clouds during burning seasons. We use the CALIOP observations to derive the optical properties of aerosols. We developed two diurnal cloud fraction variation models. One is based on sinusoidal fitting of MODIS observations from Terra and Aqua satellites. The other is based on high-temporal frequency diurnal cloud fraction observations from SEVIRI on board of geostationary satellite. Both models indicate a strong cloud fraction diurnal cycle over the southeast Atlantic region. Sensitivity studies indicate that using a constant cloud fraction corresponding to Aqua local equatorial crossing time (1:30 PM) generally leads to an underestimated (less positive) diurnal mean DARF even if solar diurnal variation is considered. Using cloud fraction corresponding to Terra local equatorial crossing time (10:30 AM) generally leads overestimation. The biases are a typically around 10–20%, but up to more than 50%. The influence of sub-grid cloud optical thickness variability on DARF is studied utilizing the cloud optical thickness histogram available in MODIS Level-3 daily data. Similar to previous studies, we found the above-cloud smoke in the southeast Atlantic region has a strong warming effect at the top of the atmosphere. However, because of the plane-parallel albedo bias the warming effect of above-cloud smoke could be significantly overestimated if the grid-mean, instead of the full histogram, of cloud optical thickness is used in the computation. This bias generally increases with increasing above-cloud aerosol optical thickness and sub-grid cloud optical thickness inhomogeneity. Our results suggest that the cloud diurnal cycle and sub-grid cloud variability are important factors
Viewing Formal Mathematics from Yoruba Conception of the Sky
Segla, Aimé
2016-01-01
Yoruba Cosmology resembles a generative system at the foundation of concepts. The traditional thought, which derives from the reality of the identical pair incorporated from cosmology into real life, exemplifies all kind of existing knowledge, culture and practices. Previous studies by the author show in some detail the scientific interests in Yoruba cosmology. The present paper aims to view formal mathematics through the interpretation of Yoruba sky knowledge. It attempts to demonstrate tha...
Redemann, J.; Livingston, J.; Shinozuka, Y.; Kacenelenbogen, M.; Russell, P.; LeBlanc, S.; Vaughan, M.; Ferrare, R.; Hostetler, C.; Rogers, R.;
2014-01-01
We have developed a technique for combining CALIOP aerosol backscatter, MODIS spectral AOD (aerosol optical depth), and OMI AAOD (absorption aerosol optical depth) retrievals for the purpose of estimating full spectral sets of aerosol radiative properties, and ultimately for calculating the 3-D distribution of direct aerosol radiative forcing. We present results using one year of data collected in 2007 and show comparisons of the aerosol radiative property estimates to collocated AERONET retrievals. Use of the recently released MODIS Collection 6 data for aerosol optical depths derived with the dark target and deep blue algorithms has extended the coverage of the multi-sensor estimates towards higher latitudes. We compare the spatio-temporal distribution of our multi-sensor aerosol retrievals and calculations of seasonal clear-sky aerosol radiative forcing based on the aerosol retrievals to values derived from four models that participated in the latest AeroCom model intercomparison initiative. We find significant inter-model differences, in particular for the aerosol single scattering albedo, which can be evaluated using the multi-sensor A-Train retrievals. We discuss the major challenges that exist in extending our clear-sky results to all-sky conditions. On the basis of comparisons to suborbital measurements, we present some of the limitations of the MODIS and CALIOP retrievals in the presence of adjacent or underlying clouds. Strategies for meeting these challenges are discussed.
Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S.
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
The diffuse very high-energy (VHE; >100 GeV) γ-ray emission observed in the central 200 pc of the Milky Way by H.E.S.S. was found to follow dense matter distribution in the central molecular zone (CMZ) up to a longitudinal distance of about 130 pc to the Galactic centre (GC), where the flux rapidly decreases. This was initially interpreted as the result of a burst-like injection of energetic particles 104 yr ago, but a recent more sensitive H.E.S.S. analysis revealed that the cosmic-ray (CR) density profile drops with the distance to the centre, making data compatible with a steady cosmic PeVatron at the GC. In this paper, we extend this analysis to obtain, for the first time, a detailed characterisation of the correlation with matter and to search for additional features and individual γ-ray sources in the inner 200 pc. Taking advantage of 250 h of H.E.S.S. data and improved analysis techniques, we perform a detailed morphology study of the diffuse VHE emission observed from the GC ridge and reconstruct its total spectrum. To test the various contributions to the total γ-ray emission, we used an iterative 2D maximum-likelihood approach that allows us to build a phenomenological model of the emission by summing a number of different spatial components. We show that the emission correlated with dense matter covers the full CMZ and that its flux is about half the total diffuse emission flux. We also detect some emission at higher latitude that is likely produced by hadronic collisions of CRs in less dense regions of the GC interstellar medium. We detect an additional emission component centred on the GC and extending over about 15 pc that is consistent with the existence of a strong CR density gradient and confirms the presence of a CR accelerator at the very centre of our Galaxy. We show that the spectrum of full ridge diffuse emission is compatible with that previously derived from the central regions, suggesting that a single population of particles fills the
Meteor Shower Forecast Improvements from a Survey of All-Sky Network Observations
Moorhead, Althea V.; Sugar, Glenn; Brown, Peter G.; Cooke, William J.
2015-01-01
Meteoroid impacts are capable of damaging spacecraft and potentially ending missions. In order to help spacecraft programs mitigate these risks, NASA's Meteoroid Environment Office (MEO) monitors and predicts meteoroid activity. Temporal variations in near-Earth space are described by the MEO's annual meteor shower forecast, which is based on both past shower activity and model predictions. The MEO and the University of Western Ontario operate sister networks of all-sky meteor cameras. These networks have been in operation for more than 7 years and have computed more than 20,000 meteor orbits. Using these data, we conduct a survey of meteor shower activity in the "fireball" size regime using DBSCAN. For each shower detected in our survey, we compute the date of peak activity and characterize the growth and decay of the shower's activity before and after the peak. These parameters are then incorporated into the annual forecast for an improved treatment of annual activity.
The History of the CONCAM Project: All Sky Monitors in the Digital Age
Nemiroff, Robert; Shamir, Lior; Pereira, Wellesley
2018-01-01
The CONtinuous CAMera (CONCAM) project, which ran from 2000 to (about) 2008, consisted of real-time, Internet-connected, fisheye cameras located at major astronomical observatories. At its peak, eleven CONCAMs around the globe monitored most of the night sky, most of the time. Initially designed to search for transients and stellar variability, CONCAMs gained initial notoriety as cloud monitors. As such, CONCAMs made -- and its successors continue to make -- ground-based astronomy more efficient. The original, compact, fisheye-observatory-in-a-suitcase design underwent several iterations, starting with CONCAM0 and with the last version dubbed CONCAM3. Although the CONCAM project itself concluded after centralized funding diminished, today more locally-operated, commercially-designed, CONCAM-like devices operate than ever before. It has even been shown that modern smartphones can operate in a CONCAM-like mode. It is speculated that the re-instatement of better global coordination of current wide-angle sky monitors could lead to better variability monitoring of the brightest stars and transients.
SkyNet: A Modular Nuclear Reaction Network Library
Lippuner, Jonas; Roberts, Luke F.
2017-12-01
Almost all of the elements heavier than hydrogen that are present in our solar system were produced by nuclear burning processes either in the early universe or at some point in the life cycle of stars. In all of these environments, there are dozens to thousands of nuclear species that interact with each other to produce successively heavier elements. In this paper, we present SkyNet, a new general-purpose nuclear reaction network that evolves the abundances of nuclear species under the influence of nuclear reactions. SkyNet can be used to compute the nucleosynthesis evolution in all astrophysical scenarios where nucleosynthesis occurs. SkyNet is free and open source, and aims to be easy to use and flexible. Any list of isotopes can be evolved, and SkyNet supports different types of nuclear reactions. SkyNet is modular so that new or existing physics, like nuclear reactions or equations of state, can easily be added or modified. Here, we present in detail the physics implemented in SkyNet with a focus on a self-consistent transition to and from nuclear statistical equilibrium to non-equilibrium nuclear burning, our implementation of electron screening, and coupling of the network to an equation of state. We also present comprehensive code tests and comparisons with existing nuclear reaction networks. We find that SkyNet agrees with published results and other codes to an accuracy of a few percent. Discrepancies, where they exist, can be traced to differences in the physics implementations.
The taxonomic distribution of asteroids from multi-filter all-sky photometric surveys
DeMeo, F. E.; Carry, B.
2013-09-01
The distribution of asteroids across the main belt has been studied for decades to understand the current compositional distribution and what that tells us about the formation and evolution of our Solar System. All-sky surveys now provide orders of magnitude more data than targeted surveys. We present a method to bias-correct the asteroid population observed in the Sloan Digital Sky Survey (SDSS) according to size, distance, and albedo. We taxonomically classify this dataset consistent with the Bus and Binzel (Bus, S.J., Binzel, R.P. [2002]. Icarus 158, 146-177) and Bus-DeMeo et al. (DeMeo, F.E., Binzel, R.P., Slivan, S.M., Bus, S.J. [2009]. Icarus 202(July), 160-180) systems and present the resulting taxonomic distribution. The dataset includes asteroids as small as 5 km, a factor of three in diameter smaller than in previous work such as by Mothé-Diniz et al. (Mothé-Diniz, T., Carvano, J.M.Á., Lazzaro, D. [2003]. Icarus 162(March), 10-21). Because of the wide range of sizes in our sample, we present the distribution by number, surface area, volume, and mass whereas previous work was exclusively by number. While the distribution by number is a useful quantity and has been used for decades, these additional quantities provide new insights into the distribution of total material. We find evidence for D-types in the inner main belt where they are unexpected according to dynamical models of implantation of bodies from the outer Solar System into the inner Solar System during planetary migration (Levison, H.F., Bottke, W.F., Gounelle, M., Morbidelli, A., Nesvorný, D., Tsiganis, K. [2009]. Nature 460(July), 364-366). We find no evidence of S-types or other unexpected classes among Trojans and Hildas, albeit a bias favoring such a detection. Finally, we estimate for the first time the total amount of material of each class in the inner Solar System. The main belt’s most massive classes are C, B, P, V and S in decreasing order. Excluding the four most massive
The NexStar evolution and SkyPortal user's guide
Chen, James L
2016-01-01
This book serves as a comprehensive guide for using a Nexstar Evolution mount with WiFi SkyPortal control, walking the reader through the process for aligning and operating the system from a tablet or smartphone. The next generation Go-To mount from Celestron, this is compatible not only with the Nextstar Evolution but also with older mounts. It is the ideal resource for anyone who owns, or is thinking of owning, a Nexstar Evolution telescope, or adapting their existing Celestron mount. Pros and cons of the system are thoroughly covered with a critical depth that addresses any possible question by users. Beginning with a brief history of Go-To telescopes and the genesis of this still new technology, the author covers every aspect of the newly expanding capability in observing. This includes the associated Sky Portal smartphone and tablet application, the transition from the original Nexstar GoTo system to the new SkyPortal system, the use of the Sky Portal application with its Sky Safari 4 basic software and ...
Multifrequency observations of KAZ 102 during the ROSAT all-sky survey
Treves, A.; Fink, H. H.; Malkan, M.; Wilkes, B. J.; Baganoff, F.; Heidt, J.; Pian, E.; Sadun, A.; Schaeidt, S.; Bonnell, J. T.
1995-01-01
The bright quasar Kaz 102, which lies in the vicinity of the North Ecliptic Pole, was monitored during the ROSAT All Sky Survey for 121.5 days from 1990 July 30 to 1991 January 25. In the course of the survey, optical photometry with various filters was peformed at several epochs, together with UV (IUE) and optical spectrophotometry. The spectral energy distribution in the 3 x 10(exp 14) -3 x 10(exp 17) Hz range is obtained simultaneously among the various frequencies to less than or = 1 day. No clear case of variability can be made in the X-rays, while in the optical and UV variability of 10%-20% is apparent. An analysis of IUE and Einstein archives indicates a doubling timescale of years for the UV and soft X-ray flux. The X-ray photon index, which in 1979 was rather flat (Gamma = 0.8(+0.6 -0.4), in 1990/1991 was found to be Gamma = 2.22 +/- 0.13, a typical value for radio-quiet quasars in this energy range. The overall energy distribution and the variability are discussed.
Lopez-Coto, Ruben
2015-07-01
The history of astronomy is as ancient as the reach of our written records. All the human civilizations have been interested in the study and interpretation of the night sky and its objects and phenomena. These observations were performed with the naked eye until the beginning of the 17th century, when Galileo Galilei started to use an instrument recently developed called telescope. Since then, the range of accessible wavelengths has been increasing, with a burst in the 20th century with the developing of instruments to observe them: antennas (radio and submillimeter), telescopes (optical, IR) and satellites (UV, X-rays and soft gamma rays). The last wavelength range accessed was the Very-High-Energy (VHE) gamma rays. At this range fluxes are so low that it is not possible to use space-based instruments with typical collection areas of O(1) m2. We must resort to the imaging atmospheric Cherenkov technique, which is based on the detection of the flashes of Cherenkov light that VHE gamma rays produce when they interact with the Earth's atmosphere. The field is very young, with the first source discovered in 1989 by the pioneering Whipple telescope. It is very dynamic with more than 150 sources detected to date, most of them by MAGIC, HESS and VERITAS, that make up the current generation of instruments. Finally, the field is also very promising, with the preparation of a next generation of imaging atmospheric Cherenkov telescopes: CTA, that is expected to start full operation in 2020. The work presented in this thesis comprises my efforts to take the ground-based γ-ray astronomy one step forward. Part I of the thesis is an introduction to the non- thermal universe, the imaging atmospheric Cherenkov technique and the Imaging Atmospheric Cherenkov Telescopes (IACTs) MAGIC and CTA. Part II deals with several ways to reduce the trigger threshold of IACTs. This includes the simula- tion, characterization and test of an analog trigger especially designed to achieve the
Lomb, Nick
2012-01-01
Compact, easy to use and reliable, this popular guide contains everything you need to know about the southern night sky with monthly star maps, diagrams and details of all the year's exciting celestial events. Wherever you are in Australia or New Zealand, easy calculations allow you to determine when the Sun, Moon and planets will rise and set throughout the year. Also included is information on the latest astronomical findings from space probes and telescopes around the world. The Sky guide has been published annually by the Powerhouse Museum, Sydney, since 1991. It is recommended for photogr
Night sky luminance under clear sky conditions: Theory vs. experiment
International Nuclear Information System (INIS)
Kocifaj, Miroslav
2014-01-01
Sky glow is caused by both natural phenomena and factors of anthropogenic origin, and of the latter ground-based light sources are the most important contributors for they emit the spatially linked spectral radiant intensity distribution of artificial light sources, which are further modulated by local atmospheric optics and perceived as the diffuse light of a night sky. In other words, sky glow is closely related to a city's shape and pattern of luminaire distribution, in practical effect an almost arbitrary deployment of random orientation of heterogeneous electrical light sources. Thus the luminance gradation function measured in a suburban zone or near the edges of a city is linked to the City Pattern or vice versa. It is shown that clear sky luminance/radiance data recorded in an urban area can be used to retrieve the bulk luminous/radiant intensity distribution if some a-priori information on atmospheric aerosols is available. For instance, the single scattering albedo of aerosol particles is required under low turbidity conditions, as demonstrated on a targeted experiment in the city of Frýdek-Mistek. One of the main advantages of the retrieval method presented in this paper is that the single scattering approximation is satisfactorily accurate in characterizing the light field near the ground because the dominant contribution to the sky glow has originated from beams propagated along short optical paths. - Highlights: • Urban sky glow is interpreted in terms of city emission function. • Luminance function in a suburban zone is linked to the City Pattern. • Single scattering approximation is applicable in modeling urban sky glow. • Information on aerosols represents valuable inputs to the retrieval procedure. • Sky glow patterns vary with light source distribution and spectral emission
Price, Stephan D.
2009-02-01
A retrospective is given on infrared sky surveys from Thomas Edison’s proposal in the late 1870s to IRAS, the first sensitive mid- to far-infrared all-sky survey, and the mid-1990s experiments that filled in the IRAS deficiencies. The emerging technology for space-based surveys is highlighted, as is the prominent role the US Defense Department, particularly the Air Force, played in developing and applying detector and cryogenic sensor advances to early mid-infrared probe-rocket and satellite-based surveys. This technology was transitioned to the infrared astronomical community in relatively short order and was essential to the success of IRAS, COBE and ISO. Mention is made of several of the little known early observational programs that were superseded by more successful efforts.
Testing an inversion method for estimating electron energy fluxes from all-sky camera images
Directory of Open Access Journals (Sweden)
N. Partamies
2004-06-01
Full Text Available An inversion method for reconstructing the precipitating electron energy flux from a set of multi-wavelength digital all-sky camera (ASC images has recently been developed by tomografia. Preliminary tests suggested that the inversion is able to reconstruct the position and energy characteristics of the aurora with reasonable accuracy. This study carries out a thorough testing of the method and a few improvements for its emission physics equations. We compared the precipitating electron energy fluxes as estimated by the inversion method to the energy flux data recorded by the Defense Meteorological Satellite Program (DMSP satellites during four passes over auroral structures. When the aurorae appear very close to the local zenith, the fluxes inverted from the blue (427.8nm filtered ASC images or blue and green line (557.7nm images together give the best agreement with the measured flux values. The fluxes inverted from green line images alone are clearly larger than the measured ones. Closer to the horizon the quality of the inversion results from blue images deteriorate to the level of the ones from green images. In addition to the satellite data, the precipitating electron energy fluxes were estimated from the electron density measurements by the EISCAT Svalbard Radar (ESR. These energy flux values were compared to the ones of the inversion method applied to over 100 ASC images recorded at the nearby ASC station in Longyearbyen. The energy fluxes deduced from these two types of data are in general of the same order of magnitude. In 35% of all of the blue and green image inversions the relative errors were less than 50% and in 90% of the blue and green image inversions less than 100%. This kind of systematic testing of the inversion method is the first step toward using all-sky camera images in the way in which global UV images have recently been used to estimate the energy fluxes. The advantages of ASCs, compared to the space-born imagers, are
Calendar Activities NOAO-S EPO Programs CADIAS Astro Chile Hugo E. Schwarz Telescope Dark Sky Education â¹âº You are here CTIO Home » Outreach » NOAO-S EPO Programs » Dark Sky Education Dark Sky Education Dark Sky Education (in progress) Is an EPO Program. It runs Globe at Night, an annual program to
The Python Sky Model: software for simulating the Galactic microwave sky
Thorne, B.; Dunkley, J.; Alonso, D.; Næss, S.
2017-08-01
We present a numerical code to simulate maps of Galactic emission in intensity and polarization at microwave frequencies, aiding in the design of cosmic microwave background experiments. This python code builds on existing efforts to simulate the sky by providing an easy-to-use interface and is based on publicly available data from the WMAP (Wilkinson Microwave Anisotropy Probe) and Planck satellite missions. We simulate synchrotron, thermal dust, free-free and anomalous microwave emission over the whole sky, in addition to the cosmic microwave background, and include a set of alternative prescriptions for the frequency dependence of each component, for example, polarized dust with multiple temperatures and a decorrelation of the signals with frequency, which introduce complexity that is consistent with current data. We also present a new prescription for adding small-scale realizations of these components at resolutions greater than current all-sky measurements. The usefulness of the code is demonstrated by forecasting the impact of varying foreground complexity on the recovered tensor-to-scalar ratio for the LiteBIRD satellite. The code is available at: https://github.com/bthorne93/PySM_public.
Modelling and Display of the Ultraviolet Sky
Daniels, J.; Henry, R.; Murthy, J.; Allen, M.; McGlynn, T. A.; Scollick, K.
1994-12-01
A computer program is currently under development to model in 3D - one dimension of which is wavelength - all the known and major speculated sources of ultraviolet (900 A - 3100 A ) radiation over the celestial sphere. The software is being written in Fortran 77 and IDL and currently operates under IRIX (the operating system of the Silicon Graphics Iris Machine); all output models are in FITS format. Models along with display software will become available to the astronomical community. The Ultraviolet Sky Model currently includes the Zodiacal Light, Point Sources of Emission, and the Diffuse Galactic Light. The Ultraviolet Sky Model is currently displayed using SkyView: a package under development at NASA/ GSFC, which allows users to retrieve and display publically available all-sky astronomical survey data (covering many wavebands) over the Internet. We present a demonstration of the SkyView display of the Ultraviolet Model. The modelling is a five year development project: the work illustrated here represents product output at the end of year one. Future work includes enhancements to the current models and incorporation of the following models: Galactic Molecular Hydrogen Fluorescence; Galactic Highly Ionized Atomic Line Emission; Integrated Extragalactic Light; and speculated sources in the intergalactic medium such as Ionized Plasma and radiation from Non-Baryonic Particle Decay. We also present a poster which summarizes the components of the Ultraviolet Sky Model and outlines a further package that will be used to display the Ultraviolet Model. This work is supported by United States Air Force Contract F19628-93-K-0004. Dr J. Daniels is supported with a post-doctoral Fellowship from the Leverhulme Foundation, London, United Kingdom. We are also grateful for the encouragement of Dr Stephen Price (Phillips Laboratory, Hanscomb Air Force Base, MA)
Li, M.; Yu, T.; Chunliang, X.; Zuo, X.; Liu, Z.
2017-12-01
A new method for estimating the equatorial plasma bubbles (EPBs) motions from airglow emission all-sky images is presented in this paper. This method, which is called 'cloud-derived wind technology' and widely used in satellite observation of wind, could reasonable derive zonal and meridional velocity vectors of EPBs drifts by tracking a series of successive airglow 630.0 nm emission images. Airglow emission images data are available from an all sky airglow camera in Hainan Fuke (19.5°N, 109.2°E) supported by China Meridional Project, which can receive the 630.0nm emission from the ionosphere F region at low-latitudes to observe plasma bubbles. A series of pretreatment technology, e.g. image enhancement, orientation correction, image projection are utilized to preprocess the raw observation. Then the regions of plasma bubble extracted from the images are divided into several small tracing windows and each tracing window can find a target window in the searching area in following image, which is considered as the position tracing window moved to. According to this, velocities in each window are calculated by using the technology of cloud-derived wind. When applying the cloud-derived wind technology, the maximum correlation coefficient (MCC) and the histogram of gradient (HOG) methods to find the target window, which mean to find the maximum correlation and the minimum euclidean distance between two gradient histograms in respectively, are investigated and compared in detail. The maximum correlation method is fianlly adopted in this study to analyze the velocity of plasma bubbles because of its better performance than HOG. All-sky images from Hainan Fuke, between August 2014 and October 2014, are analyzed to investigate the plasma bubble drift velocities using MCC method. The data at different local time at 9 nights are studied and find that zonal drift velocity in different latitude at different local time ranges from 50 m/s to 180 m/s and there is a peak value at
PePSS - A portable sky scanner for measuring extremely low night-sky brightness
Kocifaj, Miroslav; Kómar, Ladislav; Kundracik, František
2018-05-01
A new portable sky scanner designed for low-light-level detection at night is developed and employed in night sky brightness measurements in a rural region. The fast readout, adjustable sensitivity and linear response guaranteed in 5-6 orders of magnitude makes the device well suited for narrow-band photometry in both dark areas and bright urban and suburban environments. Quasi-monochromatic night-sky brightness data are advantageous in the accurate characterization of spectral power distribution of scattered and emitted light and, also allows for the possibility to retrieve light output patterns from whole-city light sources. The sky scanner can operate in both night and day regimes, taking advantage of the complementarity of both radiance data types. Due to its inherent very high sensitivity the photomultiplier tube could be used in night sky radiometry, while the spectrometer-equipped system component capable of detecting elevated intensities is used in daylight monitoring. Daylight is a source of information on atmospheric optical properties that in turn are necessary in processing night sky radiances. We believe that the sky scanner has the potential to revolutionize night-sky monitoring systems.
Sandmann, Henner; Stick, Carsten
2014-01-01
Spatial measurements of the diffusely scattered sky radiance at a seaside resort under clear sky and slightly overcast conditions have been used to calculate the sky radiance distribution across the upper hemisphere. The measurements were done in the summer season when solar UV radiation is highest. The selected wavelengths were 307, 350 and 550 nm representing the UVB, UVA and VIS band. Absolute values of radiance differ considerably between the wavelengths. Normalizing the measured values by use of direct solar radiance made the spatial distributions of unequal sky radiance comparable. The results convey a spatial impression of the different distributions of the radiance at the three wavelengths. Relative scattered radiance intensity is one order of magnitude greater in UVB than in VIS, whereas in UVA lies roughly in between. Under slightly overcast conditions scattered radiance is increased at all three wavelengths by about one order of magnitude. These measurements taken at the seaside underline the importance of diffuse scattered radiance. The effect of shading parts of the sky can be estimated from the distribution of sky radiance. This knowledge might be useful for sun seekers and in the treatment of people staying at the seaside for therapeutic purposes. © 2013 The American Society of Photobiology.
Clear-Sky Narrowband Albedo Datasets Derived from Modis Data
Chen, Y.; Minnis, P.; Sun-Mack, S.; Arduini, R. F.; Hong, G.
2013-12-01
Satellite remote sensing of clouds requires an accurate estimate of the clear-sky radiances for a given scene to detect clouds and aerosols and to retrieve their microphysical properties. Knowing the spatial and angular variability of clear-sky albedo is essential for predicting the clear-sky radiance at solar wavelengths. The Clouds and the Earth's Radiant Energy System (CERES) Project uses the near-infrared (NIR; 1.24, 1.6 or 2.13 μm) and visible (VIS; 0.63 μm) channels available on the Terra and Aqua Moderate Resolution Imaging Spectroradiometers (MODIS) to help identify clouds and retrieve their properties. Generally, clear-sky albedo for a given surface type is determined for conditions when the vegetation is either thriving or dormant and free of snow. The clear-sky albedos are derived using a radiative transfer parameterization of the impact of the atmosphere, including aerosols, on the observed reflectances. This paper presents the method of generating monthly clear-sky overhead albedo maps for both snow-free and snow-covered surfaces of these channels using one year of MODIS (Moderate Resolution Imaging Spectroradiometer) CERES products. Maps of 1.24 and 1.6 μm are being used as the background to help retrieve cloud properties (e.g., effective particle size, optical depth) in CERES cloud retrievals in both snow-free and snow-covered conditions.
The GMRT 150 MHz all-sky radio survey. First alternative data release TGSS ADR1
Intema, H. T.; Jagannathan, P.; Mooley, K. P.; Frail, D. A.
2017-02-01
We present the first full release of a survey of the 150 MHz radio sky, observed with the Giant Metrewave Radio Telescope (GMRT) between April 2010 and March 2012 as part of the TIFR GMRT Sky Survey (TGSS) project. Aimed at producing a reliable compact source survey, our automated data reduction pipeline efficiently processed more than 2000 h of observations with minimal human interaction. Through application of innovative techniques such as image-based flagging, direction-dependent calibration of ionospheric phase errors, correcting for systematic offsets in antenna pointing, and improving the primary beam model, we created good quality images for over 95 percent of the 5336 pointings. Our data release covers 36 900 deg2 (or 3.6 π steradians) of the sky between -53° and +90° declination (Dec), which is 90 percent of the total sky. The majority of pointing images have a noise level below 5 mJy beam-1 with an approximate resolution of 25''×25'' (or 25''×25''/ cos(Dec-19°) for pointings south of 19° declination). We have produced a catalog of 0.62 Million radio sources derived from an initial, high reliability source extraction at the seven sigma level. For the bulk of the survey, the measured overall astrometric accuracy is better than two arcseconds in right ascension and declination, while the flux density accuracy is estimated at approximately ten percent. Within the scope of the TGSS alternative data release (TGSS ADR) project, the source catalog, as well as 5336 mosaic images (5°×5°) and an image cutout service, are made publicly available at the CDS as a service to the astronomical community. Next to enabling a wide range of different scientific investigations, we anticipate that these survey products will provide a solid reference for various new low-frequency radio aperture array telescopes (LOFAR, LWA, MWA, SKA-low), and can play an important role in characterizing the epoch-of-reionisation (EoR) foreground. The TGSS ADR project aims at
Moore, Patrick
2010-01-01
For more than 50 years now Sir Patrick Moore has presented the BBC Television series Sky at Night; not a month has been missed – a record for any television series, and a record which may never be broken. Every three years or so a book is published covering the main events in both astronomy and space research. This is the 13th volume, not only a record of the programmes but also of the great advances and discoveries during the period covered - eclipses, comets, and the strange chemical lakes of Titan, for instance, but also anniversaries such as the fifteenth “birthday” of the Hubble Space Telescope, and not forgetting the programme celebrating the Sky at Night’s 50th year, attended by astronaut Piers Sellars and many others who appeared on the programme over the years. All the chapters are self-contained, and fully illustrated. In this new Sky at Night book you will find much to entertain you. It will appeal to amateurs and professionals alike.
Photosynthetically-active radiation: sky radiance distributions under clear and overcast conditions
International Nuclear Information System (INIS)
Grant, R.H.; Heisler, G.M.; Gao, W.
1996-01-01
The photosynthetically active radiation (PAR), defined as the wavelength band of 0.400 μm to 0.700 μm, represents most of the visible solar radiation. Although the proportion of global irradiance that originates from diffuse sky radiation is higher for PAR than for all solar shortwave radiation, it is often assumed that the PAR diffuse sky radiation is distributed identically to that of all shortwave solar radiation. This assumption has not been tested. PAR sky radiance measurements were made in a rural area over a wide range of solar zenith angles. The distribution of PAR sky radiance was modeled using physically-based, non-linear equations.For clear skies, the normalized sky radiance distribution (N) was best modeled using the scattering angle (ψ) and the zenith position in the sky (Θ) as N (Θ, ψ) = 0.0361 [6.3 + (1 + cos 2 Θ / (1 - cos ψ)] [1-e -0.31 sec ( Θ]. The angle Ψ is defined by cos ψ = cos Θ cos Θ * + sin Θ sin Θ * cos Φ, where solar zenith angle is Θ* and the difference in azimuth between the sun and the position in the sky is Φ. Modeling of the overcast sky depended on the visibility of the solar disk. The translucent middle/high cloud overcast conditions (cloud base greater than 300 m above ground level) were best modeled as: N(Θ∗, ψ) = 0.149 + 0.084Θ∗ + 1.305e −2.5ψ while the translucent low cloud overcast conditions (cloud base less than 300 m above ground level) were best modeled as: N(Θ∗, ψ) = 0.080 + 0.058Θ∗ + 0.652e −2.1ψ . The obscured overcast sky condition (solar disk obscured) was best modeled as: N(Θ) = 0.441 [1 + 4.6cos Θ] /[1 + 4.6]. The unit of N for all equations is π Sr −1 , so that integration of each function over the sky hemisphere yields 1.0.These equations can be applied directly to the sky diffuse irradiance on the horizontal, I diff , to provide radiance distributions for the sky. Estimates of actual sky radiance distribution can be estimated from N a (Θ, ψ) = I diff N(Θ,
Song, Yingchao; Luo, Haibo; Ma, Junkai; Hui, Bin; Chang, Zheng
2018-04-01
Sky detection plays an essential role in various computer vision applications. Most existing sky detection approaches, being trained on ideal dataset, may lose efficacy when facing unfavorable conditions like the effects of weather and lighting conditions. In this paper, a novel algorithm for sky detection in hazy images is proposed from the perspective of probing the density of haze. We address the problem by an image segmentation and a region-level classification. To characterize the sky of hazy scenes, we unprecedentedly introduce several haze-relevant features that reflect the perceptual hazy density and the scene depth. Based on these features, the sky is separated by two imbalance SVM classifiers and a similarity measurement. Moreover, a sky dataset (named HazySky) with 500 annotated hazy images is built for model training and performance evaluation. To evaluate the performance of our method, we conducted extensive experiments both on our HazySky dataset and the SkyFinder dataset. The results demonstrate that our method performs better on the detection accuracy than previous methods, not only under hazy scenes, but also under other weather conditions.
Sitek, M.; Pojmański, G.
2014-06-01
This paper presents the results of our extensive search for the bright variable stars in approximately 30 000 square degrees of the south sky in the I-band data collected by 9o×9o camera of the All Sky Automated Survey between 2002 and 2009. Lists of over 27 000 variable stars brighter than 9 mag at maximum light, with amplitudes ranging from 0.02 mag to 7 mag and variability time-scales from hours to years, as well as corresponding light curves are provided. Automated classification algorithm based on stellar properties (period, Fourier coefficients, 2MASS J, H, K, colors, ASAS V-band data) was used to roughly classify objects. Despite low spatial resolution of the ASAS data (≍15'') we cross-identified all objects with other available data sources. Coordinates of the most probable 2MASS counterparts are provided. 27 705 stars brighter than I=9 mag were found to be variable, of which 7842 objects were detected to be variable for the first time. Brief statistics and discussion of the presented data is provided. All the photometric data is available over the Internet at http://www.astrouw.edu.pl/ gp/asas/AsasBrightI.html
International Nuclear Information System (INIS)
Pattanasethanon, Singthong; Lertsatitthanakorn, Charoenporn; Atthajariyakul, Surat; Soponronnarit, Somchart
2008-01-01
The results of a study on all sky modeling and forecasting daylight availability for the tropical climate found in the central region of the northeastern part of Thailand (16 deg. 14' N, 103 deg. 15' E) is presented. The required components of sky quantities, namely, global and diffuse horizontal irradiance and global horizontal illuminance for saving energy used in buildings are estimated. The empirical sinusoidal models are validated. A and B values of the empirical sinusoidal model for all sky conditions are determined and developed to become a form of the sky conditions. In addition, a novel sinusoidal model, which consists of polynomial or exponential functions, is validated. A and B values of the empirical sinusoidal model for all sky conditions are determined and developed to become a new function in the polynomial or exponential form of the sky conditions. Novelettes, an artificial intelligent agent, namely, artificial neural network (ANN) model is also identified. Back propagation learning algorithms were used in the networks. Moreover, a one year data set and a next half year data set were used in order to train and test the neural network, respectively. Observation results from one year's round data indicate that luminosity and energy from the sky on horizontal in the area around Mahasarakham are frequently brighter than those of Bangkok. The accuracy of the validated model is determined in terms of the mean bias deviation (MBD), the root-mean-square-deviation (RMSD) and the coefficient of correlation (R 2 ) values. A comparison of the estimated solar irradiation values and the observed values revealed a small error slide in the empirical sinusoidal model as well. In addition, some results of the sky quantity forecast by the ANN model indicate that the ANN model is more accurate than the empirical models and the novel sinusoidal models. This study confirms the ability of the ANN to predict highly accurate solar radiance/illuminance values. We believe
The Mythology of the Night Sky
Falkner, David E.
The word "planet" comes from the Latin word planeta and the Greek word planes, which means "wanderer." When the ancient Greeks studied the night sky they noticed that most of the stars remained in the same position relative to all the other stars, but a few stars seem to move in the sky from day to day, week to week, and month to month. The Greeks called these rogue stars "wanderers" because they wandered through the starry background.
Educating for the Preservation of Dark Skies
Preston, Sandra Lee; Cianciolo, Frank; Wetzel, Marc; Finkelstein, Keely; Wren, William; Nance, Craig
2015-08-01
The stars at night really are big and bright deep in the heart of Texas at the McDonald Observatory near Fort Davis, Texas. Each year 80,000 visitors from all over the world make the pilgrimage to the Observatory to attend one of the three-times-a-week star parties. Many experience, for the first time, the humbling, splendor of a truly dark night sky. Over the last several years, the Observatory has experienced dramatic increases in visitation demonstrating the public’s appetite for science education, in general, and interest in the night sky, in particular. This increasing interest in astronomy is, ironically, occurring at a time when most of humanity’s skies are becoming increasingly light-polluted frustrating this natural interest. Dark skies and knowledgeable education and outreach staff are an important resource in maintaining the public’s interest in astronomy, support for astronomical research, and local tourism.This year Observatory educators were inspired by the observance of the International Year of Light to promote healthy outdoor lighting through its popular Astronomy Day distance learning program. This program reaches tens of thousands of K-12 students in Texas and other states with a message of how they can take action to preserve dark skies. As well, more than a thousand Boy Scouts visiting during the summer months receive a special program, which includes activities focusing on good lighting practices, thereby earning them credits toward an astronomy badge.The Observatory also offers a half-a-dozen K-12 teacher professional development workshops onsite each year, which provide about 90 teachers with dark skies information, best-practice lighting demonstrations, and red flashlights. Multi-year workshops for National Park and State of Texas Parks personnel are offered on dark sky preservation and sky interpretation at McDonald and a Dark Skies fund for retrofitting lights in the surrounding area has been established. The Observatory also uses
VizieR Online Data Catalog: Northern Sky Variability Survey (Wozniak+, 2004)
Wozniak, P. R.; Vestrand, W. T.; Akerlof, C. W.; Balsano, R.; Bloch, J.; Casperson, D.; Fletcher, S.; Gisler, G.; Kehoe, R.; Kinemuchi, K.; Lee, B. C.; Marshall, S.; McGowan, K. E.; McKay, T. A.; Rykoff, E. S.; Smith, D. A.; Szymanski, J.; Wren, J.
2004-11-01
The Northern Sky Variability Survey (NSVS) is a temporal record of the sky over the optical magnitude range from 8 to 15.5. It was conducted in the course of the first-generation Robotic Optical Transient Search Experiment (ROTSE-I) using a robotic system of four comounted unfiltered telephoto lenses equipped with CCD cameras. The survey was conducted from Los Alamos, New Mexico, and primarily covers the entire northern sky. Some data in southern fields between declinations 0{deg} and -38{deg} are also available, although with fewer epochs and noticeably lesser quality. The NSVS contains light curves for approximately 14 million objects. With a 1-yr baseline and typically 100-500 measurements per object, the NSVS is the most extensive record of stellar variability across the bright sky available today. In a median field, bright unsaturated stars attain a point-to-point photometric scatter of ~0.02mag and position errors within 2. At Galactic latitudes |b|public access from the Sky Database for Objects in Time-Domain (SkyDOT) at Los Alamos National Laboratory. Copies of the full survey photometry may also be requested on tape. (7 data files).
Berthier, J.; Carry, B.; Vachier, F.; Eggl, S.; Santerne, A.
2016-05-01
All the fields of the extended space mission Kepler/K2 are located within the ecliptic. Many Solar system objects thus cross the K2 stellar masks on a regular basis. We aim at providing to the entire community a simple tool to search and identify Solar system objects serendipitously observed by Kepler. The sky body tracker (SkyBoT) service hosted at Institut de mécanique céleste et de calcul des éphémérides provides a Virtual Observatory compliant cone search that lists all Solar system objects present within a field of view at a given epoch. To generate such a list in a timely manner, ephemerides are pre-computed, updated weekly, and stored in a relational data base to ensure a fast access. The SkyBoT web service can now be used with Kepler. Solar system objects within a small (few arcminutes) field of view are identified and listed in less than 10 s. Generating object data for the entire K2 field of view (14°) takes about a minute. This extension of the SkyBoT service opens new possibilities with respect to mining K2 data for Solar system science, as well as removing Solar system objects from stellar photometric time series.
Kirkpatrick, J.; Reid, I.; Liebert, J.; Cutri, R.; Nelson, B.; Beichman, C.; Dahn, C.; Monet, D.; Gizis, J.; Skrutskie, M.
1998-01-01
Before the 2-Micron All-Sky Survey (2MASS) began, only six objects were known with spectral types later than M9.5 V. In the first 371 sq. deg. of actual 2MASS survey data, we have identified another twenty such objects spectroscopically confirmed using the Low Resolution Imaging Spectrograph (LRIS) at the W.M. Keck Observatory.
Energy Technology Data Exchange (ETDEWEB)
Gagné, Jonathan; Lafrenière, David; Doyon, René; Malo, Lison; Artigau, Étienne [Département de Physique, Université de Montréal, C.P. 6128 Succ. Centre-ville, Montréal, QC H3C 3J7 (Canada)
2015-01-10
We present the BANYAN All-Sky Survey (BASS) catalog, consisting of 228 new late-type (M4-L6) candidate members of nearby young moving groups (YMGs) with an expected false-positive rate of ∼13%. This sample includes 79 new candidate young brown dwarfs and 22 planetary-mass objects. These candidates were identified through the first systematic all-sky survey for late-type low-mass stars and brown dwarfs in YMGs. We cross-matched the Two Micron All Sky Survey and AllWISE catalogs outside of the galactic plane to build a sample of 98,970 potential ≥M5 dwarfs in the solar neighborhood and calculated their proper motions with typical precisions of 5-15 mas yr{sup –1}. We selected highly probable candidate members of several YMGs from this sample using the Bayesian Analysis for Nearby Young AssociatioNs II tool (BANYAN II). We used the most probable statistical distances inferred from BANYAN II to estimate the spectral type and mass of these candidate YMG members. We used this unique sample to show tentative signs of mass segregation in the AB Doradus moving group and the Tucana-Horologium and Columba associations. The BASS sample has already been successful in identifying several new young brown dwarfs in earlier publications, and will be of great interest in studying the initial mass function of YMGs and for the search of exoplanets by direct imaging; the input sample of potential close-by ≥M5 dwarfs will be useful to study the kinematics of low-mass stars and brown dwarfs and search for new proper motion pairs.
Estimating the sky map in gamma-ray astronomy with a Compton telescope
International Nuclear Information System (INIS)
Herbert, T.J.
1991-01-01
Compton telescopes represent an effective design for γ-ray astronomy in the 1-30 MeV range. However, the complexity of the system response to incident γ-rays has restricted the formulation of optimal methods for processing the data. Since data is only acquired at considerable expense and difficulty a significant investment in both algorithm development and computer processing time are warranted. Current methods for processing low level data form the sky map as either the sum or product of the probabilities that each recorded γ-ray originated from within an area of the sky map. Instead, we model the unknown sky map itself as the means of a Poisson process generating the γ-ray recorded by the telescope. In this paper the authors formulate the probability density function of the data conditioned upon the sky map and derive an iterative algorithm for estimating the sky map by the method of maximum likelihood
SURVEYING THE DYNAMIC RADIO SKY WITH THE LONG WAVELENGTH DEMONSTRATOR ARRAY
International Nuclear Information System (INIS)
Lazio, T. Joseph W.; Clarke, Tracy E.; Lane, W. M.; Gross, C.; Kassim, N. E.; Hicks, B.; Polisensky, E.; Stewart, K.; Ray, P. S.; Wood, D.; York, J. A.; Kerkhoff, A.; Dalal, N. Paravastu; Cohen, A. S.; Erickson, W. C.
2010-01-01
This paper presents a search for radio transients at a frequency of 73.8 MHz (4 m wavelength) using the all-sky imaging capabilities of the Long Wavelength Demonstrator Array (LWDA). The LWDA was a 16-dipole phased array telescope, located on the site of the Very Large Array in New Mexico. The field of view of the individual dipoles was essentially the entire sky, and the number of dipoles was sufficiently small that a simple software correlator could be used to make all-sky images. From 2006 October to 2007 February, we conducted an all-sky transient search program, acquiring a total of 106 hr of data; the time sampling varied, being 5 minutes at the start of the program and improving to 2 minutes by the end of the program. We were able to detect solar flares, and in a special-purpose mode, radio reflections from ionized meteor trails during the 2006 Leonid meteor shower. We detected no transients originating outside of the solar system above a flux density limit of 500 Jy, equivalent to a limit of no more than about 10 -2 events yr -1 deg -2 , having a pulse energy density ∼>1.5 x 10 -20 J m -2 Hz -1 at 73.8 MHz for pulse widths of about 300 s. This event rate is comparable to that determined from previous all-sky transient searches, but at a lower frequency than most previous all-sky searches. We believe that the LWDA illustrates how an all-sky imaging mode could be a useful operational model for low-frequency instruments such as the Low Frequency Array, the Long Wavelength Array station, the low-frequency component of the Square Kilometre Array, and potentially the Lunar Radio Array.
Directory of Open Access Journals (Sweden)
Yong Ha Kim
2010-09-01
Full Text Available We have carried out all-sky imaging of OH Meinel, O2 atmospheric and OI 557.7 nm airglow layers in the period from July of 2001 through September of 2005 at Mt. Bohyun, Korea (36.2° N, 128.9° E, Alt = 1,124 m. We analyzed the images observed during a total of 153 clear moonless nights and found 97 events of band-type waves. The characteristics of the observed waves (wavelengths, periods, and phase speeds are consistent with internal gravity waves. The wave occurrence shows an approximately semi-annual variation, with maxima near solstices and minima near equinoxes, which is consistent with other studies of airglow wave observations, but not with those of mesospheric radar/lidar observations. The observed waves tended to propagate westward during fall and winter, and eastward during spring and summer. Our ray tracing study of the observed waves shows that majority of the observed waves seemed to originate from mesospheric altitudes. The preferential directions and the apparent source altitudes can be explained if the observed waves are secondary waves generated from primary waves that have been selected by the filtering process and break up at the mesospheric altitudes.
Sky coverage modeling for the whole sky for laser guide star multiconjugate adaptive optics.
Wang, Lianqi; Andersen, David; Ellerbroek, Brent
2012-06-01
The scientific productivity of laser guide star adaptive optics systems strongly depends on the sky coverage, which describes the probability of finding natural guide stars for the tip/tilt wavefront sensor(s) to achieve a certain performance. Knowledge of the sky coverage is also important for astronomers planning their observations. In this paper, we present an efficient method to compute the sky coverage for the laser guide star multiconjugate adaptive optics system, the Narrow Field Infrared Adaptive Optics System (NFIRAOS), being designed for the Thirty Meter Telescope project. We show that NFIRAOS can achieve more than 70% sky coverage over most of the accessible sky with the requirement of 191 nm total rms wavefront.
Eyes on the Skies 400 Years of Telescopic Discovery
Schilling, Govert
2011-01-01
Adopted as the official book of the International Year of Astronomy (IYA) 2009, this stunningly illustrated history of telescopic discovery spans the range from the first telescopes via the Hubble Space Telescope to next generation platforms, and how they have changed and continue to change our view of the universe, our place in it and where it all came from. Eyes on the Skies features numerous full-page photographs and is printed in high-quality color throughout. Also includes the official IYA DVD with 59 minutes of narrated text, expert comments and interviews, animations, computer simulatio
Planck 2013 results. XXI. All-sky Compton parameter power spectrum and high-order statistics
Ade, P.A.R.; Armitage-Caplan, C.; Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.; Aumont, J.; Baccigalupi, C.; Banday, A.J.; Barreiro, R.B.; Bartlett, J.G.; Battaner, E.; Benabed, K.; Benoit, A.; Benoit-Levy, A.; Bernard, J.P.; Bersanelli, M.; Bielewicz, P.; Bobin, J.; Bock, J.J.; Bonaldi, A.; Bond, J.R.; Borrill, J.; Bouchet, F.R.; Bridges, M.; Bucher, M.; Burigana, C.; Butler, R.C.; Cardoso, J.F.; Carvalho, P.; Catalano, A.; Challinor, A.; Chamballu, A.; Chiang, L.Y.; Chiang, H.C.; Christensen, P.R.; Church, S.; Clements, D.L.; Colombi, S.; Colombo, L.P.L.; Comis, B.; Couchot, F.; Coulais, A.; Crill, B.P.; Curto, A.; Cuttaia, F.; Da Silva, A.; Danese, L.; Davies, R.D.; Davis, R.J.; de Bernardis, P.; de Rosa, A.; de Zotti, G.; Delabrouille, J.; Delouis, J.M.; Desert, F.X.; Dickinson, C.; Diego, J.M.; Dolag, K.; Dole, H.; Donzelli, S.; Dore, O.; Douspis, M.; Dupac, X.; Efstathiou, G.; Ensslin, T.A.; Eriksen, H.K.; Finelli, F.; Flores-Cacho, I.; Forni, O.; Frailis, M.; Franceschi, E.; Galeotta, S.; Ganga, K.; Genova-Santos, R.T.; Giard, M.; Giardino, G.; Giraud-Heraud, Y.; Gonzalez-Nuevo, J.; Gorski, K.M.; Gratton, S.; Gregorio, A.; Gruppuso, A.; Hansen, F.K.; Hanson, D.; Harrison, D.; Henrot-Versille, S.; Hernandez-Monteagudo, C.; Herranz, D.; Hildebrandt, S.R.; Hivon, E.; Hobson, M.; Holmes, W.A.; Hornstrup, A.; Hovest, W.; Huffenberger, K.M.; Hurier, G.; Jaffe, T.R.; Jaffe, A.H.; Jones, W.C.; Juvela, M.; Keihanen, E.; Keskitalo, R.; Kisner, T.S.; Kneissl, R.; Knoche, J.; Knox, L.; Kunz, M.; Kurki-Suonio, H.; Lacasa, F.; Lagache, G.; Lahteenmaki, A.; Lamarre, J.M.; Lasenby, A.; Laureijs, R.J.; Lawrence, C.R.; Leahy, J.P.; Leonardi, R.; Leon-Tavares, J.; Lesgourgues, J.; Liguori, M.; Lilje, P.B.; Linden-Vornle, M.; Lopez-Caniego, M.; Lubin, P.M.; Macias-Perez, J.F.; Maffei, B.; Maino, D.; Mandolesi, N.; Marcos-Caballero, A.; Maris, M.; Marshall, D.J.; Martin, P.G.; Martinez-Gonzalez, E.; Masi, S.; Matarrese, S.; Matthai, F.; Mazzotta, P.; Melchiorri, A.; Melin, J.B.; Mendes, L.; Mennella, A.; Migliaccio, M.; Mitra, S.; Miville-Deschenes, M.A.; Moneti, A.; Montier, L.; Morgante, G.; Mortlock, D.; Moss, A.; Munshi, D.; Naselsky, P.; Nati, F.; Natoli, P.; Netterfield, C.B.; Norgaard-Nielsen, H.U.; Noviello, F.; Novikov, D.; Novikov, I.; Osborne, S.; Oxborrow, C.A.; Paci, F.; Pagano, L.; Pajot, F.; Paoletti, D.; Partridge, B.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Pietrobon, D.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Poutanen, T.; Pratt, G.W.; Prezeau, G.; Prunet, S.; Puget, J.L.; Rachen, J.P.; Rebolo, R.; Reinecke, M.; Remazeilles, M.; Renault, C.; Ricciardi, S.; Riller, T.; Ristorcelli, I.; Rocha, G.; Rosset, C.; Rossetti, M.; Roudier, G.; Rubino-Martin, J.A.; Rusholme, B.; Sandri, M.; Santos, D.; Savini, G.; Scott, D.; Seiffert, M.D.; Shellard, E.P.S.; Spencer, L.D.; Starck, J.L.; Stolyarov, V.; Stompor, R.; Sudiwala, R.; Sunyaev, R.; Sureau, F.; Sutton, D.; Suur-Uski, A.S.; Sygnet, J.F.; Tauber, J.A.; Tavagnacco, D.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tucci, M.; Tuovinen, J.; Umana, G.; Valenziano, L.; Valiviita, J.; Van Tent, B.; Varis, J.; Vielva, P.; Villa, F.; Vittorio, N.; Wade, L.A.; Wandelt, B.D.; White, S.D.M.; Yvon, D.; Zacchei, A.; Zonca, A.
2014-01-01
We have constructed the first all-sky map of the thermal Sunyaev-Zeldovich (tSZ) effect by applying specifically tailored component separation algorithms to the 100 to 857 GHz frequency channel maps from the Planck survey. These maps show an obvious galaxy cluster tSZ signal that is well matched with blindly detected clusters in the Planck SZ catalogue. To characterize the signal in the tSZ map we have computed its angular power spectrum. At large angular scales ($\\ell 500$) the clustered Cosmic Infrared Background (CIB) and residual point sources are the major contaminants. These foregrounds are carefully modelled and subtracted. We measure the tSZ power spectrum in angular scales, $0.17^{\\circ} \\lesssim \\theta \\lesssim 3.0^{\\circ}$, that were previously unexplored. The measured tSZ power spectrum is consistent with that expected from the Planck catalogue of SZ sources, with additional clear evidence of signal from unresolved clusters and, potentially, diffuse warm baryons. We use the tSZ power spectrum to ...
All-optical fast random number generator.
Li, Pu; Wang, Yun-Cai; Zhang, Jian-Zhong
2010-09-13
We propose a scheme of all-optical random number generator (RNG), which consists of an ultra-wide bandwidth (UWB) chaotic laser, an all-optical sampler and an all-optical comparator. Free from the electric-device bandwidth, it can generate 10Gbit/s random numbers in our simulation. The high-speed bit sequences can pass standard statistical tests for randomness after all-optical exclusive-or (XOR) operation.
Solar Resource Assessment with Sky Imagery and a Virtual Testbed for Sky Imager Solar Forecasting
Kurtz, Benjamin Bernard
In recent years, ground-based sky imagers have emerged as a promising tool for forecasting solar energy on short time scales (0 to 30 minutes ahead). Following the development of sky imager hardware and algorithms at UC San Diego, we present three new or improved algorithms for sky imager forecasting and forecast evaluation. First, we present an algorithm for measuring irradiance with a sky imager. Sky imager forecasts are often used in conjunction with other instruments for measuring irradiance, so this has the potential to decrease instrumentation costs and logistical complexity. In particular, the forecast algorithm itself often relies on knowledge of the current irradiance which can now be provided directly from the sky images. Irradiance measurements are accurate to within about 10%. Second, we demonstrate a virtual sky imager testbed that can be used for validating and enhancing the forecast algorithm. The testbed uses high-quality (but slow) simulations to produce virtual clouds and sky images. Because virtual cloud locations are known, much more advanced validation procedures are possible with the virtual testbed than with measured data. In this way, we are able to determine that camera geometry and non-uniform evolution of the cloud field are the two largest sources of forecast error. Finally, with the assistance of the virtual sky imager testbed, we develop improvements to the cloud advection model used for forecasting. The new advection schemes are 10-20% better at short time horizons.
Measuring high-resolution sky luminance distributions with a CCD camera.
Tohsing, Korntip; Schrempf, Michael; Riechelmann, Stefan; Schilke, Holger; Seckmeyer, Gunther
2013-03-10
We describe how sky luminance can be derived from a newly developed hemispherical sky imager (HSI) system. The system contains a commercial compact charge coupled device (CCD) camera equipped with a fish-eye lens. The projection of the camera system has been found to be nearly equidistant. The luminance from the high dynamic range images has been calculated and then validated with luminance data measured by a CCD array spectroradiometer. The deviation between both datasets is less than 10% for cloudless and completely overcast skies, and differs by no more than 20% for all sky conditions. The global illuminance derived from the HSI pictures deviates by less than 5% and 20% under cloudless and cloudy skies for solar zenith angles less than 80°, respectively. This system is therefore capable of measuring sky luminance with the high spatial and temporal resolution of more than a million pixels and every 20 s respectively.
DIGITAL ACCESS TO A SKY CENTURY AT HARVARD: INITIAL PHOTOMETRY AND ASTROMETRY
International Nuclear Information System (INIS)
Laycock, S.; Tang, S.; Grindlay, J.; Los, E.; Simcoe, R.; Mink, D.
2010-01-01
Digital Access to a Sky Century at Harvard (DASCH) is a project to digitize the collection of ∼500,000 glass photographic plates held at Harvard College Observatory. The collection spans the time period from 1880 to 1985, during which time every point on the sky was been observed from 500 to 1000 times. In this paper, we describe the DASCH commissioning run, during which we developed the data-reduction pipeline, characterized the plates and fine-tuned the digitizer's performance and operation. This initial run consisted of 500 plates taken from a variety of different plate series, all containing the open cluster Praeseppe (M44). We report that accurate photometry at the 0.1 mag level is possible on the majority of plates, and demonstrate century-long light curves of various types of variable stars in and around M44. DASCH will generate a public online archive of the entire plate collection, including images, source catalogs, and light curves for nearly all astronomical objects brighter than about 17th magnitude.
Digital Access to a Sky Century at Harvard: Initial Photometry and Astrometry
Laycock, S.; Tang, S.; Grindlay, J.; Los, E.; Simcoe, R.; Mink, D.
2010-10-01
Digital Access to a Sky Century at Harvard (DASCH) is a project to digitize the collection of ~500,000 glass photographic plates held at Harvard College Observatory. The collection spans the time period from 1880 to 1985, during which time every point on the sky was been observed from 500 to 1000 times. In this paper, we describe the DASCH commissioning run, during which we developed the data-reduction pipeline, characterized the plates and fine-tuned the digitizer's performance and operation. This initial run consisted of 500 plates taken from a variety of different plate series, all containing the open cluster Praeseppe (M44). We report that accurate photometry at the 0.1 mag level is possible on the majority of plates, and demonstrate century-long light curves of various types of variable stars in and around M44. DASCH will generate a public online archive of the entire plate collection, including images, source catalogs, and light curves for nearly all astronomical objects brighter than about 17th magnitude.
Spinning projectile's attitude measurement with LW infrared radiation under sea-sky background
Xu, Miaomiao; Bu, Xiongzhu; Yu, Jing; He, Zilu
2018-05-01
With the further development of infrared radiation research in sea-sky background and the requirement of spinning projectile's attitude measurement, the sea-sky infrared radiation field is used to carry out spinning projectile's attitude angle instead of inertial sensors. Firstly, the generation mechanism of sea-sky infrared radiation is analysed. The mathematical model of sea-sky infrared radiation is deduced in LW (long wave) infrared 8 ∼ 14 μm band by calculating the sea surface and sky infrared radiation. Secondly, according to the movement characteristics of spinning projectile, the attitude measurement model of infrared sensors on projectile's three axis is established. And the feasibility of the model is analysed by simulation. Finally, the projectile's attitude calculation algorithm is designed to improve the attitude angle estimation accuracy. The results of semi-physical experiments show that the segmented interactive algorithm estimation error of pitch and roll angle is within ±1.5°. The attitude measurement method is effective and feasible, and provides accurate measurement basis for the guidance of spinning projectile.
Day/night whole sky imagers for 24-h cloud and sky assessment: history and overview.
Shields, Janet E; Karr, Monette E; Johnson, Richard W; Burden, Art R
2013-03-10
A family of fully automated digital whole sky imagers (WSIs) has been developed at the Marine Physical Laboratory over many years, for a variety of research and military applications. The most advanced of these, the day/night whole sky imagers (D/N WSIs), acquire digital imagery of the full sky down to the horizon under all conditions from full sunlight to starlight. Cloud algorithms process the imagery to automatically detect the locations of cloud for both day and night. The instruments can provide absolute radiance distribution over the full radiance range from starlight through daylight. The WSIs were fielded in 1984, followed by the D/N WSIs in 1992. These many years of experience and development have resulted in very capable instruments and algorithms that remain unique. This article discusses the history of the development of the D/N WSIs, system design, algorithms, and data products. The paper cites many reports with more detailed technical documentation. Further details of calibration, day and night algorithms, and cloud free line-of-sight results will be discussed in future articles.
International Nuclear Information System (INIS)
Roeser, S.; Demleitner, M.; Schilbach, E.
2010-01-01
USNO-B1.0 and the Two Micron All Sky Survey (2MASS) are the most widely used all-sky surveys. However, 2MASS has no proper motions at all, and USNO-B1.0 published only relative, not absolute (i.e., on the International Celestial Reference Frame (ICRS), proper motions. We performed a new determination of mean positions and proper motions on the ICRS system by combining USNO-B1.0 and 2MASS astrometry. This catalog is called PPMXL (VO access to the catalog is possible via http://vo.uni-hd.de/ppmxl), and it aims to be completed from the brightest stars down to about V ∼ 20 all sky. PPMXL contains about 900 million objects, some 410 million with 2MASS photometry, and is the largest collection of ICRS proper motions at present. As representative for the ICRS, we chose PPMX. The recently released UCAC3 could not be used because we found plate-dependent distortions in its proper motion system north of -20 0 declination. UCAC3 served as an intermediate system for δ ≤ -20 0 . The resulting typical individual mean errors of the proper motions range from 4 mas yr -1 to more than 10 mas yr -1 depending on observational history. The mean errors of positions at epoch 2000.0 are 80-120 mas, if 2MASS astrometry could be used, 150-300 mas else. We also give correction tables to convert USNO-B1.0 observations of, e.g., minor planets to the ICRS system.
An Innovative Collaboration on Dark Skies Education
Walker, Constance E.; Mayer, M.; EPO Students, NOAO
2011-01-01
Dark night skies are being lost all over the globe, and hundreds of millions of dollars of energy are being wasted in the process.. Improper lighting is the main cause of light pollution. Light pollution is a concern on many fronts, affecting safety, energy conservation, cost, human health, and wildlife. It also robs us of the beauty of viewing the night sky. In the U.S. alone, over half of the population cannot see the Milky Way from where they live. To help address this, the National Optical Astronomy Observatory Education and Public Outreach (NOAO EPO) staff created two programs: Dark Skies Rangers and GLOBE at Night. Through the two programs, students learn about the importance of dark skies and experience activities that illustrate proper lighting, light pollution's effects on wildlife and how to measure the darkness of their skies. To disseminate the programs locally in an appropriate yet innovative venue, NOAO partnered with the Cooper Center for Environmental Learning in Tucson, Arizona. Operated by the largest school district in Tucson and the University of Arizona College of Education, the Cooper Center educates thousands of students and educators each year about ecology, science, and the beauty and wonders of the Sonoran Desert. During the first academic year (2009-2010), we achieved our goal of reaching nearly 20 teachers in 40 classrooms of 1000 students. We gave two 3-hour teacher-training sessions and provided nineteen 2.5-hour on-site evening sessions on dark skies activities for the students of the teachers trained. One outcome of the program was the contribution of 1000 "GLOBE at Night 2010” night-sky brightness measurements by Tucson students. Training sessions at similar levels are continuing this year. The partnership, planning, lesson learned, and outcomes of NOAO's collaboration with the environmental center will be presented.
SkyMapper Southern Survey: First Data Release (DR1)
Wolf, Christian; Onken, Christopher A.; Luvaul, Lance C.; Schmidt, Brian P.; Bessell, Michael S.; Chang, Seo-Won; Da Costa, Gary S.; Mackey, Dougal; Martin-Jones, Tony; Murphy, Simon J.; Preston, Tim; Scalzo, Richard A.; Shao, Li; Smillie, Jon; Tisserand, Patrick; White, Marc C.; Yuan, Fang
2018-02-01
We present the first data release of the SkyMapper Southern Survey, a hemispheric survey carried out with the SkyMapper Telescope at Siding Spring Observatory in Australia. Here, we present the survey strategy, data processing, catalogue construction, and database schema. The first data release dataset includes over 66 000 images from the Shallow Survey component, covering an area of 17 200 deg2 in all six SkyMapper passbands uvgriz, while the full area covered by any passband exceeds 20 000 deg2. The catalogues contain over 285 million unique astrophysical objects, complete to roughly 18 mag in all bands. We compare our griz point-source photometry with Pan-STARRS1 first data release and note an RMS scatter of 2%. The internal reproducibility of SkyMapper photometry is on the order of 1%. Astrometric precision is better than 0.2 arcsec based on comparison with Gaia first data release. We describe the end-user database, through which data are presented to the world community, and provide some illustrative science queries.
Okoh, Daniel; Rabiu, Babatunde; Shiokawa, Kazuo; Otsuka, Yuichi; Segun, Bolaji; Falayi, Elijah; Onwuneme, Sylvester; Kaka, Rafiat
2017-12-01
This is the first paper that reports the occurrence frequency of equatorial plasma bubbles and their dependences of local time, season, and geomagnetic activity based on airglow imaging observations at West Africa. The all-sky imager, situated in Abuja (Geographic: 8.99°N, 7.38°E; Geomagnetic: 1.60°S), has a 180° fisheye view covering almost the entire airspace of Nigeria. Plasma bubbles are observed for 70 nights of the 147 clear-sky nights from 9 June 2015 to 31 January 2017. Differences between nighttime and daytime ROTIs were also computed as a proxy of plasma bubbles using Global Navigation Satellite Systems (GNSS) receivers within the coverage of the all-sky imager. Most plasma bubble occurrences are found during equinoxes and least occurrences during solstices. The occurrence rate of plasma bubbles was highest around local midnight and lower for hours farther away. Most of the postmidnight plasma bubbles were observed around the months of December to March, a period that coincides with the harmattan period in Nigeria. The on/off status of plasma bubble in airglow and GNSS observations were in agreement for 67.2% of the total 768 h, while we suggest several reasons responsible for the remaining 32.8% when the airglow and GNSS bubble status are inconsistent. A majority of the plasma bubbles were observed under relatively quiet geomagnetic conditions (Dst ≥ -40 and Kp ≤ 3), but there was no significant pattern observed in the occurrence rate of plasma bubbles as a function of geomagnetic activity. We suggest that geomagnetic activities could have either suppressed or promoted the occurrence of plasma bubbles.
Five years of Project META - An all-sky narrow-band radio search for extraterrestrial signals
Horowitz, Paul; Sagan, Carl
1993-01-01
We have conducted a five-year search of the northern sky (delta between 30 and 60 deg) for narrow-band radio signals near the 1420 MHz line of neutral hydrogen, and its second harmonic, using an 8.4 x 10 exp 6 channel Fourier spectrometer of 0.05 Hz resolution and 400 kHz instantaneous bandwidth. The observing frequency was corrected both for motions with respect to three astronomical inertial frames, and for the effect of Earth's rotation, which provides a characteristic changing Doppler signature for narrow-band signals of extraterrestrial origin. Among the 6 x 10 exp 13 spectral channels searched, we have found 37 candidate events exceeding the average detection threshold of 1.7 x 10 exp -23 W/sq m, none of which was detected upon reobservation. The strongest of these appear to be dominated by rare processor errors. However, the strongest signals that survive culling for terrestrial interference lie in or near the Galactic plane. We describe the search and candidate events, and set limits on the prevalence of supercivilizations transmitting Doppler-precompensated beacons at H I or its second harmonic. We conclude with recommendations for future searches, based upon these findings, and a description of our next-generation search system.
A Survey of Variable Extragalactic Sources with XTE's All Sky Monitor (ASM)
Jernigan, Garrett
1998-01-01
The original goal of the project was the near real-time detection of AGN utilizing the SSC 3 of the ASM on XTE which does a deep integration on one 100 square degree region of the sky. While the SSC never performed sufficiently well to allow the success of this goal, the work on the project has led to the development of a new analysis method for coded aperture systems which has now been applied to ASM data for mapping regions near clusters of galaxies such as the Perseus Cluster and the Coma Cluster. Publications are in preparation that describe both the new method and the results from mapping clusters of galaxies.
Tomographic local 2D analyses of the WISExSuperCOSMOS all-sky galaxy catalogue
Novaes, C. P.; Bernui, A.; Xavier, H. S.; Marques, G. A.
2018-05-01
The recent progress in obtaining larger and deeper galaxy catalogues is of fundamental importance for cosmological studies, especially to robustly measure the large scale density fluctuations in the Universe. The present work uses the Minkowski Functionals (MF) to probe the galaxy density field from the WISExSuperCOSMOS (WSC) all-sky catalogue by performing tomographic local analyses in five redshift shells (of thickness δz = 0.05) in the total range of 0.10 methodology reveals 1 - 3 regions of the GNC maps in each redshift shell with an uncommon behaviour (extreme regions), i.e., p-value < 1.4%. Indeed, the resulting MF curves show signatures that suggest the uncommon behaviour to be associated with the presence of over- or under-densities there, but contamination due to residual foregrounds is not discarded. Additionally, even though our analyses indicate a good agreement among data and simulations, we identify 1 highly extreme region, seemingly associated to a large clustered distribution of galaxies. Our results confirm the usefulness of the MF to analyse GNC maps from photometric galaxy datasets.
Long term variability of Cygnus X-1. V. State definitions with all sky monitors
Grinberg, V.; Hell, N.; Pottschmidt, K.; Böck, M.; Nowak, M. A.; Rodriguez, J.; Bodaghee, A.; Cadolle Bel, M.; Case, G. L.; Hanke, M.; Kühnel, M.; Markoff, S. B.; Pooley, G. G.; Rothschild, R. E.; Tomsick, J. A.; Wilson-Hodge, C. A.; Wilms, J.
2013-06-01
We present a scheme for determining the spectral state of the canonical black hole Cyg X-1 using data from previous and current X-ray all sky monitors (RXTE-ASM, Swift-BAT, MAXI, and Fermi-GBM). Determinations of the hard/intermediate and soft state agree to better than 10% between different monitors, facilitating the determination of the state and its context for any observation of the source, potentially over the lifetimes of different individual monitors. A separation of the hard and the intermediate states, which strongly differ in their spectral shape and short-term timing behavior, is only possible when data in the soft X-rays (probability of Cyg X-1 remaining in a given state for at least one week to be larger than 85% in the hard state and larger than 75% in the soft state. Intermediate states are short lived, with a 50% probability that the source leaves the intermediate state within three days. Reliable detection of these potentially short-lived events is only possible with monitor data that have a time resolution better than 1 d.
Curnow, Paul
2009-06-01
Aboriginal Australians have been viewing the night skies of Australia for some 45,000 years and possibly much longer. During this time they have been able to develop a complex knowledge of the night sky, the terrestrial environment in addition to seasonal changes. However, few of us in contemporary society have an in-depth knowledge of the nightly waltz of stars above.
Full-sky formulae for weak lensing power spectra from total angular momentum method
International Nuclear Information System (INIS)
Yamauchi, Daisuke; Taruya, Atsushi; Namikawa, Toshiya
2013-01-01
We systematically derive full-sky formulae for the weak lensing power spectra generated by scalar, vector and tensor perturbations from the total angular momentum (TAM) method. Based on both the geodesic and geodesic deviation equations, we first give the gauge-invariant expressions for the deflection angle and Jacobi map as observables of the CMB lensing and cosmic shear experiments. We then apply the TAM method, originally developed in the theoretical studies of CMB, to a systematic derivation of the angular power spectra. The TAM representation, which characterizes the total angular dependence of the spatial modes projected along a line-of-sight, can carry all the information of the lensing modes generated by scalar, vector, and tensor metric perturbations. This greatly simplifies the calculation, and we present a complete set of the full-sky formulae for angular power spectra in both the E-/B-mode cosmic shear and gradient-/curl-mode lensing potential of deflection angle. Based on the formulae, we give illustrative examples of non-vanishing B-mode cosmic shear and curl-mode of deflection angle in the presence of the vector and tensor perturbations, and explicitly compute the power spectra
Buick, Tony
2010-01-01
The world is full of color, from the blue ocean and the yellow daffodils and sunflowers in green carpeted meadows to the majestic purple mountains in the distance and brightly hued coral reefs off the edges of tropical coasts. But what is color, exactly? Why do we see things in different colors? Do we all see the same colors? Like the surface of our planet, the sky above us offers us an endless palette of color, a visual feast for the eyes. Besides atmospheric phenomena such as sunsets and rainbows, there are the many varied worlds of the Solar System, which we can spy through our telescopes, with their subtle colorings of beige and blue and green. Faraway star systems have suns that come in shades ranging from red and yellow to blue and white. Scientists even often use "false colors" to enhance the features of images they take of structures, such as the rings of Saturn and Jupiter’s clouds. This book, with its clear explanations of what makes the sky such a colorful place and in its great wealth of picture...
DEFF Research Database (Denmark)
Poutanen, T.; Natoli, P.; Polenta, G.
2011-01-01
An all sky map of the apparent temperature and optical depth of thermal dust emission is constructed using the Planck-HFI (350μm to 2 mm) andIRAS(100μm) data. The optical depth maps are correlated with tracers of the atomic (Hi) and molecular gas traced by CO. The correlation with the column dens...
Thermography hogging the limelight at Big Sky
Energy Technology Data Exchange (ETDEWEB)
Plastow, C. [Fluke Electronics Canada, Mississauga, ON (Canada)
2010-02-15
The high levels of humidity and ammonia found at hog farms can lead to premature corrosion of electrical systems and create potential hazards, such as electrical fires. Big Sky Farms in Saskatchewan has performed on-site inspections at its 44 farms and 16 feed mills using handheld thermography technology from Fluke Electronics. Ti thermal imaging units save time and simplify inspections. The units could be used for everything, from checking out the bearings at the feed mills to electrical circuits and relays. The Ti25 is affordable and has the right features for a preventative maintenance program. Operators of Big Sky Farms use the Ti25 to inspect all circuit breakers of 600 volts or lower as well as transformers where corrosion often causes connections to break off. The units are used to look at bearings, do scanning and thermal imaging on motors. To date, the Ti25 has detected and highlighted 5 or 6 problems on transformers alone that could have been major issues. At one site, the Ti25 indicated that all 30 circuit breakers had loose connections and were overeating. Big Sky Farms fixed the problem right away before a disaster happened. In addition to reducing inspection times, the Ti25 can record all measurements and keep a record of all the readings for downloading. 2 figs.
Light-pollution measurement with the Wide-field all-sky image analyzing monitoring system
Vítek, S.
2017-07-01
The purpose of this experiment was to measure light pollution in the capital of Czech Republic, Prague. As a measuring instrument is used calibrated consumer level digital single reflex camera with IR cut filter, therefore, the paper reports results of measuring and monitoring of the light pollution in the wavelength range of 390 - 700 nm, which most affects visual range astronomy. Combining frames of different exposure times made with a digital camera coupled with fish-eye lens allow to create high dynamic range images, contain meaningful values, so such a system can provide absolute values of the sky brightness.
Causality and skies: is non-refocussing necessary?
International Nuclear Information System (INIS)
Bautista, A; Ibort, A; Lafuente, J
2015-01-01
The causal structure of a strongly causal, null pseudo-convex, space-time M is completely characterized in terms of a partial order on its space of skies defined by means of a class of non-negative Legendrian isotopies called sky isotopies. It is also shown that such partial order is determined by the class of future causal celestial curves, that is, curves in the space of light rays which are tangent to skies and such that they determine non-negative sky isotopies. It will also be proved that the space of skies Σ equipped with Low’s (or reconstructive) topology is homeomorphic and diffeomorphic to M under the only additional assumption that M separates skies, that is, that different events determine different skies. The sky-separating property of M is sharp and the previous result provides an answer to the question about the class of space-times whose causal structure, topological and differentiable structure can be reconstructed from their spaces of light rays and skies. These results can be understood as a Malament–Hawking-like theorem stated in terms of the partial order defined on the space of skies. (paper)
All-sky LIGO search for periodic gravitational waves in the early fifth-science-run data.
Abbott, B P; Abbott, R; Adhikari, R; Ajith, P; Allen, B; Allen, G; Amin, R S; Anderson, S B; Anderson, W G; Arain, M A; Araya, M; Armandula, H; Armor, P; Aso, Y; Aston, S; Aufmuth, P; Aulbert, C; Babak, S; Baker, P; Ballmer, S; Bantilan, H; Barish, B C; Barker, C; Barker, D; Barr, B; Barriga, P; Barsotti, L; Barton, M A; Bartos, I; Bassiri, R; Bastarrika, M; Behnke, B; Benacquista, M; Betzwieser, J; Beyersdorf, P T; Bilenko, I A; Billingsley, G; Biswas, R; Black, E; Blackburn, J K; Blackburn, L; Blair, D; Bland, B; Bodiya, T P; Bogue, L; Bork, R; Boschi, V; Bose, S; Brady, P R; Braginsky, V B; Brau, J E; Brinkmann, M; Brooks, A F; Brown, D A; Brunet, G; Bullington, A; Buonanno, A; Burmeister, O; Byer, R L; Cadonati, L; Cagnoli, G; Camp, J B; Cannizzo, J; Cannon, K C; Cao, J; Cardenas, L; Cardoso, V; Caride, S; Casebolt, T; Castaldi, G; Caudill, S; Cavaglià, M; Cepeda, C; Chalkley, E; Charlton, P; Chatterji, S; Chelkowski, S; Chen, Y; Christensen, N; Clark, D; Clark, J; Clayton, J H; Cokelaer, T; Conte, R; Cook, D; Corbitt, T R C; Cornish, N; Coyne, D C; Creighton, J D E; Creighton, T D; Cruise, A M; Cumming, A; Cunningham, L; Cutler, R M; Danzmann, K; Daudert, B; Davies, G; Debra, D; Degallaix, J; Dergachev, V; Desai, S; Desalvo, R; Dhurandhar, S; Díaz, M; Dickson, J; Dietz, A; Donovan, F; Dooley, K L; Doomes, E E; Drever, R W P; Duke, I; Dumas, J-C; Dwyer, J; Echols, C; Edgar, M; Effler, A; Ehrens, P; Ely, G; Espinoza, E; Etzel, T; Evans, M; Evans, T; Fairhurst, S; Faltas, Y; Fan, Y; Fazi, D; Fejer, M M; Finn, L S; Flasch, K; Foley, S; Forrest, C; Fotopoulos, N; Franzen, A; Frei, Z; Freise, A; Frey, R; Fricke, T T; Fritschel, P; Frolov, V V; Fyffe, M; Garofoli, J A; Gholami, I; Giaime, J A; Giampanis, S; Giardina, K D; Goda, K; Goetz, E; Goggin, L M; González, G; Gossler, S; Gouaty, R; Grant, A; Gras, S; Gray, C; Gray, M; Greenhalgh, R J S; Gretarsson, A M; Grimaldi, F; Grosso, R; Grote, H; Grunewald, S; Guenther, M; Gustafson, E K; Gustafson, R; Hage, B; Hallam, J M; Hanna, C; Hanson, J; Harms, J; Harry, G M; Harstad, E D; Haughian, E; Hayama, K; Hayler, T; Heefner, J; Heng, I S; Heptonstall, A; Hewitson, M; Hild, S; Hirose, E; Hoak, D; Holt, K; Hosken, D; Hough, J; Huttner, S H; Ingram, D; Ito, M; Ivanov, A; Johnson, B; Johnson, W W; Jones, D I; Jones, G; Jones, R; Ju, L; Kalmus, P; Kalogera, V; Kamat, S; Kanner, J; Kasprzyk, D; Katsavounidis, E; Kawabe, K; Kawamura, S; Kawazoe, F; Kells, W; Keppel, D G; Khalaidovski, A; Khalili, F Ya; Khan, R; Khazanov, E; King, P; Kissel, J S; Klimenko, S; Kocsis, B; Kokeyama, K; Kondrashov, V; Kopparapu, R; Koranda, S; Kozak, D; Kozhevatov, I; Krishnan, B; Kwee, P; Landry, M; Lantz, B; Lazzarini, A; Lei, M; Leonor, I; Li, C; Lin, H; Lindquist, P E; Littenberg, T B; Lockerbie, N A; Lodhia, D; Lormand, M; Lu, P; Lubinski, M; Lucianetti, A; Lück, H; Machenschalk, B; Macinnis, M; Mageswaran, M; Mailand, K; Mandel, I; Mandic, V; Márka, S; Márka, Z; Markosyan, A; Markowitz, J; Maros, E; Martin, I W; Martin, R M; Marx, J N; Mason, K; Matichard, F; Matone, L; Matzner, R; Mavalvala, N; McCarthy, R; McClelland, D E; McGuire, S C; McHugh, M; McIntyre, G; McKechan, D; McKenzie, K; Mehmet, M; Melissinos, A; Mendell, G; Mercer, R A; Meshkov, S; Messenger, C J; Meyers, D; Miller, A; Miller, J; Minelli, J; Mitra, S; Mitrofanov, V P; Mitselmakher, G; Mittleman, R; Miyakawa, O; Moe, B; Mohanty, S D; Moreno, G; Mors, K; Mossavi, K; Mowlowry, C; Mueller, G; Muhammad, D; Mukherjee, S; Mukhopadhyay, H; Mullavey, A; Müller-Ebhardt, H; Munch, J; Murray, P G; Myers, E; Myers, J; Nash, T; Nelson, J; Newton, G; Nishizawa, A; Numata, K; Ochsner, E; O'Dell, J; Ogin, G; O'Reilly, B; O'Shaughnessy, R; Ottaway, D J; Ottens, R S; Overmier, H; Owen, B J; Pan, Y; Pankow, C; Papa, M A; Parameshwaraiah, V; Patel, P; Pedraza, M; Penn, S; Perraca, A; Petrie, T; Pinto, I M; Pitkin, M; Pletsch, H J; Plissi, M V; Postiglione, F; Principe, M; Prix, R; Quetschke, V; Raab, F J; Rabeling, D S; Radkins, H; Raffai, P; Rainer, N; Rakhmanov, M; Ramsunder, M; Reed, T; Rehbein, H; Reid, S; Reitze, D H; Riesen, R; Riles, K; Rivera, B; Robertson, N A; Robinson, C; Robinson, E L; Roddy, S; Rogan, A M; Rollins, J; Romano, J D; Romie, J H; Rowan, S; Rüdiger, A; Ruet, L; Russell, P; Ryan, K; Sakata, S; Sancho de la Jordana, L; Sandberg, V; Sannibale, V; Santamaria, L; Saraf, S; Sarin, P; Sathyaprakash, B S; Sato, S; Saulson, P R; Savage, R; Savov, P; Scanlan, M; Schediwy, S W; Schilling, R; Schnabel, R; Schofield, R; Schutz, B F; Schwinberg, P; Scott, J; Scott, S M; Searle, A C; Sears, B; Seifert, F; Sellers, D; Sengupta, A S; Sergeev, A; Shapiro, B; Shawhan, P; Shoemaker, D H; Sibley, A; Siemens, X; Sigg, D; Sinha, S; Sintes, A M; Slagmolen, B J J; Slutsky, J; Smith, J R; Smith, M R; Smith, N D; Somiya, K; Sorazu, B; Stein, L C; Strain, K A; Stuver, A; Summerscales, T Z; Sun, K-X; Sung, M; Sutton, P J; Takahashi, H; Tanner, D B; Taylor, R; Taylor, R; Thacker, J; Thorne, K A; Thorne, K S; Thüring, A; Tokmakov, K V; Torres, C; Torrie, C; Traylor, G; Trias, M; Ugolini, D; Urbanek, K; Vahlbruch, H; Van Den Broeck, C; van der Sluys, M V; van Veggel, A A; Vass, S; Vaulin, R; Vecchio, A; Veitch, J D; Veitch, P; Villar, A; Vorvick, C; Vyachanin, S P; Waldman, S J; Wallace, L; Ward, H; Ward, R L; Weinert, M; Weinstein, A J; Weiss, R; Wen, L; Wen, S; Wette, K; Whelan, J T; Whitcomb, S E; Whiting, B F; Wilkinson, C; Willems, P A; Williams, H R; Williams, L; Willke, B; Wilmut, I; Winkler, W; Wipf, C C; Wiseman, A G; Woan, G; Wooley, R; Worden, J; Wu, W; Yakushin, I; Yamamoto, H; Yan, Z; Yoshida, S; Zanolin, M; Zhang, J; Zhang, L; Zhao, C; Zotov, N; Zucker, M E; Zur Mühlen, H; Zweizig, J
2009-03-20
We report on an all-sky search with the LIGO detectors for periodic gravitational waves in the frequency range 50-1100 Hz and with the frequency's time derivative in the range -5 x 10{-9}-0 Hz s{-1}. Data from the first eight months of the fifth LIGO science run (S5) have been used in this search, which is based on a semicoherent method (PowerFlux) of summing strain power. Observing no evidence of periodic gravitational radiation, we report 95% confidence-level upper limits on radiation emitted by any unknown isolated rotating neutron stars within the search range. Strain limits below 10{-24} are obtained over a 200-Hz band, and the sensitivity improvement over previous searches increases the spatial volume sampled by an average factor of about 100 over the entire search band. For a neutron star with nominal equatorial ellipticity of 10{-6}, the search is sensitive to distances as great as 500 pc.
Walker, Constance E.
2009-05-01
The arc of the Milky Way seen from a truly dark location is part of our planet's natural heritage. More than one fifth of the world population, two thirds of the United States population and one half of the European Union population have already lost naked eye visibility of the Milky Way. This loss, caused by light pollution, is a serious and growing issue that impacts astronomical research, the economy, ecology, energy conservation, human health, public safety and our shared ability to see the night sky. For this reason, "Dark Skies” is a cornerstone project of the International Year of Astronomy. Its goal is to raise public awareness of the impact of artificial lighting on local environments by getting people worldwide involved in a variety of programs that: 1. Teach about dark skies using new technology (e.g., an activity-based planetarium show on DVD, podcasting, social networking on Facebook and MySpace, a Second Life presence) 2. Provide thematic events on light pollution at star parties and observatory open houses (Dark Skies Discovery Sites, Nights in the (National) Parks, Sidewalk Astronomy) 3. Organize events in the arts (e.g., a photography contest) 4. Involve citizen-scientists in naked-eye and digital-meter star hunting programs (e.g., GLOBE at Night, "How Many Stars?", the Great World Wide Star Count and the radio frequency interference equivalent: "Quiet Skies") and 5. Raise awareness about the link between light pollution and public health, economic issues, ecological consequences, energy conservation, safety and security, and astronomy (e.g., The Starlight Initiative, World Night in Defense of Starlight, International Dark Sky Week, International Dark-Sky Communities, Earth Hour, The Great Switch Out, a traveling exhibit, downloadable posters and brochures). The presentation will provide an update, describe how people can become involved and take a look ahead at the program's sustainability. For more information, visit www.darkskiesawareness.org.
Directory of Open Access Journals (Sweden)
N. C. Maynard
2006-11-01
Full Text Available We combine in situ measurements from Cluster with high-resolution 557.7 nm all-sky images from South Pole to investigate the spatial and temporal evolution of merging on the dayside magnetopause. Variations of 557.7 nm emissions were observed at a 6 s cadence at South Pole on 29 April 2003 while significant changes in the Interplanetary Magnetic Field (IMF clock angle were reaching the magnetopause. Electrons energized at merging sites are the probable sources for 557.7 nm cusp emissions. At the same time Cluster was crossing the pre-noon cusp in the Northern Hemisphere. The combined observations confirm results of a previous study that merging events can occur at multiple sites simultaneously and vary asynchronously on time scales of 10 s to 3 min (Maynard et al., 2004. The intensity of the emissions and the merging rate appear to vary with changes in the IMF clock angle, IMF BX and the dynamic pressure of the solar wind. Most poleward moving auroral forms (PMAFs reflect responses to changes in interplanetary medium rather than to local processes. The changes in magnetopause position required by increases in dynamic pressure are mediated by merging and result in the generation of PMAFs. Small (15–20% variations in dynamic pressure of the solar wind are sufficient to launch PMAFs. Changes in IMF BX create magnetic flux compressions and rarefactions in the solar wind. Increases (decreases in IMF BX strengthens |B| near northern (southern hemisphere merging sites thereby enhancing merging rates and triggering PMAFs. When correlating responses in the two hemispheres, the presence of significant IMF BX also requires that different lag-times be applied to ACE measurements acquired ~0.1 AU upstream of Earth. Cluster observations set lag times for merging at Northern Hemisphere sites; post-noon optical emissions set times of Southern Hemisphere merging. All-sky images and magnetohydrodynamic simulations indicate that merging occurs in multiple
IS THE TWO MICRON ALL SKY SURVEY CLUSTERING DIPOLE CONVERGENT?
International Nuclear Information System (INIS)
Bilicki, Maciej; Chodorowski, Michal; Jarrett, Thomas; Mamon, Gary A.
2011-01-01
There is a long-standing controversy about the convergence of the dipole moment of the galaxy angular distribution (the so-called clustering dipole). Is the dipole convergent at all, and if so, what is the scale of the convergence? We study the growth of the clustering dipole of galaxies as a function of the limiting flux of the sample from the Two Micron All Sky Survey (2MASS). Contrary to some earlier claims, we find that the dipole does not converge before the completeness limit of the 2MASS Extended Source Catalog, i.e., up to 13.5 mag in the near-infrared K s band (equivalent to an effective distance of 300 Mpc h -1 ). We compare the observed growth of the dipole with the theoretically expected, conditional one (i.e., given the velocity of the Local Group relative to the cosmic microwave background), for the ΛCDM power spectrum and cosmological parameters constrained by the Wilkinson Microwave Anisotropy Probe. The observed growth turns out to be within 1σ confidence level of its theoretical counterpart once the proper observational window of the 2MASS flux-limited catalog is included. For a contrast, if the adopted window is a top hat, then the predicted dipole grows significantly faster and converges (within the errors) to its final value for a distance of about 300 Mpc h -1 . By comparing the observational windows, we show that for a given flux limit and a corresponding distance limit, the 2MASS flux-weighted window passes less large-scale signal than the top-hat one. We conclude that the growth of the 2MASS dipole for effective distances greater than 200 Mpc h -1 is only apparent. On the other hand, for a distance of 80 Mpc h -1 (mean depth of the 2MASS Redshift Survey) and the ΛCDM power spectrum, the true dipole is expected to reach only ∼80% of its final value. Eventually, since for the window function of 2MASS the predicted growth is consistent with the observed one, we can compare the two to evaluate β ≡ Ω m 0.55 /b. The result is β = 0.38
Dark Skies as a Universal Resource: Citizen Scientists Measuring Sky Brightness
Walker, C. E.; Isbell, D.; Pompea, S. M.
2007-12-01
The international star-hunting event known as GLOBE at Night returned March 8-21, 2007 in two flavors: the classic GLOBE at Night activity incorporating unaided-eye observations which debuted last year, and a new effort to obtain precise measurements of urban dark skies using digital sky-brightness meters. Both flavors of the program were designed to aid in heightening the awareness about the impact of artificial lighting on local environments, and the ongoing loss of a dark night sky as a natural resource for much of the world's population. To make possible the digital GLOBE at Night program, NSF funded 135 low-cost, digital sky-quality meter (manufactured by Unihedron). With these, citizen-scientists took direct measurements of the integrated sky brightness across a wide swath of night sky. Along with related materials developed by the National Optical Astronomy Observatory (NOAO), the meters were distributed to citizen-scientists in 21 U.S. states plus Washington DC, and in 5 other countries, including Chile, where NOAO has a major observatory. The citizen- scientists were selected from teachers, their students, astronomers at mountain-top observatories, International Dark-Sky Association members and staff from 19 small science centers. Most sites had a coordinator, who instructed local educators in the proper use of the meters and develop a plan to share them as widely as possible during the 2-week window. The local teams pooled their data for regional analysis and in some cases shared the results with their schools and local policymakers. Building upon the worldwide participation sparked by the first GLOBE at Night campaign in March 2006, the observations this year approached 8500 (from 60 countries), 85% higher than the number from last year. The success of GLOBE at Night 2007 is a major step toward the International Year of Astronomy in 2009, when one goal is to make the digital data collection into a worldwide activity. In this presentation, we will outline
The First Data Release of the All-sky NOAO Source Catalog
Nidever, David L.; NOAO Data Lab
2018-06-01
Roughly three quarters of the sky has been imaged with NOAO's telescopes from both hemispheres. While the large majority of these data were obtained for PI-led projects and surveys only a fraction have been released to the community via well-calibrated and easily accessible catalogs. We have remedied this by creating a catalog of sources from most of the public data taken on CTIO-4m+DECam as well as KPNO 4m+Mosaic3. The first data release (DR1) of this catalog, called the NOAO Source Catalog (NSC), contains 2.9 billion unique objects, 34 billion individual measurements, covers ~30,000 square degrees, has depths of ~23rd magnitude in most broadband filters with ~1-2% photometric accuracy and astrometric accuracy of ~2 mas. The NSC will be useful for exploring stellar streams, dwarf satellite galaxies, distant galaxies as well as variable stars and other transients. DR1 is now available through the NOAO Data Lab (datalab.noao.edu).
Deep sky observing an astronomical tour
Coe, Steven R
2016-01-01
This updated second edition has all of the information needed for your successful forays into deep sky observing. Coe uses his years of experience to give detailed practical advice about how to find the best observing site, how to make the most of the time spent there, and what equipment and instruments to take along. There are comprehensive lists of deep sky objects of all kinds, along with Steve's own observations describing how they look through telescopes with apertures ranging from 4 inches to 36 inches (0.1 - 0.9 meters). Binocular observing also gets its due, while the lists of objects have been amended to highlight only the best targets. A new index makes finding targets easier than ever before, while the selection of viewing targets has been revised from the first edition. Most of all, this book is all about how to enjoy astronomy. The author's enthusiasm and sense of wonder shine through every page as he invites you along on a tour of some of the most beautiful and fascinating sites in the deep ...
Next Generation Science Standards: All Standards, All Students
Lee, Okhee; Miller, Emily C.; Januszyk, Rita
2014-01-01
The Next Generation Science Standards (NGSS) offer a vision of science teaching and learning that presents both learning opportunities and demands for all students, particularly student groups that have traditionally been underserved in science classrooms. The NGSS have addressed issues of diversity and equity from their inception, and the NGSS…
Light pollution: Assessment of sky glow on two dark sky regions of Portugal.
Lima, Raul Cerveira; Pinto da Cunha, José; Peixinho, Nuno
2016-01-01
Artificial light at night (ALAN), producing light pollution (LP), is not a matter restricted to astronomy anymore. Light is part of modern societies and, as a consequence, the natural cycle day-night (bright-dark) has been interrupted in a large segment of the global population. There is increasing evidence that exposure to certain types of light at night and beyond threshold levels may produce hazardous effects to humans and the environment. The concept of "dark skies reserves" is a step forward in order to preserve the night sky and a means of enhancing public awareness of the problem of spread of light pollution worldwide. The aim of this study was to assess the skyglow at two sites in Portugal, the Peneda-Gerês National Park (PNPG) and the region now known as Dark Sky Alqueva Reserve. The latter site was classified as a "Starlight Tourism Destination" by the Starlight Foundation (the first in the world to achieve this classification) following a series of night sky measurements in situ described herein. The measurements at PNPG also contributed to the new set of regulations concerning light pollution at this national park. This study presents the first in situ systematic measurements of night sky brightness, showing that at the two sites the skies are mostly in levels 3 to 4 of the Bortle 9-level scale (with level 1 being the best achievable). The results indicate that the sources of light pollution and skyglow can be attributed predominantly to contamination from nearby urban regions.
Education for Life in the Sky.
Roth, Charles E.
1981-01-01
The need to educate people about the sky as both a psychological and physical environment is discussed, including a formal curriculum schema (sky as habitat, sky as transport, influence on culture) and informal curriculum, with such topics as recreation, pollution, mythology, and clouds. (DC)
Patricelli, B.; Stamerra, A.; Razzano, M.; Pian, E.; Cella, G.
2018-05-01
The merger of binary neutron star (BNS) systems are predicted to be progenitors of short gamma-ray bursts (GRBs); the definitive probe of this association came with the recent detection of gravitational waves (GWs) from a BNS merger by Advanced LIGO and Advanced Virgo (GW170817), in coincidence with the short GRB 170817A observed by Fermi-GBM and INTEGRAL. Short GRBs are also expected to emit very-high energy (VHE, > 10S0 GeV) photons and VHE electromagnetic (EM) upper limits have been set with observations performed by ground-based gamma-ray detectors and during the intense EM follow-up campaign associated with GW170817/GRB 170817A. In the next years, the searches for VHE EM counterparts will become more effective thanks to the Cherenkov Telescope Array (CTA): this instrument will be fundamental for the EM follow-up of transient GW events at VHE, owing to its unprecedented sensitivity, rapid response (few tens of seconds) and capability to monitor large sky areas via survey-mode operation. We present a comprehensive study on the prospects for joint GW and VHE EM observations of merging BNSs with Advanced LIGO, Advanced Virgo and CTA, based on detailed simulations of the multi-messenger emission and detection. We propose a new observational strategy optimized on the prior assumptions about the EM emission. The method can be further generalized to include other electromagnetic emission models. According to this study CTA will cover most of the region of the GW skymap for the intermediate and most energetic on-axis GRBs associated to the GW event. We estimate the expected joint GW and VHE EM detection rates and we found this rate goes from 0.08 up to 0.5 events per year for the most energetic EM sources.
Dark Skies Awareness Cornerstone Project for the International Year of Astronomy
Walker, C. E.; Pompea, S. M.; Iya Dark Skies Awareness Working Group
2010-12-01
Programs that were part of the International Year of Astronomy 2009 (IYA2009) Dark Skies Awareness (DSA) Cornerstone Project have been successfully implemented around the world to promote social awareness of the effects of light pollution on public health, economic issues, ecological consequences, energy conservation, safety and security, nightscape aesthetics and especially astronomy. In developing the programs, DSA Cornerstone Project found that to influence cultural change effectively — to make people literally look up and see the light — we must make children a main focus, use approaches that offer involvement on many levels, from cursory to committed, and offer involvement via many venues. We must make the programs and resources as turn-key as possible, especially for educators — and provide ways to visualize the problem with simple, easily grasped demonstrations. The programs spanned a wide range; from new media technology for the younger generation, to an event in the arts, to various types of educational materials, to the promotion of dark skies communities, to national and international events and to global citizen science programs. The DSA Cornerstone Project is continuing most all of these programs beyond IYA2009. The International Dark-Sky Association as well as the Starlight Initiative is endorsing and helping to continue with some of the most successful programs from the DSA. The GLOBE at Night campaign is adding a research component that examines light pollution’s affects on wildlife. Dark Skies Rangers activities are being implemented in Europe through the Galileo Teacher Training Program. The new “One Star at a Time” will engage people to protect the night sky through personal pledges and registration of public stargazing areas or StarParks, like the newest one in Italy. The Starlight Initiative’s World Night in Defence of the Starlight will take place on the Vernal Equinox. DSA will again oversee the Dark Skies portion of Global
NASA Science Engagement Through "Sky Art"
Bethea, K. L.; Damadeo, K.
2013-12-01
Sky Art is a NASA-funded online community where the public can share in the beauty of nature and the science behind it. At the center of Sky Art is a gallery of amateur sky photos submitted by users that are related to NASA Earth science mission research areas. Through their submissions, amateur photographers from around the world are engaged in the process of making observations, or taking pictures, of the sky just like many NASA science instruments. By submitting their pictures and engaging in the online community discussions and interactions with NASA scientists, users make the connection between the beauty of nature and atmospheric science. Sky Art is a gateway for interaction and information aimed at drawing excitement and interest in atmospheric phenomena including sunrises, sunsets, moonrises, moonsets, and aerosols, each of which correlates to a NASA science mission. Educating the public on atmospheric science topics in an informal way is a central goal of Sky Art. NASA science is included in the community through interaction from scientists, NASA images, and blog posts on science concepts derived from the images. Additionally, the website connects educators through the formal education pathway where science concepts are taught through activities and lessons that align with national learning standards. Sky Art was conceived as part of the Education and Public Outreach program of the SAGE III on ISS mission. There are currently three other NASA mission involved with Sky Art: CALIPSO, GPM, and CLARREO. This paper will discuss the process of developing the Sky Art online website, the challenges of growing a community of users, as well as the use of social media and mobile applications in science outreach and education.
Instrumentation for comparing night sky quality and atmospheric conditions of CTA site candidates
International Nuclear Information System (INIS)
Fruck, C.; Schweizer, T.; Häfner, D.; Lorentz, E.; Teshima, M.; Gaug, M.; Ernenwein, J.-P.; Costantini, H.; Mandát, D.; Pech, M.; Bulik, T.; Cieslar, M.; Dominik, M.; Ebr, J.; Garczarczyk, M.; Pareschi, G.; Puerto-Giménez, I.
2015-01-01
Many atmospheric and climatic criteria have to be taken into account for the selection of a suitable site for the next generation of imaging air-shower Cherenkov telescopes, the ''Cherenkov Telescope Array'' CTA. Such data are not available with sufficient precision, thus a comparison of the proposed sites and final decision based on a comprehensive characterization is impossible. Identical cross-calibrated instruments have been developed which allow for precise comparison between sites, the cross-validation of existing data, and the ground-validation of satellite data. The site characterization work package of the CTA consortium opted to construct and deploy 9 copies of an autonomous multi-purpose weather sensor, incorporating an infrared cloud sensor, a newly developed sensor for measuring the light of the night sky, and an All-Sky-Camera, the whole referred to as Autonomous Tool for Measuring Observatory Site COnditions PrEcisely (ATMOSCOPE). We present here the hardware that was combined into the ATMOSCOPE and characterize its performance
Secrets to Successful Earth and Sky Photography
Tafreshi, Babak A.
In the absolute silence of a desert night, surrounded by an arena of celestial beauties, a gentle breeze shifts the tiny grains of sand around me. There is a patchy glow of light visible all across the eastern horizon. It is gradually ascending over the sand dunes. The glow represents billions of stars in our home galaxy rising above the horizon of our planet. I have seen such dream-like starry scenes from many locations; from the boundless dark skies of the African Sahara when the summer Milky Way was arching over giant sandstones, to the shimmering beauty of the Grand Canyon under moonlight, and the transparent skies of the Himalayas when the bright stars of winter were rising above where the highest peak on Earth (Mt. Everest) meets the sky. These are forever-engraved moments in my memory. Astrophotography is not only about recording the celestial world. It can lead you to a life of adventure and discovery (Fig. 1).
Martinis, C.; Baumgardner, J.; Wroten, J.; Mendillo, M.
2018-04-01
Optical signatures of ionospheric disturbances exist at all latitudes on Earth-the most well known case being visible aurora at high latitudes. Sub-visual emissions occur equatorward of the auroral zones that also indicate periods and locations of severe Space Weather effects. These fall into three magnetic latitude domains in each hemisphere: (1) sub-auroral latitudes ∼40-60°, (2) mid-latitudes (20-40°) and (3) equatorial-to-low latitudes (0-20°). Boston University has established a network of all-sky-imagers (ASIs) with sites at opposite ends of the same geomagnetic field lines in each hemisphere-called geomagnetic conjugate points. Our ASIs are autonomous instruments that operate in mini-observatories situated at four conjugate pairs in North and South America, plus one pair linking Europe and South Africa. In this paper, we describe instrument design, data-taking protocols, data transfer and archiving issues, image processing, science objectives and early results for each latitude domain. This unique capability addresses how a single source of disturbance is transformed into similar or different effects based on the unique "receptor" conditions (seasonal effects) found in each hemisphere. Applying optical conjugate point observations to Space Weather problems offers a new diagnostic approach for understanding the global system response functions operating in the Earth's upper atmosphere.
Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acemese, F.; Ackley, K.; Adams, C.; Phythian-Adams, A.T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwa, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allocca, A.; Altin, P. A.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Babak, S.; Bacon, P.; Bader, M. K. M.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Arker, Bd.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Bejger, M.; Be, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Birch, M.J.; Birney, R.; Biscans, S.; Bisht, A.; Bitoss, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Boer, M.; Bogaert, J.G.; Bogan, C.; Bohe, A.; Bond, C.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Boutfanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, A.D.; Brown, D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, O.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, C.; Cahillane, C.; Bustillo, J. Calderon; Callister, T. A.; Calloni, E.; Camp, J. B.; Cannon, K. C.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, D. S.; Charlton, P.; Chassande-Mottin, E.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y; Cheng, C.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, S. S. Y.; Chung, S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Cominsky, L.; Constancio, M., Jr.; Conte, A.; Conti, L.; Cook, D.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cumming, A.; Cunningham, Laura; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Darman, N. S.; Dasgupta, A.; Costa, C. F. Da Silva; Dattilo, V.; Dave, I.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; De, S.; DeBra, D.; Debreczeni, G.; Degallaix, J.; De laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.A.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devine, R. C.; Dhurandhar, S.; Diaz, M. C.; Di Fiore, L.; Giovanni, M. Di; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Virgilio, A.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Douglas, R.; Downes, T. P.; Drago, M.; Dreyer, R. W. P.; Driggers, J. C.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Egizenstein, H. -B.; Ehrens, P.; Eichholel, J.; Eikenberry, S. S.; Engels, W.; Essick, R. C.; Etzel, T.; Evans, M.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, O.; Fair, H.; Fairhurst, S.; Fan, X.; Fang, Q.; Farinon, S.; Farr, B.; Far, W. M.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Fenyvesi, E.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.M.; Fournier, J. -D.; Frasca, J. -D; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fritsche, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H. A. G.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garuti, F.; Gaur, G.; Gehrels, N.; Gemme, G.; Geng, P.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gi, K.; Glaetke, A.; Goetz, E.; Goetz, R.; Gondan, L.; Gonzalez, Idelmis G.; Castro, J. M. Gonzalez; Gopakumar, A.; Gordon, N. A.; Gorodetsky, M. L.; Gossan, S. E.; Lee-Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Graff, P. B.; Granata, M.; Granta, A.; Gras, S.; Cray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C. -J.; Haughian, K.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, S.; Hennig, J.; Henry, J.A.; Heptonsta, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Hough, J.; Houston, E. A.; Howel, E. J.; Hu, Y. M.; Huang, O.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J. -M.; Isi, M.; Isogai, T.; Lyer, B. R.; Fzumi, K.; Jaccimin, T.; Jang, D.H.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jian, L.; Jimenez-Forteza, F.; Johnson, W.; Jones, I.D.; Jones, R.; Jones, R.; Jonker, R. J. G.; Ju, L.; Wads, k; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Kapadia, S. J.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kefelian, F.; Keh, M. S.; Keite, D.; Kelley, D. B.; Kells, W.; Kennedy, R.E.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chi-Woong; Kim, Chunglee; Kim, J.; Kim, K.; Kim, Namjun; Kim, W.; Kimbre, S. J.; King, E. J.; King, P. J.; Kisse, J. S.; Klein, B.; Kleybolte, L.; Klimenko, S.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kringe, V.; Krishnan, B.; Krolak, A.; Krueger, C.; Kuehn, G.; Kumar, P.; Kumar, R.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lange, J.; Lantz, B.; Lasky, P. D.; Laxen, M.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C. H.; Lee, K.H.; Lee, M.H.; Lee, K.; Lenon, A.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Lewis, J. B.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Lockerbie, N. A.; Lombardi, A. L.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Liick, H.; Lundgren, A. P.; Lynch, R.; Ivia, Y.; Machenschalk, B.; Maclnnis, M.; Macleod, D. M.; Magafia-Sandoval, F.; Zertuche, L. Magafia; Magee, R. M.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandic, V.; Mangano, V.; Manse, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Marka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matiehard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mende, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Miche, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B.C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, S.D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Murphy, D. J.; Murray, P.G.; Mytidis, A.; Nardecehia, I.; Naticchioni, L.; Nayak, R. K.; Nedkova, K.; Nelemans, G.; Nelson, T. J. N.; Gutierrez-Neri, M.; Neunzert, A.; Newton, G.; Nguyen, T. T.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Hang, S.; Ohme, F.; Oliver, M.; Oppermann, P.; Ram, Richard J.; O'Reilly, B.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.S; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Patrick, Z.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perreca, A.; Perri, L. M.; Phelps, M.; Piccinni, . J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poe, M.; Poggiani, R.; Popolizio, P.; Post, A.; Powel, J.; Prasad, J.; Predoi, V.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, .; Punturo, M.; Purrer, PuppoM.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Reed, C. M.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romanov, G.; Romie, J. H.; Rowan, RosiliskaS.; Ruggi, RiidigerP.; Ryan, K.; Sachdev, Perminder S; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Saulson, P. R.; Sauter, E. S.; Savage, R. L.; Sawadsky, A.; Schale, P.; Schilling, R.; Schmidt, J; Schmidt, P.; Schnabe, R.; Schofield, R. M. S.; Schonbeck, A.; Schreiber, K.E.C.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, S. M.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Setyawati, Y.; Shaddock, D. A.; Shaffer, T. J.; Shahriar, M. S.; Shaltev, M.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Sielleez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, António Dias da; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, R. J. E.; Smith, N.D.; Smith, R. J. E.; Son, E. J.; Sorazus, B.; Sorrentino, F.; Souradeep, T.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strauss, N. A.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sunil, Suns; Sutton, P. J.; Swinkels, B. L.; Szczepariczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tapai, M.; Tarabrin, S. P.; Taracchini, A.; Taylor, W.R.; Theeg, T.; Thirugnanasambandam, M. P.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tomlinson, C.; Tonelli, M.; Tomasi, Z.; Torres, C. V.; Tome, C.; Tot, D.; Travasso, F.; Traylor, G.; Trifire, D.; Tringali, M. C.; Trozz, L.; Tse, M.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Valente, G.; Valdes, G.; van Bake, N.; Van Beuzekom, Martin; Van den Brand, J. F. J.; Van Den Broeck, C.F.F.; Vander-Hyde, D. C.; van der Schaaf, L.; Van Heilningen, J. V.; Van Vegge, A. A.; Vardaro, M.; Vass, S.; Vaslith, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P.J.; Venkateswara, K.; Verkindt, D.; Vetrano, F.; Vicere, A.; Vinciguerra, S.; Vine, D. J.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, MT; Walker, M.; Wallace, L.; Walsh, S.; Vvang, G.; Wang, O.; Wang, X.; Wiang, Y.; Ward, R. L.; Wiarner, J.; Was, M.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Weliels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Williams, D.R.; Williamson, A. R.; Willis, J. L.; WilIke, B.; Wimmer, M. H.; Whinkler, W.; Wipf, C. C.; De Witte, H.; Woan, G.; Woehler, J.; Worden, J.; Wright, J.L.; Wu, D. S.; Wu, G.; Yablon, J.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yu, H.; Yvert, M.; Zadrozny, A.; Zangrando, L.; Zanolin, M.; Zendri, J. P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S.J.; Zhu, X.; Zucker, M. E.; Zuraw, S. E.; Zweizig, J.
2016-01-01
We report results of a deep all-sky search for periodic gravitational waves from isolated neutron stars in data from the S6 LIGO science run. The search was possible thanks to the computing power provided by the volunteers of the Einstein@Home distributed computing project. We find no significant
SKY BRIGHTNESS AND TRANSPARENCY IN THE i-BAND AT DOME A, ANTARCTICA
International Nuclear Information System (INIS)
Zou Hu; Zhou Xu; Jiang Zhaoji; Hu Jingyao; Ma Jun; Ashley, M. C. B.; Luong-Van, D. M.; Storey, J. W. V.; Cui Xiangqun; Feng Longlong; Gong Xuefei; Kulesa, C. A.; Lawrence, J. S.; Liu Genrong; Moore, A. M.; Pennypacker, C. R.; Travouillon, T.; Qin Weijia; Sun Bo; Shang Zhaohui
2010-01-01
The i-band observing conditions at Dome A on the Antarctic plateau have been investigated using data acquired during 2008 with the Chinese Small Telescope Array. The sky brightness, variations in atmospheric transparency, cloud cover, and the presence of aurorae are obtained from these images. The median sky brightness of moonless clear nights is 20.5 mag arcsec -2 in the SDSS i band at the south celestial pole (which includes a contribution of about 0.06 mag from diffuse Galactic light). The median over all Moon phases in the Antarctic winter is about 19.8 mag arcsec -2 . There were no thick clouds in 2008. We model contributions of the Sun and the Moon to the sky background to obtain the relationship between the sky brightness and transparency. Aurorae are identified by comparing the observed sky brightness to the sky brightness expected from this model. About 2% of the images are affected by relatively strong aurorae.
Redemann, J.; Livingston, J. M.; Shinozuka, Y.; Kacenelenbogen, M. S.; Russell, P. B.; LeBlanc, S. E.; Vaughan, M.; Ferrare, R. A.; Hostetler, C. A.; Rogers, R. R.; Burton, S. P.; Torres, O.; Remer, L. A.; Stier, P.; Schutgens, N.
2014-12-01
We describe a technique for combining CALIOP aerosol backscatter, MODIS spectral AOD (aerosol optical depth), and OMI AAOD (absorption aerosol optical depth) retrievals for the purpose of estimating full spectral sets of aerosol radiative properties, and ultimately for calculating the 3-D distribution of direct aerosol radiative forcing. We present results using one year of data collected in 2007 and show comparisons of the aerosol radiative property estimates to collocated AERONET retrievals. Use of the recently released MODIS Collection 6 data for aerosol optical depths derived with the dark target and deep blue algorithms has extended the coverage of the multi-sensor estimates towards higher latitudes. Initial calculations of seasonal clear-sky aerosol radiative forcing based on our multi-sensor aerosol retrievals compare well with over-ocean and top of the atmosphere IPCC-2007 model-based results, and with more recent assessments in the "Climate Change Science Program Report: Atmospheric Aerosol Properties and Climate Impacts" (2009). For the first time, we present comparisons of our multi-sensor aerosol direct radiative forcing estimates to values derived from a subset of models that participated in the latest AeroCom initiative. We discuss the major challenges that exist in extending our clear-sky results to all-sky conditions. On the basis of comparisons to suborbital measurements, we present some of the limitations of the MODIS and CALIOP retrievals in the presence of adjacent or underlying clouds. Strategies for meeting these challenges are discussed.
Full band all-sky search for periodic gravitational waves in the O1 LIGO data
Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allen, G.; Allocca, A.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Angelova, S. V.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Atallah, D. V.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Austin, C.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barkett, K.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Bawaj, M.; Bayley, J. C.; Bazzan, M.; Bécsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Bero, J. J.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Biscoveanu, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonilla, E.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bossie, K.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Bustillo, J. Calderón; Callister, T. A.; Calloni, E.; Camp, J. B.; Canepa, M.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerdá-Durán, P.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chase, E.; Chassande-Mottin, E.; Chatterjee, D.; Cheeseboro, B. D.; Chen, H. Y.; Chen, X.; Chen, Y.; Cheng, H.-P.; Chia, H. Y.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciecielag, P.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Clearwater, P.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Cohen, D.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Cordero-Carrión, I.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, E. T.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Canton, T. Dal; Dálya, G.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Demos, N.; Denker, T.; Dent, T.; De Pietri, R.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; De Rossi, C.; DeSalvo, R.; de Varona, O.; Devenson, J.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorosh, O.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Dreissigacker, C.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dupej, P.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Estevez, D.; Etienne, Z. B.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fee, C.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Finstad, D.; Fiori, I.; Fiorucci, D.; Fishbach, M.; Fisher, R. P.; Fitz-Axen, M.; Flaminio, R.; Fletcher, M.; Fong, H.; Font, J. A.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garcia-Quiros, C.; Garufi, F.; Gateley, B.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; Goncharov, B.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Gretarsson, E. M.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Halim, O.; Hall, B. R.; Hall, E. D.; Hamilton, E. Z.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hinderer, T.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hreibi, A.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J.-M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kamai, B.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Kapadia, S. J.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, K.; Kim, W.; Kim, W. S.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kinley-Hanlon, M.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Knowles, T. D.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Linker, S. D.; Littenberg, T. B.; Liu, J.; Lo, R. K. L.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Lück, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macas, R.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña Hernandez, I.; Magaña-Sandoval, F.; Magaña Zertuche, L.; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markakis, C.; Markosyan, A. S.; Markowitz, A.; Maros, E.; Marquina, A.; Martelli, F.; Martellini, L.; Martin, I. W.; Martin, R. M.; Martynov, D. V.; Mason, K.; Massera, E.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McNeill, L.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Mehmet, M.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, B. B.; Miller, J.; Millhouse, M.; Milovich-Goff, M. C.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moffa, D.; Moggi, A.; Mogushi, K.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muñiz, E. A.; Muratore, M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Neilson, J.; Nelemans, G.; Nelson, T. J. N.; Nery, M.; Neunzert, A.; Nevin, L.; Newport, J. M.; Newton, G.; Ng, K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; North, C.; Nuttall, L. K.; Oberling, J.; O'Dea, G. D.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Okada, M. A.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ossokine, S.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, Howard; Pan, Huang-Wei; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Parida, A.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patil, M.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pirello, M.; Pisarski, A.; Pitkin, M.; Poe, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Pratten, G.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rajbhandari, B.; Rakhmanov, M.; Ramirez, K. E.; Ramos-Buades, A.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Ren, W.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosińska, D.; Ross, M. P.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Rutins, G.; Ryan, K.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sanchez, L. E.; Sanchis-Gual, N.; Sandberg, V.; Sanders, J. R.; Sassolas, B.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheel, M.; Scheuer, J.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shaner, M. B.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, L. P.; Singh, A.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Somala, S.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staats, K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stevenson, S. P.; Stone, R.; Stops, D. J.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Strunk, A.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Suresh, J.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Tait, S. C.; Talbot, C.; Talukder, D.; Tanner, D. B.; Tao, D.; Tápai, M.; Taracchini, A.; Tasson, J. D.; Taylor, J. A.; Taylor, R.; Tewari, S. V.; Theeg, T.; Thies, F.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torres-Forné, A.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tsukada, L.; Tsuna, D.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, W. H.; Wang, Y. F.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Weßels, P.; Westerweck, J.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Wilken, D.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wysocki, D. M.; Xiao, S.; Yamamoto, H.; Yancey, C. C.; Yang, L.; Yap, M. J.; Yazback, M.; Yu, Hang; Yu, Haocun; Yvert, M.; Zadroźny, A.; Zanolin, M.; Zelenova, T.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.-H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S. J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; LIGO Scientific Collaboration; Virgo Collaboration
2018-05-01
We report on a new all-sky search for periodic gravitational waves in the frequency band 475-2000 Hz and with a frequency time derivative in the range of [-1.0 ,+0.1 ] ×1 0-8 Hz /s . Potential signals could be produced by a nearby spinning and slightly nonaxisymmetric isolated neutron star in our Galaxy. This search uses the data from Advanced LIGO's first observational run O1. No gravitational-wave signals were observed, and upper limits were placed on their strengths. For completeness, results from the separately published low-frequency search 20-475 Hz are included as well. Our lowest upper limit on worst-case (linearly polarized) strain amplitude h0 is ˜4 ×1 0-25 near 170 Hz, while at the high end of our frequency range, we achieve a worst-case upper limit of 1.3 ×1 0-24. For a circularly polarized source (most favorable orientation), the smallest upper limit obtained is ˜1.5 ×1 0-25.
Night sky a falcon field guide
Nigro, Nicholas
2012-01-01
Night Sky: A Falcon Field Guide covers both summer and winter constellations, planets, and stars found in the northern hemisphere. Conveniently sized to fit in a pocket and featuring detailed photographs, this informative guide makes it easy to identify objects in the night sky even from one's own backyard. From information on optimal weather conditions, preferred viewing locations, and how to use key tools of the trade, this handbook will help you adeptly navigate to and fro the vast and dynamic nighttime skies, and you'll fast recognize that the night sky's the limit.
DISCOVERY OF A HALO AROUND THE HELIX NEBULA NGC 7293 IN THE WISE ALL-SKY SURVEY
International Nuclear Information System (INIS)
Zhang Yong; Hsia, Chih-Hao; Kwok, Sun
2012-01-01
We report the discovery of an extended halo (∼40' in diameter) around the planetary nebula NGC 7293 (the Helix Nebula) observed in the 12 μm band from the Wide-field Infrared Survey Explorer all-sky survey. The mid-infrared halo has an axisymmetric structure with a sharp boundary to the northeast and a more diffuse boundary to the southwest, suggesting an interaction between the stellar wind and the interstellar medium (ISM). The symmetry axis of the halo is well aligned with that of a northeast arc, suggesting that the two structures are physically associated. We have attempted to fit the observed geometry with a model of a moving steady-state stellar wind interacting with the ISM. Possible combinations of the ISM density and the stellar velocity are derived from these fittings. The discrepancies between the model and the observations suggest that the stellar mass loss has a more complicated history, including possible time and angle dependences.
Száz, Dénes; Farkas, Alexandra; Barta, András; Kretzer, Balázs; Blahó, Miklós; Egri, Ádám; Szabó, Gyula; Horváth, Gábor
2017-09-01
According to Thorkild Ramskou's theory proposed in 1967, under overcast and foggy skies, Viking seafarers might have used skylight polarization analysed with special crystals called sunstones to determine the position of the invisible Sun. After finding the occluded Sun with sunstones, its elevation angle had to be measured and its shadow had to be projected onto the horizontal surface of a sun compass. According to Ramskou's theory, these sunstones might have been birefringent calcite or dichroic cordierite or tourmaline crystals working as polarizers. It has frequently been claimed that this method might have been suitable for navigation even in cloudy weather. This hypothesis has been accepted and frequently cited for decades without any experimental support. In this work, we determined the accuracy of this hypothetical sky-polarimetric Viking navigation for 1080 different sky situations characterized by solar elevation θ and cloudiness ρ, the sky polarization patterns of which were measured by full-sky imaging polarimetry. We used the earlier measured uncertainty functions of the navigation steps 1, 2 and 3 for calcite, cordierite and tourmaline sunstone crystals, respectively, and the newly measured uncertainty function of step 4 presented here. As a result, we revealed the meteorological conditions under which Vikings could have used this hypothetical navigation method. We determined the solar elevations at which the navigation uncertainties are minimal at summer solstice and spring equinox for all three sunstone types. On average, calcite sunstone ensures a more accurate sky-polarimetric navigation than tourmaline and cordierite. However, in some special cases (generally at 35° ≤ θ ≤ 40°, 1 okta ≤ ρ ≤ 6 oktas for summer solstice, and at 20° ≤ θ ≤ 25°, 0 okta ≤ ρ ≤ 4 oktas for spring equinox), the use of tourmaline and cordierite results in smaller navigation uncertainties than that of calcite. Generally, under clear or less cloudy
Advertising Citizen Science: A Trailer for the Citizen Sky Project
Wyatt, Ryan; Price, A.
2012-01-01
Citizen Sky is a multi-year, NSF funded citizen science project involving the bright and mysterious variable star epsilon Aurigae. The project was conceived by the IYA 2009 working group on Research Experiences for Students, Teachers, and Citizen-Scientists. Citizen Sky goes beyond simple observing to include a major data analysis component, introducing participants to the full scientific process from background research to paper writing for a peer-reviewed journal. As a means of generating interest in the project, the California Academy of Sciences produced a six-minute "trailer” formatted for both traditional and fulldome planetariums as well as HD and web applications. This talk will review the production process for the trailer as well as the methods of distribution via planetariums, social media, and other venues_along with an update on the Citizen Sky Project as a whole. We will show how to use a small, professionally-produced planetarium trailer to help spread word on a citizen science project. We will also show preliminary results on a study about how participation level/type in the project affects science learning.
The interactive sky: a browsable allsky image
Tancredi, Gonzalo; Da Rosa, Fernando; Roland, Santiago; Almenares, Luciano; Gomez, Fernando
2015-08-01
We are conducting a project to make available panoramas of the night sky of the southern hemisphere, based on a mosaic of hundred of photographs. Each allsky panorama is a giant image composed by hundreds of high-resolution photos taken in the course of one night. The panoramas are accessible with a web-browser and the public is able to zoom on them and to see the sky with better quality than the naked eye. We are preparing 4 sets of panoramas corresponding to the four seasons.The individual images are taken with a 16 Mpixels DLSR camera with a 50 mm lens mounted on a Gigapan EPIC robotic camera mounts. These devices and a autoguiding telescope are mounted in a equatorial telescope mount, which allows us to have exposure of several tens seconds. The images are then processed and stitched to create the gigantic panorama, with typical weight of several GBytes.The limiting magnitude is V~8. The panoramas include more than 50 times more stars those detected with the naked eye.In addition to the allsky panoramas, we embedded higher resolution images of specific regions of interest such as: emission nebulae and dark, open and globular clusters and galaxies; which can be zoomed.The photographs have been acquiring since December 2014 in a dark place with low light pollution in the countryside of Uruguay; which allows us to achieve deep sky objects.These panoramas will be available on a website and can be accessed with any browser.This tool will be available for teaching purposes, astronomy popularization or introductory research. Teacher guides will be developed for educational activities at different educational levels.While there are similar projects like Google Sky, the methodology used to generate the giant panoramas allows a much more realistic view, with a background of continuous sky without sharp edges. Furthermore, while the planetarium software is based on drawings of the stars, our panoramas are based on real images.This is the first project with these
Smith, R. Chris; Smith, Malcolm; Pompea, Stephen; Sanhueza, Pedro; AURA-Chile EPO Team
2018-01-01
For over 20 years, AURA has been leading efforts promoting the protection of dark skies in northern Chile. Efforts began in the early 1990s at AURA's Cerro Tololo Inter-American Observatory (CTIO), working in collaboration with other international observatories in Chile including Las Campanas Observatory (LCO) and the European Southern Observatory (ESO). CTIO also partnered with local communities, for example supporting Vicuña's effort to establish the first municipal observatory in Chile. Today we have developed a multifaceted effort of dark sky protection, including proactive government relations at national and local levels, a strong educational and public outreach program, and a program of highlighting international recognition of the dark skies through the IDA Dark Sky Places program. Work on international recognition has included the declaration of the Gabriel Mistral IDA Dark Sky Sanctuary, the first such IDA sanctuary in the world.
Energy Technology Data Exchange (ETDEWEB)
Brenner, Mark [Political Economy Research Institute, University of Massachusetts, Amherst (United States)]. E-mail: brenner@econs.umass.edu; Riddle, Matthew [Department of Economics, University of Massachusetts, Amherst (United States)]. E-mail: mriddle@econs.umass.edu; Boyce, James K. [Political Economy Research Institute and Department of Economics, University of Massachusetts, Amherst (United States)]. E-mail: boyce@econs.umass.edu
2007-03-15
The introduction of carbon charges on the use of fossil fuels in China would have a progressive impact on income distribution. This outcome, which contrasts to the regressive distributional impact found in most studies of carbon charges in industrialized countries, is driven primarily by differences between urban and rural expenditure patterns. If carbon revenues were recycled on an equal per capita basis via a 'sky trust,' the progressive impact would be further enhanced: low-income (mainly rural) households would receive more in sky-trust dividends than they pay in carbon charges, and high-income (mainly urban) households would pay more than they receive in dividends. Thus a Chinese sky trust would contribute to both lower fossil fuel consumption and greater income equality.
International Nuclear Information System (INIS)
Brenner, Mark; Riddle, Matthew; Boyce, James K.
2007-01-01
The introduction of carbon charges on the use of fossil fuels in China would have a progressive impact on income distribution. This outcome, which contrasts to the regressive distributional impact found in most studies of carbon charges in industrialized countries, is driven primarily by differences between urban and rural expenditure patterns. If carbon revenues were recycled on an equal per capita basis via a 'sky trust,' the progressive impact would be further enhanced: low-income (mainly rural) households would receive more in sky-trust dividends than they pay in carbon charges, and high-income (mainly urban) households would pay more than they receive in dividends. Thus a Chinese sky trust would contribute to both lower fossil fuel consumption and greater income equality
A simple formula for determining globally clear skies
Energy Technology Data Exchange (ETDEWEB)
Long, C.N.; George, A.T.; Mace, G.G. [Penn State Univ., University Park, PA (United States)] [and others
1996-04-01
Surface measurements to serve as {open_quotes}ground truth{close_quotes} are of primary importance in the development of retrieval algorithms using satellite measurements to predict surface irradiance. The most basic algorithms of this type deal with clear sky (i.e., cloudless) top-to-surface shortwave (SW) transfer, serving as a necessary prerequisite towards treating both clear and cloudy conditions. Recently, atmosphere SW cloud forcing to infer the possibility of excess atmospheric absorption (compared with model results) in cloudy atmospheres. The surface component of this ratio relies on inferring the expected clear sky SW irradiance to determine the effects of clouds on the SW energy budget. Solar renewable energy applications make use of clear and cloud fraction climatologies to assess solar radiation resources. All of the above depend to some extent on the identification of globally clear sky conditions and the attendant measurements of downwelling SW irradiance.
Providing Diurnal Sky Cover Data at ARM Sites
Energy Technology Data Exchange (ETDEWEB)
Klebe, Dimitri I. [Solmirus Corporation, Colorado Springs, CO (United States)
2015-03-06
The Solmirus Corporation was awarded two-year funding to perform a comprehensive data analysis of observations made during Solmirus’ 2009 field campaign (conducted from May 21 to July 27, 2009 at the ARM SGP site) using their All Sky Infrared Visible Analyzer (ASIVA) instrument. The objective was to develop a suite of cloud property data products for the ASIVA instrument that could be implemented in real time and tailored for cloud modelers. This final report describes Solmirus’ research and findings enabled by this grant. The primary objective of this award was to develop a diurnal sky cover (SC) data product utilizing the ASIVA’s infrared (IR) radiometrically-calibrated data and is described in detail. Other data products discussed in this report include the sky cover derived from ASIVA’s visible channel and precipitable water vapor, cloud temperature (both brightness and color), and cloud height inferred from ASIVA’s IR channels.
Ajello, M.; Alexander, D. M.; Greiner, J.; Madejeski, G. M.; Gehrels, N.; Burlon, D.
2014-01-01
Surveys above 10 keV represent one of the best resources to provide an unbiased census of the population of active galactic nuclei (AGNs). We present the results of 60 months of observation of the hard X-ray sky with Swift/Burst Alert Telescope (BAT). In this time frame, BAT-detected (in the 15-55 keV band) 720 sources in an all-sky survey of which 428 are associated with AGNs, most of which are nearby. Our sample has negligible incompleteness and statistics a factor of approx. 2 larger over similarly complete sets of AGNs. Our sample contains (at least) 15 bona fide Compton-thick AGNs and 3 likely candidates. Compton-thick AGNs represent approx. 5% of AGN samples detected above 15 keV. We use the BAT data set to refine the determination of the log N-log S of AGNs which is extremely important, now that NuSTAR prepares for launch, toward assessing the AGN contribution to the cosmic X-ray background. We show that the log N-log S of AGNs selected above 10 keV is now established to approx. 10% precision. We derive the luminosity function of Compton-thick AGNs and measure a space density of 7.9(+4.1/-2.9)× 10(exp -5)/cubic Mpc for objects with a de-absorbed luminosity larger than 2 × 10(exp 42) erg / s. As the BAT AGNs are all mostly local, they allow us to investigate the spatial distribution of AGNs in the nearby universe regardless of absorption. We find concentrations of AGNs that coincide spatially with the largest congregations of matter in the local (much < 85 Mpc) universe. There is some evidence that the fraction of Seyfert 2 objects is larger than average in the direction of these dense regions..
Predicting Clear-Sky Reflectance Over Snow/Ice in Polar Regions
Chen, Yan; Sun-Mack, Sunny; Arduini, Robert F.; Hong, Gang; Minnis, Patrick
2015-01-01
Satellite remote sensing of clouds requires an accurate estimate of the clear-sky radiances for a given scene to detect clouds and aerosols and to retrieve their microphysical properties. Knowing the spatial and angular variability of clear-sky albedo is essential for predicting clear-sky radiance at solar wavelengths. The Clouds and the Earth's Radiant Energy System (CERES) Project uses the nearinfrared (NIR; 1.24, 1.6 or 2.13 micrometers), visible (VIS; 0.63 micrometers) and vegetation (VEG; 0.86 micrometers) channels available on the Terra and Aqua Moderate Resolution Imaging Spectroradiometer (MODIS) to help identify clouds and retrieve their properties in both snow-free and snow-covered conditions. Thus, it is critical to have reliable distributions of clear-sky albedo for all of these channels. In CERES Edition 4 (Ed4), the 1.24-micrometer channel is used to retrieve cloud optical depth over snow/ice-covered surfaces. Thus, it is especially critical to accurately predict the 1.24-micrometer clear-sky albedo alpha and reflectance rho for a given location and time. Snow albedo and reflectance patterns are very complex due to surface texture, particle shapes and sizes, melt water, and vegetation protrusions from the snow surface. To minimize those effects, this study focuses on the permanent snow cover of Antarctica where vegetation is absent and melt water is minimal. Clear-sky albedos are determined as a function of solar zenith angle (SZA) from observations over all scenes determined to be cloud-free to produce a normalized directional albedo model (DRM). The DRM is used to develop alpha(SZA=0 degrees) on 10 foot grid for each season. These values provide the basis for predicting r at any location and set of viewing & illumination conditions. This paper examines the accuracy of this approach for two theoretical snow surface reflectance models.
Fireballs in the Sky: An Augmented Reality Citizen Science Program
Day, Brian
2017-01-01
Fireballs in the Sky is an innovative Australian citizen science program that connects the public with the research of the Desert Fireball Network (DFN). This research aims to understand the early workings of the solar system, and Fireballs in the Sky invites people around the world to learn about this science, contributing fireball sightings via a user-friendly augmented reality mobile app. Tens of thousands of people have downloaded the app world-wide and participated in the science of meteoritics. The Fireballs in the Sky app allows users to get involved with the Desert Fireball Network research, supplementing DFN observations and providing enhanced coverage by reporting their own meteor sightings to DFN scientists. Fireballs in the Sky reports are used to track the trajectories of meteors - from their orbit in space to where they might have landed on Earth. Led by Phil Bland at Curtin University in Australia, the Desert Fireball Network (DFN) uses automated observatories across Australia to triangulate trajectories of meteorites entering the atmosphere, determine pre-entry orbits, and pinpoint their fall positions. Each observatory is an autonomous intelligent imaging system, taking 1000 by 36 megapixel all-sky images throughout the night, using neural network algorithms to recognize events. They are capable of operating for 12 months in a harsh environment, and store all imagery collected. We developed a completely automated software pipeline for data reduction, and built a supercomputer database for storage, allowing us to process our entire archive. The DFN currently stands at 50 stations distributed across the Australian continent, covering an area of 2.5 million square kilometers. Working with DFN's partners at NASA's Solar System Exploration Research Virtual Institute, the team is expanding the network beyond Australia to locations around the world. Fireballs in the Sky allows a growing public base to learn about and participate in this exciting research.
Fireballs in the Sky: an Augmented Reality Citizen Science Program
Day, B. H.; Bland, P.; Sayers, R.
2017-12-01
Fireballs in the Sky is an innovative Australian citizen science program that connects the public with the research of the Desert Fireball Network (DFN). This research aims to understand the early workings of the solar system, and Fireballs in the Sky invites people around the world to learn about this science, contributing fireball sightings via a user-friendly augmented reality mobile app. Tens of thousands of people have downloaded the app world-wide and participated in the science of meteoritics. The Fireballs in the Sky app allows users to get involved with the Desert Fireball Network research, supplementing DFN observations and providing enhanced coverage by reporting their own meteor sightings to DFN scientists. Fireballs in the Sky reports are used to track the trajectories of meteors - from their orbit in space to where they might have landed on Earth. Led by Phil Bland at Curtin University in Australia, the Desert Fireball Network (DFN) uses automated observatories across Australia to triangulate trajectories of meteorites entering the atmosphere, determine pre-entry orbits, and pinpoint their fall positions. Each observatory is an autonomous intelligent imaging system, taking 1000×36Megapixel all-sky images throughout the night, using neural network algorithms to recognize events. They are capable of operating for 12 months in a harsh environment, and store all imagery collected. We developed a completely automated software pipeline for data reduction, and built a supercomputer database for storage, allowing us to process our entire archive. The DFN currently stands at 50 stations distributed across the Australian continent, covering an area of 2.5 million km^2. Working with DFN's partners at NASA's Solar System Exploration Research Virtual Institute, the team is expanding the network beyond Australia to locations around the world. Fireballs in the Sky allows a growing public base to learn about and participate in this exciting research.
Clear-sky classification procedures and models using a world-wide data-base
International Nuclear Information System (INIS)
Younes, S.; Muneer, T.
2007-01-01
Clear-sky data need to be extracted from all-sky measured solar-irradiance dataset, often by using algorithms that rely on other measured meteorological parameters. Current procedures for clear-sky data extraction have been examined and compared with each other to determine their reliability and location dependency. New clear-sky determination algorithms are proposed that are based on a combination of clearness index, diffuse ratio, cloud cover and Linke's turbidity limits. Various researchers have proposed clear-sky irradiance models that rely on synoptic parameters; four of these models, MRM, PRM, YRM and REST2 have been compared for six world-wide-locations. Based on a previously-developed comprehensive accuracy scoring method, the models MRM, REST2 and YRM were found to be of satisfactory performance in decreasing order. The so-called Page radiation model (PRM) was found to underestimate solar radiation, even though local turbidity data were provided for its operation
Integrating paleoecology and genetics of bird populations in two sky island archipelagos.
McCormack, John E; Bowen, Bonnie S; Smith, Thomas B
2008-06-27
demonstrate that sky islands act as generators of genetic diversity at both recent and historical timescales and underscore the importance of thorough sampling and the use of loci with fast mutation rates to studies that test hypotheses concerning recent genetic divergence.
Lomb, Nick
2011-01-01
Compact, easy to use and reliable, this popular guide contains everything you need to know about the southern night sky with monthly star maps, diagrams and details of all the year's exciting celestial events. Wherever you are in Australia or New Zealand, easy calculations allow you to determine when the Sun, Moon and planets will rise and set throughout the year. Also included is information on the latest astronomical findings from space probes and telescopes around the world.
The Fourteenth Data Release of the Sloan Digital Sky Survey
DEFF Research Database (Denmark)
Abolfathi, Bela; Aguado, D. S.; Aguilar, Gabriela
2018-01-01
The fourth generation of the Sloan Digital Sky Survey (SDSS-IV) has been in operation since 2014 July. This paper describes the second data release from this phase, and the 14th from SDSS overall (making this Data Release Fourteen or DR14). This release makes the data taken by SDSS-IV in its firs...
Model for the angular distribution of sky radiance
Energy Technology Data Exchange (ETDEWEB)
Hooper, F C; Brunger, A P
1979-08-01
A flexible mathematical model is introduced which describes the radiance of the dome of the sky under various conditions. This three-component continuous distribution (TCCD) model is compounded by the superposition of three separate terms, the isotropic, circumsolar and horizon brightening terms, each representing the contribution of a particular sky characteristic. In use a particular sky condition is characterized by the values of the coefficients of each of these three terms, defining the distribution of the total diffuse component. The TCCD model has been demonstrated to fit both the normalized clear sky data and the normalized overcast sky data with an RMS error of about ten percent of the man overall sky radiance. By extension the model could describe variable or partly clouded sky conditions. The model can aid in improving the prediction of solar collector performance.
Distribution to the Astronomy Community of the Compressed Digitized Sky Survey
Postman, Marc
1996-03-01
The Space Telescope Science Institute has compressed an all-sky collection of ground-based images and has printed the data on a two volume, 102 CD-ROM disc set. The first part of the survey (containing images of the southern sky) was published in May 1994. The second volume (containing images of the northern sky) was published in January 1995. Software which manages the image retrieval is included with each volume. The Astronomical Society of the Pacific (ASP) is handling the distribution of the lOx compressed data and has sold 310 sets as of October 1996. ASP is also handling the distribution of the recently published 100x version of the northern sky survey which is publicly available at a low cost. The target markets for the 100x compressed data set are the amateur astronomy community, educational institutions, and the general public. During the next year, we plan to publish the first version of a photometric calibration database which will allow users of the compressed sky survey to determine the brightness of stars in the images.
The Infrared Sky - Science from 2MASS
International Nuclear Information System (INIS)
Skrutskie, Michael
2002-01-01
The Two Micron All Sky Survey has imaged 100% of the celestial sphere in the near-infrared J (1.2 μm), H (1.6 μm) and Ks (2.2 μm) photometric bands. Pipeline processing of these data has produced catalogs containing 500 million stars and 1.5 million extended sources which will be released later this year. The catalogs are characterized by great photometric uniformity (1%) and precision (2-3%) around the sky as well as good astrometric accuracy (100 mas). This talk will focus on some of the initial scientific results enabled by this database ranging from brown dwarfs in the solar neighborhood to large scale structure in the early universe.
Daytime Water Detection Based on Sky Reflections
Rankin, Arturo; Matthies, Larry; Bellutta, Paolo
2011-01-01
A water body s surface can be modeled as a horizontal mirror. Water detection based on sky reflections and color variation are complementary. A reflection coefficient model suggests sky reflections dominate the color of water at ranges > 12 meters. Water detection based on sky reflections: (1) geometrically locates the pixel in the sky that is reflecting on a candidate water pixel on the ground (2) predicts if the ground pixel is water based on color similarity and local terrain features. Water detection has been integrated on XUVs.
Derivation of Sky-View Factors from LIDAR Data
Kidd, Christopher; Chapman, Lee
2013-01-01
The use of Lidar (Light Detection and Ranging), an active light-emitting instrument, is becoming increasingly common for a range of potential applications. Its ability to provide fine resolution spatial and vertical resolution elevation data makes it ideal for a wide range of studies. This paper demonstrates the capability of Lidar data to measure sky view factors (SVF). The Lidar data is used to generate a spatial map of SVFs which are then compared against photographically-derived SVF at selected point locations. At each location three near-surface elevations measurements were taken and compared with collocated Lidar-derived estimated. It was found that there was generally good agreement between the two methodologies, although with decreasing SVF the Lidar-derived technique tended to overestimate the SVF: this can be attributed in part to the spatial resolution of the Lidar sampling. Nevertheless, airborne Lidar systems can map sky view factors over a large area easily, improving the utility of such data in atmospheric and meteorological models.
H I Clouds in the Lower Halo. I. The Galactic All-Sky Survey Pilot Region
International Nuclear Information System (INIS)
Ford, H. Alyson; McClure-Griffiths, N. M.; Calabretta, M. R.; Lockman, Felix J.; Pisano, D. J.; Bailin, J.; Kalberla, P. M. W.; Murphy, T.
2008-01-01
We have detected over 400 H I clouds in the lower halo of the Galaxy within the pilot region of the Galactic All-Sky Survey (GASS), a region of the fourth quadrant that spans 18 deg. in longitude, 40 deg. in latitude, and is centered on the Galactic equator. These clouds have a median peak brightness temperature of 0.6 K, a median velocity width of 12.8 km s -1 , and angular sizes ∼ -1 . A sample of clouds likely to be near tangent points was analyzed in detail. These clouds have radii on the order of 30 pc and a median H I mass of 630 M sun . The population has a vertical scale height of 400 pc and is concentrated in Galactocentric radius, peaking at R = 3.8 kpc. This confined structure suggests that the clouds are linked to spiral features, while morphological evidence that many clouds are aligned with loops and filaments is suggestive of a relationship with star formation. The clouds might result from supernovae and stellar winds in the form of fragmenting shells and gas that has been pushed into the halo rather than from a galactic fountain.
Polygons and practice in Skies of Arcadia
Directory of Open Access Journals (Sweden)
Zoya Street
2013-03-01
Full Text Available This paper features research carried out at the Victoria and Albert Museum into the design history of Sega’s 2000 Dreamcast title, Skies of Arcadia (released in Japan as Eternal Arcadia. It was released by Overworks, a subsidiary of Sega, at an interesting point in Japanese computer game history. A new generation of video game consoles was in its infancy, and much speculation in the industry surrounded how networked gaming and large, open, tridimensional game worlds would change game design in the years ahead.
Photometric Analysis of the Pi of the Sky Data
Directory of Open Access Journals (Sweden)
M. Siudek
2011-01-01
Full Text Available A database containing star measurements from the period 2006–2009 taken by the Pi of the Sky detector located in Las Campanas Observatory in Chile contains more than 2 billion measurements of almost 17 million objects. All measurements are available on the Pi of the Sky web site through a dedicated interface, which also allows users to download selected data. Accurate analysis of Pi of the Sky data is a real challenge, because of a number of factors that can influence the measurements. Possible sources of errors in our measurements include: reading the chip with the shutter open, strong and varying sky background, passing planets or planetoids, and clouds and hot pixels. In order tofacilitate the analysis of variable stars we have developed a system of dedicated filters to remove bad measurements or frames. The spectral sensitivity of the detector is taken into account by appropriate corrections based on the spectral type of reference stars. This process is illustrated by an analysis of the BG Ind system, where we have been able to reduce the systematic uncertainty to about 0.05 magnitudo.
Abbott, B. P.; Abbott, R.; Abbott, T. D.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Afrough, M.; Agarwal, B.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Allen, B.; Allen, G.; Allocca, A.; Altin, P. A.; Amato, A.; Ananyeva, A.; Anderson, S. B.; Anderson, W. G.; Antier, S.; Appert, S.; Arai, K.; Araya, M. C.; Areeda, J. S.; Arnaud, N.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; AultONeal, K.; Avila-Alvarez, A.; Babak, S.; Bacon, P.; Bader, M. K. M.; Bae, S.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Banagiri, S.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bawaj, M.; Bazzan, M.; Bécsy, B.; Beer, C.; Bejger, M.; Belahcene, I.; Bell, A. S.; Berger, B. K.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Billman, C. R.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blackman, J.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bode, N.; Boer, M.; Bogaert, G.; Bohe, A.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Broida, J. E.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Brunett, S.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cabero, M.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderón Bustillo, J.; Callister, T. A.; Calloni, E.; Camp, J. B.; Canizares, P.; Cannon, K. C.; Cao, H.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Carney, M. F.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Cerboni Baiardi, L.; Cerretani, G.; Cesarini, E.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chatterjee, D.; Cheeseboro, B. D.; Chen, H. Y.; Chen, Y.; Cheng, H.-P.; Chincarini, A.; Chiummo, A.; Chmiel, T.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, A. J. K.; Chua, S.; Chung, A. K. W.; Chung, S.; Ciani, G.; Ciolfi, R.; Cirelli, C. E.; Cirone, A.; Clara, F.; Clark, J. A.; Cleva, F.; Cocchieri, C.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L. R.; Constancio, M.; Conti, L.; Cooper, S. J.; Corban, P.; Corbitt, T. R.; Corley, K. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Covas, P. B.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Creighton, J. D. E.; Creighton, T. D.; Cripe, J.; Crowder, S. G.; Cullen, T. J.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Dasgupta, A.; Da Silva Costa, C. F.; Dattilo, V.; Dave, I.; Davier, M.; Davis, D.; Daw, E. J.; Day, B.; De, S.; DeBra, D.; Deelman, E.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devenson, J.; Devine, R. C.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Girolamo, T.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Renzo, F.; Doctor, Z.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Dorrington, I.; Douglas, R.; Dovale Álvarez, M.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Duncan, J.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Eisenstein, R. A.; Essick, R. C.; Etienne, Z. B.; Etzel, T.; Evans, M.; Evans, T. M.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E. J.; Favata, M.; Fays, M.; Fehrmann, H.; Feicht, J.; Fejer, M. M.; Fernandez-Galiana, A.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fong, H.; Forsyth, P. W. F.; Forsyth, S. S.; Fournier, J.-D.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fries, E. M.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H.; Gabel, M.; Gadre, B. U.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Ganija, M. R.; Gaonkar, S. G.; Garufi, F.; Gaudio, S.; Gaur, G.; Gayathri, V.; Gehrels, N.; Gemme, G.; Genin, E.; Gennai, A.; George, D.; George, J.; Gergely, L.; Germain, V.; Ghonge, S.; Ghosh, Abhirup; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glover, L.; Goetz, E.; Goetz, R.; Gomes, S.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Grado, A.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Gruning, P.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannuksela, O. A.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Henry, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hofman, D.; Holt, K.; Holz, D. E.; Hopkins, P.; Horst, C.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Indik, N.; Ingram, D. R.; Inta, R.; Intini, G.; Isa, H. N.; Isac, J.-M.; Isi, M.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Junker, J.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Karvinen, K. S.; Kasprzack, M.; Katolik, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kawabe, K.; Kéfélian, F.; Keitel, D.; Kemball, A. J.; Kennedy, R.; Kent, C.; Key, J. S.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, Chunglee; Kim, J. C.; Kim, W.; Kim, W. S.; Kim, Y.-M.; Kimbrell, S. J.; King, E. J.; King, P. J.; Kirchhoff, R.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koch, P.; Koehlenbeck, S. M.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Krämer, C.; Kringel, V.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, P.; Kumar, R.; Kumar, S.; Kuo, L.; Kutynia, A.; Kwang, S.; Lackey, B. D.; Lai, K. H.; Landry, M.; Lang, R. N.; Lange, J.; Lantz, B.; Lanza, R. K.; Lartaux-Vollard, A.; Lasky, P. D.; Laxen, M.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, H. W.; Lee, K.; Lehmann, J.; Lenon, A.; Leonardi, M.; Leroy, N.; Letendre, N.; Levin, Y.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Liu, J.; Lo, R. K. L.; Lockerbie, N. A.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lovelace, G.; Lück, H.; Lumaca, D.; Lundgren, A. P.; Lynch, R.; Ma, Y.; Macfoy, S.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña Hernandez, I.; Magaña-Sandoval, F.; Magaña Zertuche, L.; Magee, R. M.; Majorana, E.; Maksimovic, I.; Man, N.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markakis, C.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martynov, D. V.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Mastrogiovanni, S.; Matas, A.; Matichard, F.; Matone, L.; Mavalvala, N.; Mayani, R.; Mazumder, N.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McCuller, L.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McRae, T.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Mejuto-Villa, E.; Melatos, A.; Mendell, G.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Metzdorff, R.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, A. L.; Miller, A.; Miller, B. B.; Miller, J.; Millhouse, M.; Minazzoli, O.; Minenkov, Y.; Ming, J.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mours, B.; Mow-Lowry, C. M.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Muniz, E. A. M.; Murray, P. G.; Napier, K.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Nelemans, G.; Nelson, T. J. N.; Neri, M.; Nery, M.; Neunzert, A.; Newport, J. M.; Newton, G.; Ng, K. K. Y.; Nguyen, T. T.; Nichols, D.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Noack, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; Ormiston, R.; Ortega, L. F.; O'Shaughnessy, R.; Ottaway, D. J.; Overmier, H.; Owen, B. J.; Pace, A. E.; Page, J.; Page, M. A.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pang, B.; Pang, P. T. H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perez, C. J.; Perreca, A.; Perri, L. M.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Porter, E. K.; Post, A.; Powell, J.; Prasad, J.; Pratt, J. W. W.; Predoi, V.; Prestegard, T.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Qiu, S.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rajan, C.; Rakhmanov, M.; Ramirez, K. E.; Rapagnani, P.; Raymond, V.; Razzano, M.; Read, J.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Ricker, P. M.; Rieger, S.; Riles, K.; Rizzo, M.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romel, C. L.; Romie, J. H.; Rosińska, D.; Ross, M. P.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Rynge, M.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Sakellariadou, M.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sampson, L. M.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Scheuer, J.; Schmidt, E.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schulte, B. W.; Schutz, B. F.; Schwalbe, S. G.; Scott, J.; Scott, S. M.; Seidel, E.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Shaddock, D. A.; Shaffer, T. J.; Shah, A. A.; Shahriar, M. S.; Shao, L.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sieniawska, M.; Sigg, D.; Silva, A. D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, B.; Smith, J. R.; Smith, R. J. E.; Son, E. J.; Sonnenberg, J. A.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Spencer, A. P.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Stratta, G.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sunil, S.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Taracchini, A.; Taylor, J. A.; Taylor, R.; Theeg, T.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Toland, K.; Tonelli, M.; Tornasi, Z.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Trinastic, J.; Tringali, M. C.; Trozzo, L.; Tsang, K. W.; Tse, M.; Tso, R.; Tuyenbayev, D.; Ueno, K.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahi, K.; Vahlbruch, H.; Vajente, G.; Valdes, G.; Vallisneri, M.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Varma, V.; Vass, S.; Vasúth, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Venugopalan, G.; Verkindt, D.; Vetrano, F.; Viceré, A.; Viets, A. D.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walet, R.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, J. Z.; Wang, M.; Wang, Y.-F.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Watchi, J.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wessel, E. K.; Weßels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; Whiting, B. F.; Whittle, C.; Williams, D.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Woehler, J.; Wofford, J.; Wong, K. W. K.; Worden, J.; Wright, J. L.; Wu, D. S.; Wu, G.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, Hang; Yu, Haocun; Yvert, M.; ZadroŻny, A.; Zanolin, M.; Zelenova, T.; Zendri, J.-P.; Zevin, M.; Zhang, L.; Zhang, M.; Zhang, T.; Zhang, Y.-H.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, S. J.; Zhu, X. J.; Zucker, M. E.; Zweizig, J.; Anderson, D. P.; LIGO Scientific Collaboration; Virgo Collaboration
2017-12-01
We report results of a deep all-sky search for periodic gravitational waves from isolated neutron stars in data from the first Advanced LIGO observing run. This search investigates the low frequency range of Advanced LIGO data, between 20 and 100 Hz, much of which was not explored in initial LIGO. The search was made possible by the computing power provided by the volunteers of the Einstein@Home project. We find no significant signal candidate and set the most stringent upper limits to date on the amplitude of gravitational wave signals from the target population, corresponding to a sensitivity depth of 48.7 [1 /√{Hz }] . At the frequency of best strain sensitivity, near 100 Hz, we set 90% confidence upper limits of 1.8 ×1 0-25. At the low end of our frequency range, 20 Hz, we achieve upper limits of 3.9 ×1 0-24. At 55 Hz we can exclude sources with ellipticities greater than 1 0-5 within 100 pc of Earth with fiducial value of the principal moment of inertia of 1038 kg m2 .
Characterizing Sky Spectra Using SDSS BOSS Data
Florez, Lina Maria; Strauss, Michael A.
2018-01-01
In the optical/near-infrared spectra gathered by a ground-based telescope observing very faint sources, the strengths of the emission lines due to the Earth’s atmosphere can be many times larger than the fluxes of the sources we are interested in. Thus the limiting factor in faint-object spectroscopy is the degree to which systematics in the sky subtraction can be minimized. Longwards of 6000 Angstroms, the night-sky spectrum is dominated by multiple vibrational/rotational transitions of the OH radical from our upper atmosphere. While the wavelengths of these lines are the same in each sky spectrum, their relative strengths vary considerably as a function of time and position on the sky. The better we can model their strengths, the better we can hope to subtract them off. We expect that the strength of lines from common upper energy levels will be correlated with one another. We used flux-calibrated sky spectra from the Sloan Digital Sky Survey Baryon Oscillation Spectroscopic Survey (SDSS BOSS) to explore these correlations. Our aim is to use these correlations for creating improved sky subtraction algorithms for the Prime Focus Spectrograph (PFS) on the 8.2-meter Subaru Telescope. When PFS starts gathering data in 2019, it will be the most powerful multi-object spectrograph in the world. Since PFS will be gathering data on sources as faint as 24th magnitude and fainter, it's of upmost importance to be able to accurately measure and subtract sky spectra from the data that we receive.
VizieR Online Data Catalog: Wisconsin soft X-ray diffuse background all-sky Survey (McCammon+ 1983)
McCammon, D.; Burrows, D. N.; Sanders, W. T.; Kraushaar, W. L.
1997-10-01
The catalog contains all-sky survey of the soft X-ray diffuse background and the count-rate data from which the maps were made for the ten flights included in the survey. It contains 40 files in the machine-readable version and includes documentation and utility subroutines. The data files contain different band maps (B, C, M, M1, M2, I, J, 2-6 keV) in a 0 degree-centered Aitoff projection, in a 180-degree-centered Aitoff projection, in a north polar projection, and in a south polar projection. Lookup tables in the form of FITS images are provided for conversion between pixel coordinates and Galactic coordinates for the various projections. The bands are: B = 130-188eV C = 160-284eV M1 = 440-930eV M2 = 600-1100eV I = 770-1500eV J = 1100-2200eV 2-6keV = 1800-6300eV (51 data files).
Quantifying the clear-sky bias of satellite-derived infrared LST
Ermida, S. L.; Trigo, I. F.; DaCamara, C.
2017-12-01
Land surface temperature (LST) is one of the most relevant parameters when addressing the physical processes that take place at the surface of the Earth. Satellite data are particularly appropriate for measuring LST over the globe with high temporal resolution. Remote-sensed LST estimation from space-borne sensors has been systematically performed over the Globe for nearly 3 decades and geostationary LST climate data records are now available. The retrieval of LST from satellite observations generally relies on measurements in the thermal infrared (IR) window. Although there is a large number of IR sensors on-board geostationary satellites and polar orbiters suitable for LST retrievals with different temporal and spatial resolutions, the use of IR observations limits LST estimates to clear sky conditions. As a consequence, climate studies based on IR LST are likely to be affected by the restriction of LST data to cloudless conditions. However, such "clear sky bias" has never been quantified and, therefore, the actual impact of relying only on clear sky data is still to be determined. On the other hand, an "all-weather" global LST database may be set up based on passive microwave (MW) measurements which are much less affected by clouds. An 8-year record of all-weather MW LST is here used to quantify the clear-sky bias of IR LST at global scale based on MW observations performed by the Advanced Microwave Scanning Radiometer-Earth Observing System (AMSR-E) onboard NASA's Aqua satellite. Selection of clear-sky and cloudy pixels is based on information derived from measurements performed by the Moderate Resolution Imaging Spectroradiometer (MODIS) on-board the same satellite.
Száz, Dénes; Farkas, Alexandra; Barta, András; Kretzer, Balázs; Blahó, Miklós; Egri, Ádám; Szabó, Gyula; Horváth, Gábor
2017-09-01
According to Thorkild Ramskou's theory proposed in 1967, under overcast and foggy skies, Viking seafarers might have used skylight polarization analysed with special crystals called sunstones to determine the position of the invisible Sun. After finding the occluded Sun with sunstones, its elevation angle had to be measured and its shadow had to be projected onto the horizontal surface of a sun compass. According to Ramskou's theory, these sunstones might have been birefringent calcite or dichroic cordierite or tourmaline crystals working as polarizers. It has frequently been claimed that this method might have been suitable for navigation even in cloudy weather. This hypothesis has been accepted and frequently cited for decades without any experimental support. In this work, we determined the accuracy of this hypothetical sky-polarimetric Viking navigation for 1080 different sky situations characterized by solar elevation θ and cloudiness ρ , the sky polarization patterns of which were measured by full-sky imaging polarimetry. We used the earlier measured uncertainty functions of the navigation steps 1, 2 and 3 for calcite, cordierite and tourmaline sunstone crystals, respectively, and the newly measured uncertainty function of step 4 presented here. As a result, we revealed the meteorological conditions under which Vikings could have used this hypothetical navigation method. We determined the solar elevations at which the navigation uncertainties are minimal at summer solstice and spring equinox for all three sunstone types. On average, calcite sunstone ensures a more accurate sky-polarimetric navigation than tourmaline and cordierite. However, in some special cases (generally at 35° ≤ θ ≤ 40°, 1 okta ≤ ρ ≤ 6 oktas for summer solstice, and at 20° ≤ θ ≤ 25°, 0 okta ≤ ρ ≤ 4 oktas for spring equinox), the use of tourmaline and cordierite results in smaller navigation uncertainties than that of calcite
SkyProbeBV: dual-color absolute sky transparency monitor to optimize science operations
Cuillandre, Jean-Charles; Magnier, Eugene; Sabin, Dan; Mahoney, Billy
2008-07-01
Mauna Kea (4200 m elevation, Hawaii) is known for its pristine seeing conditions, but sky transparency can be an issue for science operations: 25% of the nights are not photometric, a cloud coverage mostly due to high-altitude thin cirrus. The Canada-France-Hawaii Telescope (CFHT) is upgrading its real-time sky transparency monitor in the optical domain (V-band) into a dual-color system by adding a B-band channel and redesigning the entire optical and mechanical assembly. Since 2000, the original single-channel SkyProbe has gathered one exposure every minute during each observing night using a small CCD camera with a very wide field of view (35 sq. deg.) encompassing the region pointed by the telescope for science operations, and exposures long enough (30 seconds) to capture at least 100 stars of Hipparcos' Tychos catalog at high galactic latitudes (and up to 600 stars at low galactic latitudes). A key advantage of SkyProbe over direct thermal infrared imaging detection of clouds, is that it allows an accurate absolute measurement, within 5%, of the true atmospheric absorption by clouds affecting the data being gathered by the telescope's main science instrument. This system has proven crucial for decision making in the CFHT queued service observing (QSO), representing today 95% of the telescope time: science exposures taken in non-photometric conditions are automatically registered for being re-observed later on (at 1/10th of the original exposure time per pointing in the observed filters) to ensure a proper final absolute photometric calibration. If the absorption is too high, exposures can be repeated, or the observing can be done for a lower ranked science program. The new dual color system (simultaneous B & V bands) will allow a better characterization of the sky properties above Mauna Kea and should enable a better detection of the thinner cirrus (absorption down to 0.02 mag., i.e. 2%). SkyProbe is operated within the Elixir pipeline, a collection of tools
Clear-sky narrowband albedos derived from VIRS and MODIS
Sun-Mack, Sunny; Minnis, Patrick; Chen, Yan; Arduini, Robert F.
2004-02-01
The Clouds and Earth"s Radiant Energy System (CERES) project is using multispectral imagers, the Visible Infrared Scanner (VIRS) on the tropical Rainfall Measuring Mission (TRMM) satellite and the Moderate Resolution Imaging Spectroradiometer (MODIS) on Terra, operating since spring 2000, and Aqua, operating since summer 2002, to provide cloud and clear-sky properties at various wavelengths. This paper presents the preliminary results of an analysis of the CERES clear-sky reflectances to derive a set top-of-atmosphere clear sky albedo for 0.65, 0.86, 1.6, 2.13 μm, for all major surface types using the combined MODIS and VIRS datasets. The variability of snow albedo with surface type is examined using MODIS data. Snow albedo was found to depend on the vertical structure of the vegetation. At visible wavelengths, it is least for forested areas and greatest for smooth desert and tundra surfaces. At 1.6 and 2.1-μm, the snow albedos are relatively insensitive to the underlying surface because snow decreases the reflectance. Additional analyses using all of the MODIS results will provide albedo models that should be valuable for many remote sensing, simulation and radiation budget studies.
Using routine meteorological data to derive sky conditions
Directory of Open Access Journals (Sweden)
D. Pagès
2003-03-01
Full Text Available Sky condition is a matter of interest for public and weather predictors as part of weather analyses. In this study, we apply a method that uses total solar radiation and other meteorological data recorded by an automatic station for deriving an estimation of the sky condition. The impetus of this work is the intention of the Catalan Meteorological Service (SMC to provide the public with real-time information about the sky condition. The methodology for deriving sky conditions from meteorological records is based on a supervised classification technique called maximum likelihood method. In this technique we first need to define features which are derived from measured variables. Second, we must decide which sky conditions are intended to be distinguished. Some analyses have led us to use four sky conditions: (a cloudless or almost cloudless sky, (b scattered clouds, (c mostly cloudy – high clouds, (d overcast – low clouds. An additional case, which may be treated separately, corresponds to precipitation (rain or snow. The main features for estimating sky conditions are, as expected, solar radiation and its temporal variability. The accuracy of this method of guessing sky conditions compared with human observations is around 70% when applied to four sites in Catalonia (NE Iberian Peninsula. The agreement increases if we take into account the uncertainty both in the automatic classifier and in visual observations.Key words. Meteorological and atmospheric dynamics (instruments and techniques; radiative processes – Atmospheric composition and structure (cloud physics and chemistry
Dark Skies: Local Success, Global Challenge
Lockwood, G. W.
2009-01-01
The Flagstaff, Arizona 1987 lighting code reduced the growth rate of man-made sky glow by a third. Components of the code include requirements for full cutoff lighting, lumens per acre limits in radial zones around observatories, and use of low-pressure sodium monochromatic lighting for roadways and parking lots. Broad public acceptance of Flagstaff's lighting code demonstrates that dark sky preservation has significant appeal and few visibility or public safety negatives. An inventory by C. Luginbuhl et al. of the light output and shielding of a sampling of various zoning categories (municipal, commercial, apartments, single-family residences, roadways, sports facilities, industrial, etc.), extrapolated over the entire city, yields a total output of 139 million lumens. Commercial and industrial sources account for 62% of the total. Outdoor sports lighting increases the total by 24% on summer evenings. Flagstaff's per capita lumen output is 2.5 times greater than the nominal 1,000 lumens per capita assumed by R. Garstang in his early sky glow modeling work. We resolved the discrepancy with respect to Flagstaff's measured sky glow using an improved model that includes substantial near ground attenuation by foliage and structures. A 2008 university study shows that astronomy contributes $250M annually to Arizona's economy. Another study showed that the application of lighting codes throughout Arizona could reduce energy consumption significantly. An ongoing effort led by observatory directors statewide will encourage lighting controls in currently unregulated metropolitan areas whose growing sky glow threatens observatory facilities more than 100 miles away. The national press (New York Times, the New Yorker, the Economist, USA Today, etc.) have publicized dark sky issues but frequent repetition of the essential message and vigorous action will be required to steer society toward darker skies and less egregious waste.
The H.E.S.S. Galactic plane survey
H. E. S. S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Tjus, J. Becker; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carrigan, S.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gast, H.; Gaté, F.; Giavitto, G.; Giebels, B.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Malyshev, D.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Safi-Harb, S.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schandri, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.
2018-04-01
We present the results of the most comprehensive survey of the Galactic plane in very high-energy (VHE) γ-rays, including a public release of Galactic sky maps, a catalog of VHE sources, and the discovery of 16 new sources of VHE γ-rays. The High Energy Spectroscopic System (H.E.S.S.) Galactic plane survey (HGPS) was a decade-long observation program carried out by the H.E.S.S. I array of Cherenkov telescopes in Namibia from 2004 to 2013. The observations amount to nearly 2700 h of quality-selected data, covering the Galactic plane at longitudes from ℓ = 250° to 65° and latitudes |b|≤ 3°. In addition to the unprecedented spatial coverage, the HGPS also features a relatively high angular resolution (0.08° ≈ 5 arcmin mean point spread function 68% containment radius), sensitivity (≲1.5% Crab flux for point-like sources), and energy range (0.2-100 TeV). We constructed a catalog of VHE γ-ray sources from the HGPS data set with a systematic procedure for both source detection and characterization of morphology and spectrum. We present this likelihood-based method in detail, including the introduction of a model component to account for unresolved, large-scale emission along the Galactic plane. In total, the resulting HGPS catalog contains 78 VHE sources, of which 14 are not reanalyzed here, for example, due to their complex morphology, namely shell-like sources and the Galactic center region. Where possible, we provide a firm identification of the VHE source or plausible associations with sources in other astronomical catalogs. We also studied the characteristics of the VHE sources with source parameter distributions. 16 new sources were previously unknown or unpublished, and we individually discuss their identifications or possible associations. We firmly identified 31 sources as pulsar wind nebulae (PWNe), supernova remnants (SNRs), composite SNRs, or gamma-ray binaries. Among the 47 sources not yet identified, most of them (36) have possible
A lobster-eye on the x-ray sky
International Nuclear Information System (INIS)
Peele, A. G.; Zhang, W.; Gendreau, K. C.; Petre, R.; White, N. E.
1999-01-01
We propose an x-ray all-sky monitor for the International Space Station (ISS) that will be ten times more sensitive than past monitors and that opens up a new band of the soft x-ray spectrum (0.1 -3.0 keV) for study. Taking advantage of the power telemetry and space available on the ISS we can use a telescope geometry and detectors that will provide better than 4 arc minute resolution of the entire sky in a 1.5 hr duty cycle. To achieve this sensitivity and resolution we use focusing optics based on the lobster-eye geometry. We propose two approaches to the construction of the optics. The first method, well within the reach of existing technology, is to approximate the lobster-eye geometry by building crossed arrays of planar reflectors, this gives great control over the reflecting surface but is limited in terms of resolution at the baseline 4 arc minute level. The second method is to use microchannel plates: this technology has the potential to greatly exceed the baseline resolution and sensitivity but is yet to be fully demonstrated. A simultaneous development of both approaches with selection of the superior candidate at the end of the development phase is suggested. The instrument is made of a number of modules based on a 2x2 cooled CCD detector array that covers an area of 6x6 cm 2 at the focal plane. Using optics with a radius of curvature of 0.75 m this gives each module a field of view of 9 deg. x 9 deg. The modular approach gives us enormous flexibility in terms of physical arrangement on the ISS so that we may take advantage of clear lines of sight and also in terms of built-in redundancy. We estimate that ∼50 such modules give us instantaneous coverage of 1/10 of the sky. The scientific case for this mission is almost too broad to state here. The instrument we describe will allow investigation of the long term light curves of thousands of AGN, it will detect thousands of transients, including GRBs and type II supernova, and the stellar coronae of
ultra-Stable Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research (5STAR)
Dunagan, S. E.; Johnson, R. R.; Redemann, J.; Holben, B. N.; Schmid, B.; Flynn, C. J.; Fahey, L.; LeBlanc, S. E.; Liss, J.; Kacenelenbogen, M. S.; Segal-Rosenhaimer, M.; Shinozuka, Y.; Dahlgren, R. P.; Pistone, K.; Karol, Y.
2017-12-01
The Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research (4STAR) combines airborne sun tracking and sky scanning with diffraction spectroscopy to improve knowledge of atmospheric constituents and their links to air pollution and climate. Direct beam hyperspectral measurement of optical depth improves retrievals of gas constituents and determination of aerosol properties. Sky scanning enhances retrievals of aerosol type and size distribution. Hyperspectral cloud-transmitted radiance measurements enable the retrieval of cloud properties from below clouds. These measurements tighten the closure between satellite and ground-based measurements. 4STAR incorporates a modular sun-tracking/ sky-scanning optical head with optical fiber signal transmission to rack mounted spectrometers, permitting miniaturization of the external optical tracking head, and future detector evolution. 4STAR has supported a broad range of flight experiments since it was first flown in 2010. This experience provides the basis for a series of improvements directed toward reducing measurement uncertainty and calibration complexity, and expanding future measurement capabilities, to be incorporated into a new 5STAR instrument. A 9-channel photodiode radiometer with AERONET-matched bandpass filters will be incorporated to improve calibration stability. A wide dynamic range tracking camera will provide a high precision solar position tracking signal as well as an image of sky conditions around the solar axis. An ultrasonic window cleaning system design will be tested. A UV spectrometer tailored for formaldehyde and SO2 gas retrievals will be added to the spectrometer enclosure. Finally, expansion capability for a 4 channel polarized radiometer to measure the Stokes polarization vector of sky light will be incorporated. This paper presents initial progress on this next-generation 5STAR instrument. Keywords: atmosphere; climate; pollution; radiometry; technology; hyperspectral; fiber optic
Unbiased All-Optical Random-Number Generator
Steinle, Tobias; Greiner, Johannes N.; Wrachtrup, Jörg; Giessen, Harald; Gerhardt, Ilja
2017-10-01
The generation of random bits is of enormous importance in modern information science. Cryptographic security is based on random numbers which require a physical process for their generation. This is commonly performed by hardware random-number generators. These often exhibit a number of problems, namely experimental bias, memory in the system, and other technical subtleties, which reduce the reliability in the entropy estimation. Further, the generated outcome has to be postprocessed to "iron out" such spurious effects. Here, we present a purely optical randomness generator, based on the bistable output of an optical parametric oscillator. Detector noise plays no role and postprocessing is reduced to a minimum. Upon entering the bistable regime, initially the resulting output phase depends on vacuum fluctuations. Later, the phase is rigidly locked and can be well determined versus a pulse train, which is derived from the pump laser. This delivers an ambiguity-free output, which is reliably detected and associated with a binary outcome. The resulting random bit stream resembles a perfect coin toss and passes all relevant randomness measures. The random nature of the generated binary outcome is furthermore confirmed by an analysis of resulting conditional entropies.
Teach and Touch the Earth and Sky
Florina Tendea, Camelia
2017-04-01
My name is Camelia Florina Tendea. I am primary school teacher at "Horea, Closca and Crisan" Secondary School, in Brad, a town in the west side of Transylvania. I am permanently interested to develop my knowledge and teaching skills about space sciences (Earth and Sky) because the new generations of students are very well informed and couriouse about these topics. In this context the teachers must be prepared to deal with such requests in school. Introducing of activity: For a primary school teacher is a real challenge teaching about Earth and Sky, so I consider that a collaboration with science teachers, engineers and other specialists in the sciences is absolutely essential and beneficial in the educational design. In my opinion, the contents about Earth ans Sky-Space in a single word- are very attractive for students and they are a permanent source of discoveries and provide a multidisciplinary vision, so required in the education. Possible contents to teach in primary school: about Earth: -Terra -the third Planet from the Sun; How Earth spins; Land and water; The Earth seen from space, Trip between Earth and Moon,Weather Phenomena; the Poles; about Sky: Solar System, Asteroids, Comets, Meteorites; Rosetta Mission or rendez-vous with a comet; Sun.Moon. Earth. Eclipse;Light Pollution and protection of the night sky; Life in Space. Astronauts and experiences; Mission X:- Train Like an Astronaut;About ISS. For teachers it is important to know from the beginning how they teach, a viable support is the teaching of STEM subjects, which provides access to careers in astronomy, science/technology space. We could teach about earth and sky using different kinds of experiments, simulations, hands-on activities, competitions, exhibitions, video presentations. Competences developed in primary school through these contents: Comunication, individual studying, understanding and valorisation of scientific information, relating to the natural environment. In addition, they are
Using routine meteorological data to derive sky conditions
Directory of Open Access Journals (Sweden)
D. Pagès
Full Text Available Sky condition is a matter of interest for public and weather predictors as part of weather analyses. In this study, we apply a method that uses total solar radiation and other meteorological data recorded by an automatic station for deriving an estimation of the sky condition. The impetus of this work is the intention of the Catalan Meteorological Service (SMC to provide the public with real-time information about the sky condition. The methodology for deriving sky conditions from meteorological records is based on a supervised classification technique called maximum likelihood method. In this technique we first need to define features which are derived from measured variables. Second, we must decide which sky conditions are intended to be distinguished. Some analyses have led us to use four sky conditions: (a cloudless or almost cloudless sky, (b scattered clouds, (c mostly cloudy – high clouds, (d overcast – low clouds. An additional case, which may be treated separately, corresponds to precipitation (rain or snow. The main features for estimating sky conditions are, as expected, solar radiation and its temporal variability. The accuracy of this method of guessing sky conditions compared with human observations is around 70% when applied to four sites in Catalonia (NE Iberian Peninsula. The agreement increases if we take into account the uncertainty both in the automatic classifier and in visual observations.
Key words. Meteorological and atmospheric dynamics (instruments and techniques; radiative processes – Atmospheric composition and structure (cloud physics and chemistry
A Regional, Multi-Stakeholder Collaboration for Dark-Sky Protection in Flagstaff, Arizona
Hall, Jeffrey C.
2018-01-01
Flagstaff, Arizona is home to almost $200M in astronomical assets, including Lowell Observatory's 4.3-meter Discovery Channel Telescope and the Navy Precision Optical Interferometer, a partnership of Lowell, the U. S. Naval Observatory, and the Naval Research Laboratory. The City of Flagstaff and surrounding Coconino County have comprehensive and effective dark-sky ordinances, but continued regional growth has the potential to degrade the area's dark skies to a level at which observatory missions could be compromised. As a result, a wide array of stakeholders (the observatories, the City, the County, local dark-sky advocates, the business and tourism communities, the national parks and monuments, the Navajo Nation, the U. S. Navy, and others) have engaged in three complementary efforts to ensure that Flagstaff and Coconino County protect the area's dark skies while meeting the needs of the various communities and providing for continued growth and development. In this poster, I will present the status of Flagstaff's conversion to LED outdoor lighting, the Mission Compatibility Study carried out by the Navy to evaluate the dark-sky effects of buildout in Flagstaff, and the Joint Land Use Study (JLUS) presently underway among all the aforementioned stakeholders. Taken in sum, the efforts represent a comprehensive and constructive approach to dark-sky preservation region-wide, and they show what can be achieved when a culture of dark-sky protection is present and deliberate efforts are undertaken to maintain it for decades to come.
Sky subtraction at the Poisson limit with fibre-optic multiobject spectroscopy
Sharp, R.; Parkinson, H.
2010-11-01
We report on the limitations of sky-subtraction accuracy for long-duration fibre-optic multiobject spectroscopy of faint astronomical sources during long-duration exposures. We show that while standard sky subtraction techniques yield accuracies consistent with the Poisson noise limit for exposures of 1h duration, there are large-scale systematic defects that inhibit the sensitivity gains expected on the summation of longer duration exposures. For the AAOmega system at the Anglo-Australian Telescope, we identify a limiting systematic sky-subtraction accuracy, which is reached after integration times of 4-10h. We show that these systematic defects can be avoided through the use of the fibre nod-and-shuffle (N+S) observing mode, but with a potential cost in observing efficiency. Finally, we demonstrate that these disadvantages can be overcome through the application of a Principal Components Analysis (PCA) sky-subtraction routine. Such an approach minimize systematic residuals across long-duration exposures, allowing deep integrations. We apply the PCA approach to over 200h of on-sky observations and conclude that for the AAOmega system, the residual error in long-duration observations falls at a rate proportional to τ-0.32 in contrast to the τ-0.5 rate expected from theoretical considerations. With this modest rate of decline, the PCA approach represents a more efficient mode of observation than the N+S technique for observations in the sky limited regime with durations of 10-100h (even before accounting for the additional signal-to-noise ratio and targeting efficiency losses often associated with the N+S technique). This conclusion has important implications for the observing strategies of the next generation of fibre-optics redshift surveys with existing facilities as well as design implications for fibre-optic systems destined for new facilities. It argues against the use of the inherently inefficient N+S technique for faint object fibre-optic survey
The cut-sky cosmic microwave background is not anomalous
International Nuclear Information System (INIS)
Pontzen, Andrew; Peiris, Hiranya V.
2010-01-01
The observed angular correlation function of the cosmic microwave background has previously been reported to be anomalous, particularly when measured in regions of the sky uncontaminated by Galactic emission. Recent work by Efstathiou et al. presents a Bayesian comparison of isotropic theories, casting doubt on the significance of the purported anomaly. We extend this analysis to all anisotropic Gaussian theories with vanishing mean ( =0), using the much wider class of models to confirm that the anomaly is not likely to point to new physics. On the other hand if there is any new physics to be gleaned, it results from low-l alignments which will be better quantified by a full-sky statistic. We also consider quadratic maximum likelihood power spectrum estimators that are constructed assuming isotropy. The underlying assumptions are therefore false if the ensemble is anisotropic. Nonetheless we demonstrate that, for theories compatible with the observed sky, these estimators (while no longer optimal) remain statistically superior to pseudo-C l power spectrum estimators.
Protecting Dark Skies in Chile
Smith, R. Chris; Sanhueza, Pedro; Phillips, Mark
2018-01-01
Current projections indicate that Chile will host approximately 70% of the astronomical collecting area on Earth by 2030, augmenting the enormous area of ALMA with that of three next-generation optical telescopes: LSST, GMTO, and E-ELT. These cutting-edge facilities represent billions of dollars of investment in the astronomical facilities hosted in Chile. The Chilean government, Chilean astronomical community, and the international observatories in Chile have recognized that these investments are threatened by light pollution, and have formed a strong collaboration to work at managing the threats. We will provide an update on the work being done in Chile, ranging from training municipalities about new lighting regulations to exploring international recognition of the dark sky sites of Northern Chile.
Evaluation of Clear Sky Models for Satellite-Based Irradiance Estimates
Energy Technology Data Exchange (ETDEWEB)
Sengupta, Manajit [National Renewable Energy Lab. (NREL), Golden, CO (United States); Gotseff, Peter [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2013-12-01
This report describes an intercomparison of three popular broadband clear sky solar irradiance model results with measured data, as well as satellite-based model clear sky results compared to measured clear sky data. The authors conclude that one of the popular clear sky models (the Bird clear sky model developed by Richard Bird and Roland Hulstrom) could serve as a more accurate replacement for current satellite-model clear sky estimations. Additionally, the analysis of the model results with respect to model input parameters indicates that rather than climatological, annual, or monthly mean input data, higher-time-resolution input parameters improve the general clear sky model performance.
Measuring the influence of aerosols and albedo on sky polarization.
Kreuter, A; Emde, C; Blumthaler, M
2010-11-01
All-sky distributions of the polarized radiance are measured using an automated fish-eye camera system with a rotating polarizer. For a large range of aerosol and surface albedo situations, the influence on the degree of polarization and sky radiance is investigated. The range of aerosol optical depth and albedo is 0.05-0.5 and 0.1-0.75, respectively. For this range of parameters, a reduction of the degree of polarization from about 0.7 to 0.4 was observed. The analysis is done for 90° scattering angle in the principal plane under clear sky conditions for a broadband channel of 450 ± 25 nm and solar zenith angles between 55° and 60°. Radiative transfer calculations considering three different aerosol mixtures are performed and and agree with the measurements within the statistical error.
International Nuclear Information System (INIS)
Bará, Salvador; Ribas, Salvador J; Kocifaj, Miroslav
2015-01-01
The artificial emissions of light contribute to a high extent to the observed brightness of the night sky in many places of the world. Determining the all-sky radiance of anthropogenic origin requires solving the radiative transfer equation for ground-level light sources, generally resorting to a double-scattering approximation in order to account for the observed radiance patterns with a reasonable degree of accuracy. Since the all-sky radiance distribution produced by an elementary light source depends on the distance to the observer in a way that is not immediately obvious, the contributions of sources located at different distances have to be computed on an individual basis, solving for each one the corresponding scattering integrals. In this paper we show that these calculations may be significantly alleviated by using a modal approach, whereby the hemispheric night-sky radiance is expanded in terms of a convenient basis of two-dimensional (2D) orthogonal functions. Since the modal coefficients of this expansion do vary smoothly with the distance to the observer, the all-sky brightness distributions produced by light sources located at arbitrary intermediate distances can be efficiently estimated by interpolation, provided that the coefficients at a discrete set of distances are accurately determined beforehand. (paper)
GOALS, STRATEGIES AND FIRST DISCOVERIES OF AO327, THE ARECIBO ALL-SKY 327 MHz DRIFT PULSAR SURVEY
Energy Technology Data Exchange (ETDEWEB)
Deneva, J. S. [Arecibo Observatory, HC3 Box 53995, Arecibo, PR 00612 (United States); Stovall, K.; Martinez, J. G.; Jenet, F. [Center for Advanced Radio Astronomy, Department of Physics and Astronomy, University of Texas at Brownsville, Brownsville, TX 78520 (United States); McLaughlin, M. A.; Bates, S. D.; Bagchi, M. [Department of Physics, West Virginia University, 111 White Hall, Morgantown, WV 26506 (United States); Freire, P. C. C. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany)
2013-09-20
We report initial results from AO327, a drift survey for pulsars with the Arecibo telescope at 327 MHz. The first phase of AO327 will cover the sky at declinations of –1° to 28°, excluding the region within 5° of the Galactic plane, where high scattering and dispersion make low-frequency surveys sub-optimal. We record data from a 57 MHz bandwidth with 1024 channels and 125 μs sampling time. The 60 s transit time through the AO327 beam means that the survey is sensitive to very tight relativistic binaries even with no acceleration searches. To date we have detected 44 known pulsars with periods ranging from 3 ms to 2.21 s and discovered 24 new pulsars. The new discoveries include 3 ms pulsars, three objects with periods of a few tens of milliseconds typical of young as well as mildly recycled pulsars, a nuller, and a rotating radio transient. Five of the new discoveries are in binary systems. The second phase of AO327 will cover the sky at declinations of 28°-38°. We compare the sensitivity and search volume of AO327 to the Green Bank North Celestial Cap survey and the GBT350 drift survey, both of which operate at 350 MHz.
Night Sky Brightness Measurement by the Public through a Mobile Phone App
Kamegai, Kazuhisa; Tsukada, Ken; Inoue, Hiroki
2015-08-01
The darkness of night sky is important naturally for astronomy researchers, and also for the public people. Particularly, it is meaningful for those who begin to have an interest in gazing stars. Some previous studies suggest that light pollution may affect human health and ecosystem in various ways. Furthermore, it causes a lot of waste of electric energy for lighting.In Japan, the night sky brightness had been measured by Ministry of Environment for a few decades. Recently some global efforts have been also conducted. However the number of measured position is limited because the measurement needs some apparatus and takes long time.Here we show a result of quick and easy measurements of night sky brightness by the public people through a mobile phone app. The measurements were conducted in cooperation between some members of the Tenpla project and a weather forecasting company. The app has been developed by the company and has been installed by over 6.5 million people, which allow us to get a large number of data. Our purposes are (1) making map of night sky brightness all over Japan and (2) providing an opportunity to enjoy gazing star for those who are not usually interested in astronomy.As an interactive function of the app, we put a questionnaire of four choices in which we ask users how many stars are visible in a part of the constellation of Orion. When users answer the question, we get the answer and the position where they are. Depending on the answer, we can roughly recognize the sky brightness of the position.We opened the measurements for several nights. As a result, we could get 4000 - 5000 data all over the country per night. The map of each night is a snapshot of sky brightness of the night including effect of the weather. For example we can recognize that the sky is getting darker as a function of distance from the metropolitan area of Tokyo. We will show the detail results in the presentation.
A multi-sensor data-driven methodology for all-sky passive microwave inundation retrieval
Takbiri, Zeinab; Ebtehaj, Ardeshir M.; Foufoula-Georgiou, Efi
2017-06-01
We present a multi-sensor Bayesian passive microwave retrieval algorithm for flood inundation mapping at high spatial and temporal resolutions. The algorithm takes advantage of observations from multiple sensors in optical, short-infrared, and microwave bands, thereby allowing for detection and mapping of the sub-pixel fraction of inundated areas under almost all-sky conditions. The method relies on a nearest-neighbor search and a modern sparsity-promoting inversion method that make use of an a priori dataset in the form of two joint dictionaries. These dictionaries contain almost overlapping observations by the Special Sensor Microwave Imager and Sounder (SSMIS) on board the Defense Meteorological Satellite Program (DMSP) F17 satellite and the Moderate Resolution Imaging Spectroradiometer (MODIS) on board the Aqua and Terra satellites. Evaluation of the retrieval algorithm over the Mekong Delta shows that it is capable of capturing to a good degree the inundation diurnal variability due to localized convective precipitation. At longer timescales, the results demonstrate consistency with the ground-based water level observations, denoting that the method is properly capturing inundation seasonal patterns in response to regional monsoonal rain. The calculated Euclidean distance, rank-correlation, and also copula quantile analysis demonstrate a good agreement between the outputs of the algorithm and the observed water levels at monthly and daily timescales. The current inundation products are at a resolution of 12.5 km and taken twice per day, but a higher resolution (order of 5 km and every 3 h) can be achieved using the same algorithm with the dictionary populated by the Global Precipitation Mission (GPM) Microwave Imager (GMI) products.
A multi-sensor data-driven methodology for all-sky passive microwave inundation retrieval
Directory of Open Access Journals (Sweden)
Z. Takbiri
2017-06-01
Full Text Available We present a multi-sensor Bayesian passive microwave retrieval algorithm for flood inundation mapping at high spatial and temporal resolutions. The algorithm takes advantage of observations from multiple sensors in optical, short-infrared, and microwave bands, thereby allowing for detection and mapping of the sub-pixel fraction of inundated areas under almost all-sky conditions. The method relies on a nearest-neighbor search and a modern sparsity-promoting inversion method that make use of an a priori dataset in the form of two joint dictionaries. These dictionaries contain almost overlapping observations by the Special Sensor Microwave Imager and Sounder (SSMIS on board the Defense Meteorological Satellite Program (DMSP F17 satellite and the Moderate Resolution Imaging Spectroradiometer (MODIS on board the Aqua and Terra satellites. Evaluation of the retrieval algorithm over the Mekong Delta shows that it is capable of capturing to a good degree the inundation diurnal variability due to localized convective precipitation. At longer timescales, the results demonstrate consistency with the ground-based water level observations, denoting that the method is properly capturing inundation seasonal patterns in response to regional monsoonal rain. The calculated Euclidean distance, rank-correlation, and also copula quantile analysis demonstrate a good agreement between the outputs of the algorithm and the observed water levels at monthly and daily timescales. The current inundation products are at a resolution of 12.5 km and taken twice per day, but a higher resolution (order of 5 km and every 3 h can be achieved using the same algorithm with the dictionary populated by the Global Precipitation Mission (GPM Microwave Imager (GMI products.
NOAA Climate Data Record (CDR) of Cloud and Clear-Sky Radiation Properties, Version 1.0
National Oceanic and Atmospheric Administration, Department of Commerce — The NASA LaRC cloud and clear sky radiation properties dataset is generated using algorithms initially developed for application to TRMM and MODIS imagery within the...
The role of the eROSITA all-sky survey in searches for sterile neutrino dark matter
Energy Technology Data Exchange (ETDEWEB)
Zandanel, Fabio; Weniger, Christoph; Ando, Shin' ichiro, E-mail: f.zandanel@uva.nl, E-mail: c.weniger@uva.nl, E-mail: s.ando@uva.nl [GRAPPA Institute, University of Amsterdam, 1098 XH Amsterdam (Netherlands)
2015-09-01
We investigate for the first time the potential of angular auto- and cross-correlation power spectra in identifying sterile neutrino dark matter in the cosmic X-ray background. We take as reference the performance of the soon-to-be-launched eROSITA satellite. The main astrophysical background sources against sterile neutrino decays are active galactic nuclei, galaxies powered by X-ray binaries, and clusters of galaxies. While sterile neutrino decays are always subdominant in the auto-correlation power spectra, they can be efficiently enhanced when cross-correlating with tracers of the dark matter distribution such as galaxies in the 2MASS catalogues. We show that the planned four-years eROSITA all-sky survey will provide a large enough photon statistics to potentially yield very stringent constraints on the decay lifetime, enabling to firmly test the recently claimed 3.56-keV X-ray line found towards several clusters and galaxies and its decaying dark matter interpretation. However, we also show that in order to fully exploit the potential of eROSITA for dark matter searches, it is vital to overcome the shot-noise limitations inherent to galaxy catalogues as tracers for the dark matter distribution.
NRAO Makes Available VLA Sky Survey Maps
1994-06-01
An original and comprehensive data set potentially full of scientific surprises now is available to astronomers, students and the public through the information superhighway. Radio images of the sky produced by the Very Large Array radio telescope -- one of the premier astronomical instruments in the world -- as part of a massive survey now are stored in an electronic repository avail- able over the Internet computer communications network. "Each of these sensitive new sky maps shows about a thou- sand radio-emitting objects, most of which have never been seen before," said Dr. J. J. Condon, leader of the National Radio As- tronomy Observatory (NRAO) survey team. "We are releasing them as soon as they are completed because they contain more data than we could possibly analyze by ourselves." "By using electronic distribution, we can open this tre- mendous resource of information for computer analysis by all as- tronomers immediately, without waiting for traditional publication," Condon added. The radio images are copyright NRAO/ AUI. Permission is granted for use of the material without charge for scholarly, educational and private non-commercial purposes. "It is entirely conceivable -- even probable -- that valuable discoveries will be made by students or amateur astrono- mers who devote the time to study these maps carefully," said team member Dr. W. D. Cotton. "Making this new information available electronically means that more people can participate in adding to its scientific value." The maps are a product of the NRAO VLA Sky Survey (NVSS), which began its observational phase in September of 1993 and will cover 82 percent of the sky when completed by the end of 1996. The NVSS is expected to produce a catalog of more than two million ra- dio-emitting objects in the sky, and it is the first sky survey sensitive to linearly polarized emission from radio sources beyond our own Milky Way galaxy. "The NVSS is being made as a service to the entire astronomical
Receptive fields of locust brain neurons are matched to polarization patterns of the sky.
Bech, Miklós; Homberg, Uwe; Pfeiffer, Keram
2014-09-22
Many animals, including insects, are able to use celestial cues as a reference for spatial orientation and long-distance navigation [1]. In addition to direct sunlight, the chromatic gradient of the sky and its polarization pattern are suited to serve as orientation cues [2-5]. Atmospheric scattering of sunlight causes a regular pattern of E vectors in the sky, which are arranged along concentric circles around the sun [5, 6]. Although certain insects rely predominantly on sky polarization for spatial orientation [7], it has been argued that detection of celestial E vector orientation may not suffice to differentiate between solar and antisolar directions [8, 9]. We show here that polarization-sensitive (POL) neurons in the brain of the desert locust Schistocerca gregaria can overcome this ambiguity. Extracellular recordings from POL units in the central complex and lateral accessory lobes revealed E vector tunings arranged in concentric circles within large receptive fields, matching the sky polarization pattern at certain solar positions. Modeling of neuronal responses under an idealized sky polarization pattern (Rayleigh sky) suggests that these "matched filter" properties allow locusts to unambiguously determine the solar azimuth by relying solely on the sky polarization pattern for compass navigation. Copyright © 2014 Elsevier Ltd. All rights reserved.
The γ-ray sky seen with H.E.S.S
International Nuclear Information System (INIS)
Volpe, F.
2011-01-01
H.E.S.S. is an array of four imaging Cherenkov telescopes located in the Khomas Highlands of Namibia. It has been in operation since December 2003 and detects very-high-energy (VHE) γ-rays with energies ranging from 100 GeV to ∼ 50 TeV. Since 2004, regular observation of the Galactic Plane has yielded wind nebulae (PWN), supernova remnants (SNRs), γ-ray binaries and, more recently, a stellar cluster and molecular clouds in the vicinity of shell-type SNRs. H.E.S.S. has observed fast and intense TeV variability. Highlights of the most recent H.E.S.S. observations are presented and their implications are discussed.
Sipocz, Brigitta; Hegedüs, Ramón; Kriska, György; Horváth, Gábor
2008-12-01
Using 180 degrees field-of-view (full-sky) imaging polarimetry, we measured the spatiotemporal change of the polarization of skylight during the total solar eclipse on 29 March 2006 in Turkey. We present our observations here on the temporal variation of the celestial patterns of the degree p and angle alpha of linear polarization of the eclipsed sky measured in the red (650 nm), green (550 nm), and blue (450 nm) parts of the spectrum. We also report on the temporal and spectral change of the positions of neutral (unpolarized, p = 0) points, and points with local minima or maxima of p of the eclipsed sky. Our results are compared with the observations performed by the same polarimetric technique during the total solar eclipse on 11 August 1999 in Hungary. Practically the same characteristics of celestial polarization were encountered during both eclipses. This shows that the observed polarization phenomena of the eclipsed sky may be general.
Experience in Solar System and Sky Motions
Coles, K. S.
2017-12-01
To help students predict where they will see objects in the sky, they must comprehend sky motion and the relative motions of individual objects. Activities to promote this comprehension among college and secondary students include: Tracking star motion in the planetarium: Students predict star motion by marking the expected path on plastic hemisphere models of the celestial dome. They check their prediction by observing and marking the actual motion. For comprehension, comparing motion in different parts of the sky surpasses two-dimensional views of the sky in books or on computers. Mastery is assessed by the same exercise with the sky set at other latitudes, including those on the other side of the equator. Making sundials: Students first make a horizontal sundial for the latitude of their choice following written directions (e.g., Waugh, 1973). One problem to solve is how to convert sundial time to standard time. A prompt is a picture of the analemma (the position of the Sun in the sky at a fixed clock time over the course of a year). Tests of mastery include the questions, "What accounts for the shape of the analemma?" and "What information is needed to predict the shape of the analemma one would see on other planets?" Reference: Waugh, A. E., 1973, Sundials: their theory and construction: Dover, 228 p.
Daylight and energy implications for CIE standard skies
International Nuclear Information System (INIS)
Li, Danny H.W.
2007-01-01
Recently, the International Commission on Illumination (CIE) has adopted a range of 15 standard skies, which include the existing CIE overcast, very clear and cloudless polluted skies, covering the whole probable spectrum of usual skies found in the world. The traditional daylight factor (DF) approach with the calculations being based on an isotropic overcast sky, however, cannot cater to the dynamic variations in daylight luminance and illuminance as the sun's position changes under non-overcast skies. Currently, we propose a numerical procedure that considers the changes in the luminance of sky elements to predict the interior daylight illuminance under the 15 CIE standard skies. This paper evaluates the method by using a typical room with a large vertical glazing window facing north. The available daylight for the room at mean hourly sun positions in each month in terms of DF and illuminance levels were determined and compared with those based on a computer program, namely, RADIANCE. A modification to the ground reflected component was made when a well defined shadow was cast in front of the window facade. It is shown that the results estimated by the proposed approach are in reasonably good agreement with those produced from RADIANCE. The interior daylight and lighting energy consumption were also determined using the proposed and the traditional DF approaches. The findings reveal that daylighting designs using existing CIE overcast sky only would considerably underestimate the indoor daylight availability and electric lighting energy savings, especially under high design indoor illuminance settings
VizieR Online Data Catalog: SKY2000 Master Catalog, Version 5 (Myers+ 2006)
Myers, J. R.; Sande, C. B.; Miller, A. C.; Warren, W. H., Jr.; Tracewell, D. A.
2015-02-01
The SKYMAP Star Catalog System consists of a Master Catalog stellar database and a collection of utility software designed to create and maintain the database and to generate derivative mission star catalogs (run catalogs). It contains an extensive compilation of information on almost 300000 stars brighter than 8.0mag. The original SKYMAP Master Catalog was generated in the early 1970's. Incremental updates and corrections were made over the following years but the first complete revision of the source data occurred with Version 4.0. This revision also produced a unique, consolidated source of astrometric information which can be used by the astronomical community. The derived quantities were removed and wideband and photometric data in the R (red) and I (infrared) systems were added. Version 4 of the SKY2000 Master Catalog was completed in April 2002; it marks the global replacement of the variability identifier and variability data fields. More details can be found in the description file sky2kv4.pdf. The SKY2000 Version 5 Revision 4 Master Catalog differs from Revision 3 in that MK and HD spectral types have been added from the Catalogue of Stellar Spectral Classifications (B. A. Skiff of Lowell Observatory, 2005), which has been assigned source code 50 in this process. 9622 entries now have MK types from this source, while 3976 entries have HD types from this source. SKY2000 V5 R4 also differs globally from preceding MC versions in that the Galactic coordinate computations performed by UPDATE have been increased in accuracy, so that differences from the same quantities from other sources are now typically in the last decimal places carried in the MC. This version supersedes the previous versions 1(V/95), 2(V/102), 3(V/105) and 4(V/109). (6 data files).
International Nuclear Information System (INIS)
Albert, A.; Drouhin, D.; Racca, C.; Andre, M.; Anghinolfi, M.; Anton, G.; Eberl, T.; Graf, K.; Hallmann, S.; Hoessl, J.; Hofestaedt, J.; James, C.W.; Kalekin, O.; Katz, U.; Kiessling, D.; Lahmann, R.; Sieger, C.; Ardid, M.; Felis, I.; Martinez-Mora, J.A.; Saldana, M.; Aubert, J.J.; Bertin, V.; Brunner, J.; Busto, J.; Carr, J.; Costantini, H.; Coyle, P.; Dornic, D.; Enzenhoefer, A.; Quinn, L.; Salvadori, I.; Turpin, D.; Avgitas, T.; Baret, B.; Bourret, S.; Coelho, J.A.B.; Creusot, A.; Gregoire, T.; Gracia Ruiz, R.; Lachaud, C.; Barrios-Marti, J.; Hernandez-Rey, J.J.; Illuminati, G.; Lotze, M.; Toennis, C.; Zornoza, J.D.; Zuniga, J.; Basa, S.; Marcelin, M.; Nezri, E.; Belhorma, B.; Biagi, S.; Coniglione, R.; Distefano, C.; Piattelli, P.; Riccobene, G.; Sapienza, P.; Trovato, A.; Bormuth, R.; Jong, M. de; Samtleben, D.F.E.; Bouwhuis, M.C.; Heijboer, A.J.; Jongen, M.; Michael, T.; Branzas, H.; Caramete, L.; Pavalas, G.E.; Popa, V.; Bruijn, R.; Melis, K.; Capone, A.; Di Palma, I.; Perrina, C.; Vizzoca, A.; Celli, S.; Cherkaoui El Moursli, R.; El Khayati, N.; Ettahiri, A.; Fassi, F.; Tayalati, Y.; Chiarusi, T.; Circella, M.; Sanchez-Losa, A.; Coleiro, A.; Diaz, A.F.; Deschamps, A.; Hello, Y.; De Bonis, G.; Domi, A.; Hugon, C.; Sanguineti, M.; Taiuti, M.; Donzaud, C.; El Bojaddaini, I.; Moussa, A.; Elsaesser, D.; Kadler, M.; Kreter, M.; Fusco, L.A.; Margiotta, A.; Pellegrino, C.; Spurio, M.; Versari, F.; Gay, P.; Giordano, V.; Glotin, H.; Haren, H. van; Kouchner, A.; Van Elewyck, V.; Kreykenbohm, I.; Wilms, J.; Kulikovskiy, V.; Lefevre, D.; Leonora, E.; Loucatos, S.; Vallage, B.; Marinelli, A.; Mele, R.; Vivolo, D.; Migliozzi, P.; Navas, S.; Organokov, M.; Pradier, T.; Schuessler, F.; Stolarczyk, T.
2017-01-01
Advanced LIGO detected a significant gravitational wave signal (GW170104) originating from the coalescence of two black holes during the second observation run on January 4th, 2017. An all-sky high-energy neutrino follow-up search has been made using data from the Antares neutrino telescope, including both upgoing and downgoing events in two separate analyses. No neutrino candidates were found within ±500 s around the GW event time nor any time clustering of events over an extended time window of ±3 months. The non-detection is used to constrain isotropic-equivalent high-energy neutrino emission from GW170104 to less than ∝ 1.2 x 10 55 erg for a E -2 spectrum. This constraint is valid in the energy range corresponding to the 5-95% quantiles of the neutrino flux [3.2 TeV; 3.6 PeV], if the GW emitter was below the Antares horizon at the alert time. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Albert, A.; Drouhin, D.; Racca, C. [Universite de Haute Alsace - Institut Universitaire de Technologie de Colmar, GRPHE, Colmar (France); Andre, M. [Technical University of Catalonia, Laboratory of Applied Bioacoustics, Vilanova i la Geltru, Barcelona (Spain); Anghinolfi, M. [INFN-Sezione di Genova, Genoa (Italy); Anton, G.; Eberl, T.; Graf, K.; Hallmann, S.; Hoessl, J.; Hofestaedt, J.; James, C.W.; Kalekin, O.; Katz, U.; Kiessling, D.; Lahmann, R.; Sieger, C. [Friedrich-Alexander-Universitaet Erlangen-Nuernberg, Erlangen Centre for Astroparticle Physics, Erlangen (Germany); Ardid, M.; Felis, I.; Martinez-Mora, J.A.; Saldana, M. [Universitat Politecnica de Valencia, Institut d' Investigacio per a la Gestio Integrada de les Zones Costaneres (IGIC), Gandia (Spain); Aubert, J.J.; Bertin, V.; Brunner, J.; Busto, J.; Carr, J.; Costantini, H.; Coyle, P.; Dornic, D.; Enzenhoefer, A.; Quinn, L.; Salvadori, I.; Turpin, D. [Aix Marseille Univ., CNRS/IN2P3, CPPM, Marseille (France); Avgitas, T.; Baret, B.; Bourret, S.; Coelho, J.A.B.; Creusot, A.; Gregoire, T.; Gracia Ruiz, R.; Lachaud, C. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (France); Barrios-Marti, J.; Hernandez-Rey, J.J.; Illuminati, G.; Lotze, M.; Toennis, C.; Zornoza, J.D.; Zuniga, J. [IFIC-Instituto de Fisica Corpuscular (CSIC-Universitat de Valencia), Paterna, Valencia (Spain); Basa, S.; Marcelin, M.; Nezri, E. [Pole de l' Etoile Site de Chateau-Gombert, LAM-Laboratoire d' Astrophysique de Marseille (France); Belhorma, B. [National Center for Energy Sciences and Nuclear Techniques, Rabat (Morocco); Biagi, S.; Coniglione, R.; Distefano, C.; Piattelli, P.; Riccobene, G.; Sapienza, P.; Trovato, A. [INFN-Laboratori Nazionali del Sud (LNS), Catania (Italy); Bormuth, R.; Jong, M. de; Samtleben, D.F.E. [Nikhef, Amsterdam (Netherlands); Universiteit Leiden, Huygens-Kamerlingh Onnes Laboratorium, Leiden (Netherlands); Bouwhuis, M.C.; Heijboer, A.J.; Jongen, M.; Michael, T. [Nikhef, Amsterdam (Netherlands); Branzas, H.; Caramete, L.; Pavalas, G.E.; Popa, V. [Institute for Space Science, Bucharest (Romania); Bruijn, R.; Melis, K. [Nikhef, Amsterdam (Netherlands); Universiteit van Amsterdam, Instituut voor Hoge-Energie Fysica, Amsterdam (Netherlands); Capone, A.; Di Palma, I.; Perrina, C.; Vizzoca, A. [INFN-Sezione di Roma, Rome (Italy); Dipartimento di Fisica dell' Universita La Sapienza, Rome (Italy); Celli, S. [INFN-Sezione di Roma, Rome (Italy); Dipartimento di Fisica dell' Universita La Sapienza, Rome (Italy); Gran Sasso Science Institute, L' Aquila (Italy); Cherkaoui El Moursli, R.; El Khayati, N.; Ettahiri, A.; Fassi, F.; Tayalati, Y. [University Mohammed V, Faculty of Sciences, Rabat (Morocco); Chiarusi, T. [INFN-Sezione di Bologna, Bologna (Italy); Circella, M.; Sanchez-Losa, A. [INFN-Sezione di Bari, Bari (Italy); Coleiro, A. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (France); IFIC-Instituto de Fisica Corpuscular (CSIC-Universitat de Valencia), Paterna, Valencia (Spain); Diaz, A.F. [University of Granada, Department of Computer Architecture and Technology/CITIC, Granada (Spain); Deschamps, A.; Hello, Y. [Geoazur, UCA, CNRS, IRD, Observatoire de la Cote d' Azur, Sophia Antipolis (France); De Bonis, G. [Dipartimento di Fisica dell' Universita La Sapienza, Rome (Italy); Domi, A.; Hugon, C.; Sanguineti, M.; Taiuti, M. [INFN-Sezione di Genova, Genoa (Italy); Dipartimento di Fisica dell' Universita, Genoa (Italy); Donzaud, C. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (France); Universite Paris-Sud, Orsay (France); El Bojaddaini, I.; Moussa, A. [University Mohammed I, Laboratory of Physics of Matter and Radiations, Oujda (Morocco); Elsaesser, D.; Kadler, M.; Kreter, M. [Institut fuer Theoretische Physik und Astrophysik, Universitaet Wuerzburg, Wuerzburg (Germany); Fusco, L.A.; Margiotta, A.; Pellegrino, C.; Spurio, M.; Versari, F. [INFN-Sezione di Bologna, Bologna (Italy); Dipartimento di Fisica e Astronomia dell' Universita, Bologna (Italy); Gay, P. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (France); Clermont Universite, Universite Blaise Pascal, Laboratoire de Physique Corpusculaire, CNRS/IN2P3, Clermont-Ferrand (France); Giordano, V. [INFN-Sezione di Catania, Catania (Italy); Glotin, H. [LSIS, Aix Marseille Universite CNRS ENSAM LSIS UMR 7296, Marseille (France); Universite de Toulon CNRS LSIS UMR 7296, La Garde (FR); Institut Universitaire de France, Paris (FR); Haren, H. van [Utrecht University, Royal Netherlands Institute for Sea Research (NIOZ), ' t Horntje (Texel) (NL); Kouchner, A.; Van Elewyck, V. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (FR); Institut Universitaire de France, Paris (FR); Kreykenbohm, I.; Wilms, J. [Universitaet Erlangen-Nuernberg, Dr. Remeis-Sternwarte and ECAP, Bamberg (DE); Kulikovskiy, V. [Aix Marseille Univ., CNRS/IN2P3, CPPM, Marseille (FR); Moscow State University, Skobeltsyn Institute of Nuclear Physics, Moscow (RU); Lefevre, D. [Aix-Marseille University, Mediterranean Institute of Oceanography (MIO), Marseille (FR); Universite du Sud Toulon-Var, CNRS-INSU/IRD UM 110, La Garde (FR); Leonora, E. [INFN-Sezione di Catania, Catania (IT); Dipartimento di Fisica e Astronomia dell' Universita, Catania (IT); Loucatos, S.; Vallage, B. [Univ Paris Diderot, CNRS/IN2P3, CEA/Irfu, Obs de Paris, Sorbonne Paris Cite, APC, Paris (FR); Direction des Sciences de la Matiere-Institut de Recherche sur les Lois Fondamentales de l' Univers-Service de Physique des Particules, CEA Saclay, Gif-sur-Yvette (FR); Marinelli, A. [INFN-Sezione di Pisa, Pisa (IT); Dipartimento di Fisica dell' Universita, Pisa (IT); Mele, R.; Vivolo, D. [INFN-Sezione di Napoli, Naples (IT); Dipartimento di Fisica dell' Universita Federico II di Napoli, Naples (IT); Migliozzi, P. [INFN-Sezione di Napoli, Naples (IT); Navas, S. [University of Granada, Dept. de Fisica Teorica y del Cosmos y C.A.F.P.E., Granada (ES); Organokov, M.; Pradier, T. [Universite de Strasbourg, CNRS, Strasbourg (FR); Schuessler, F.; Stolarczyk, T. [Direction des Sciences de la Matiere-Institut de Recherche sur les Lois Fondamentales de l' Univers-Service de Physique des Particules, CEA Saclay, Gif-sur-Yvette (FR); Collaboration: The ANTARES Collaboration
2017-12-15
Advanced LIGO detected a significant gravitational wave signal (GW170104) originating from the coalescence of two black holes during the second observation run on January 4th, 2017. An all-sky high-energy neutrino follow-up search has been made using data from the Antares neutrino telescope, including both upgoing and downgoing events in two separate analyses. No neutrino candidates were found within ±500 s around the GW event time nor any time clustering of events over an extended time window of ±3 months. The non-detection is used to constrain isotropic-equivalent high-energy neutrino emission from GW170104 to less than ∝ 1.2 x 10{sup 55} erg for a E{sup -2} spectrum. This constraint is valid in the energy range corresponding to the 5-95% quantiles of the neutrino flux [3.2 TeV; 3.6 PeV], if the GW emitter was below the Antares horizon at the alert time. (orig.)
Lomb, Nick
2014-01-01
Compact, easy to use and reliable, this popular guide has been providing star gazers with everything they need to know about the southern night sky for the past 25 years. The 2015 guide will celebrate this landmark with highlights from the past as well as monthly astronomy maps, viewing tips and highlights, and details of the year's exciting celestial events.Wherever you are in Australia or New Zealand, easy calculations allow you to estimate local rise and set times for the Sun, Moon and planets. The 2015 Australasian Sky Guide also provides information on the solar system, updated with the l
The California All-sky Meteor Surveillance (CAMS) System
Gural, P. S.
2011-01-01
A unique next generation multi-camera, multi-site video meteor system is being developed and deployed in California to provide high accuracy orbits of simultaneously captured meteors. Included herein is a description of the goals, concept of operations, hardware, and software development progress. An appendix contains a meteor camera performance trade study made for video systems circa 2010.
The New Progress of the Starry Sky Project of China
Wang, Xiaohua
2015-08-01
Since the 28th General Assembly of IAU, the SSPC team made new progress:1. Enhanced the function of the SSPC team-- Established the contact with IAU C50, IUCN Dark Skies Advisory Group, AWB and IDA,and undertakes the work of the IDA Beijing Chapter.-- Got supports from China’s National Astronomical Observatories, Beijing Planetarium, and Shanghai Science and Technology Museum.-- Signed cooperation agreements with Lighting Research Center, English Education Group and law Firm; formed the team force.2. Put forward a proposal to national top institutionThe SSPC submitted the first proposal about dark sky protection to the Chinese People’s Political Consultative Conference.3. Introduced the Criteria and Guideline of dark sky protectionThe SSPC team translated 8 documents of IDA, and provided a reference basis for Chinese dark sky protection.4. Actively establish dark sky places-- Plan a Dark Sky Reserve around Ali astronomical observatory (5,100m elevation) in Tibet. China’s Xinhua News Agency released the news.-- Combining with Hangcuo Lake, a National Natural Reserve and Scenic in Tibet, to plan and establish the Dark Sky Park.-- Cooperated with Shandong Longgang Tourism Group to construct the Dream Sky Theme Park in the suburbs of Jinan city.In the IYL 2015, the SSPC is getting further development:First, make dark sky protection enter National Ecological Strategy of “Beautiful China”. We call on: “Beautiful China” needs “Beautiful Night Sky” China should care the shared starry sky, and left this resource and heritage for children.Second, hold “Cosmic Light” exhibition in Shanghai Science and Technology Museum on August.Third, continue to establish Dark Sky Reserve, Park and Theme Park. We want to make these places become the bases of dark sky protection, astronomical education and ecological tourism, and develop into new cultural industry.Fourth, actively join international cooperation.Now, “Blue Sky, White Cloud and Starry Sky “have become
THE 2010 VERY HIGH ENERGY gamma-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87
Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; de Almeida, U. Barres; Becherini, Y.; Becker, J.; Behera, B.; Bernloehr, K.; Birsin, E.; Biteau, J.; Bochow, A.
2012-01-01
The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3-6) x 10(9) M-circle dot) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, resu...
Tropospheric haze and colors of the clear daytime sky.
Lee, Raymond L
2015-02-01
To casual observers, haze's visible effects on clear daytime skies may seem mundane: significant scattering by tropospheric aerosols visibly (1) reduces the luminance contrast of distant objects and (2) desaturates sky blueness. However, few published measurements of hazy-sky spectra and chromaticities exist to compare with these naked-eye observations. Hyperspectral imaging along sky meridians of clear and hazy skies at one inland and two coastal sites shows that they have characteristic colorimetric signatures of scattering and absorption by haze aerosols. In addition, a simple spectral transfer function and a second-order scattering model of skylight reveal the net spectral and colorimetric effects of haze.
Aquarius L-Band Radiometers Calibration Using Cold Sky Observations
Dinnat, Emmanuel P.; Le Vine, David M.; Piepmeier, Jeffrey R.; Brown, Shannon T.; Hong, Liang
2015-01-01
An important element in the calibration plan for the Aquarius radiometers is to look at the cold sky. This involves rotating the satellite 180 degrees from its nominal Earth viewing configuration to point the main beams at the celestial sky. At L-band, the cold sky provides a stable, well-characterized scene to be used as a calibration reference. This paper describes the cold sky calibration for Aquarius and how it is used as part of the absolute calibration. Cold sky observations helped establish the radiometer bias, by correcting for an error in the spillover lobe of the antenna pattern, and monitor the long-term radiometer drift.
Polarization patterns of the twilight sky
Cronin, Thomas W.; Warrant, Eric J.; Greiner, Birgit
2005-08-01
Although natural light sources produce depolarized light, patterns of partially linearly polarized light appear in the sky due to scattering from air molecules, dust, and aerosols. Many animals, including bees and ants, orient themselves to patterns of polarization that are present in daytime skies, when the intensity is high and skylight polarization is strong and predictable. The halicitid bee Megalopta genalis inhabits rainforests in Central America. Unlike typical bees, it forages before sunrise and after sunset, when light intensities under the forest canopy are very low, and must find its way to food sources and return to its nest in visually challenging circumstances. An important cue for the orientation could be patterns of polarization in the twilight sky. Therefore, we used a calibrated digital camera to image skylight polarization in an overhead patch of sky, 87.6° across, before dawn on Barro Colorado Island in Panama, where the bees are found. We simultaneously measured the spectral properties of polarized light in a cloudless patch of sky 15° across centered on the zenith. We also performed full-sky imaging of polarization before dawn and after dusk on Lizard Island in Australia, another tropical island. During twilight, celestial polarized light occurs in a wide band stretching perpendicular to the location of the hidden sun and reaching typical degrees of polarization near 80% at wavelengths >600 nm. This pattern appears about 45 minutes before local sunrise or disappears 45 minutes after local sunset (about 20 minutes after the onset of astronomical twilight at dawn, or before its end at dusk) and extends with little change through the entire twilight period. Such a strong and reliable orientation cue could be used for flight orientation by any animal with polarization sensitivity that navigates during twilight.
The Transient High-Energy Sky and Early Universe Surveyor (THESEUS)
Amati, L.; O'Brien, P.; Goetz, D.; Tenzer, C.; Bozzo, E.
2017-10-01
The Transient High Energy Sky and Early Universe Surveyor (THESEUS) is a mission concept developed by a large international collaboration aimed at exploiting Gamma-Ray Bursts for investigating the early Universe. The main scientic objectives of THESEUS, currently under evaluation by ESA within the selection process for next M5 mission, include: investigating the star formation rate and metallicity evolution of the ISM and IGM up to redshift 10, detecting the first generation (pop III) of stars, studying the sources and physics of re-ionization, detecting the faint end of galaxies luminosity function. These goals will be achieved through a unique combination of instruments allowing GRB detection and arcmin localization over a broad FOV (more than 1sr) and an energy band extending from several MeVs down to 0.3 keV with unprecedented sensitivity, as well as on-board prompt (few minutes) follow-up with a 0.7m class IR telescope with both imaging and spectroscopic capabilities. Such instrumentation will also allow THESEUS to perform a monitoring of the X-ray sky with unprecedented sensitivity, which will provide a perfect service and sinergy to next generation multi-wavalength (e.g., E-ELT, SKA, CTA, ATHENA) and multi-messenger (aLIGO, aVIRGO, eLISA, ET, neutrino detectors, ...) facilities.
Go-To Telescopes Under Suburban Skies
Monks, Neale
2010-01-01
For the last four centuries stargazers have turned their telescopes to the night skies to look at its wonders, but only in this age of computers has it become possible to let the telescope find for you the object you are looking for! So-called “go-to” telescopes are programmed with the locations of thousands of objects, including dazzling distant Suns, stunning neighboring galaxies, globular and open star clusters, the remnants of past supernovae, and many other breathtaking sights. This book does not tell you how to use your Go-to telescope. Your manual will help you do that. It tells you what to look for in the deep sky and why, and what equipment to best see it with. Organized broadly by what is best for viewing in the northern hemisphere in different seasons, Monks further divides the sights of each season into groupings such as “Showpiece Objects,” “Interesting Deep Sky Objects,” and “Obscure and Challenging Deep Sky Objects.” He also tells what objects are visible even in light-polluted ...
SKYMONITOR: A Global Network for Sky Brightness Measurements
Davis, Donald R.; Mckenna, D.; Pulvermacher, R.; Everett, M.
2010-01-01
We are implementing a global network to measure sky brightness at dark-sky critical sites with the goal of creating a multi-decade database. The heart of this project is the Night Sky Brightness Monitor (NSBM), an autonomous 2 channel photometer which measures night sky brightness in the visual wavelengths (Mckenna et al, AAS 2009). Sky brightness is measured every minute at two elevation angles typically zenith and 20 degrees to monitor brightness and transparency. The NSBM consists of two parts, a remote unit and a base station with an internet connection. Currently these devices use 2.4 Ghz transceivers with a range of 100 meters. The remote unit is battery powered with daytime recharging using a solar panel. Data received by the base unit is transmitted via email protocol to IDA offices in Tucson where it will be collected, archived and made available to the user community via a web interface. Two other versions of the NSBM are under development: one for radio sensitive areas using an optical fiber link and the second that reads data directly to a laptop for sites without internet access. NSBM units are currently undergoing field testing at two observatories. With support from the National Science Foundation, we will construct and install a total of 10 units at astronomical observatories. With additional funding, we will locate additional units at other sites such as National Parks, dark-sky preserves and other sites where dark sky preservation is crucial. We will present the current comparison with the National Park Service sky monitoring camera. We anticipate that the SKYMONITOR network will be functioning by the end of 2010.
The Accuracy of RADIANCE Software in Modelling Overcast Sky Condition
Baharuddin
2013-01-01
A validation study of the sky models of RADIANCE simulation software against the overcast sky condition has been carried out in order to test the accuracy of sky model of RADIANCE for modeling the overcast sky condition in Hong Kong. Two sets of data have been analysed. Firstly, data collected from a set of experiments using a physical scale model. In this experiment, the illuminance of four points inside the model was measured under real sky conditions. Secondly, the RADIANCE simulation has ...
Systematic measurements of the night sky brightness at 26 locations in Eastern Austria
Posch, Thomas; Binder, Franz; Puschnig, Johannes
2018-05-01
We present an analysis of the zenithal night sky brightness (henceforth: NSB) measurements at 26 locations in Eastern Austria focussing on the years 2015-2016, both during clear and cloudy to overcast nights. All measurements have been performed with 'Sky Quality Meters' (SQMs). For some of the locations, simultaneous aerosol content measurements are available, such that we were able to find a correlation between light pollution and air pollution at those stations. For all locations, we examined the circalunar periodicity of the NSB, seasonal variations as well as long-term trends in the recorded light pollution. The latter task proved difficult, however, due to varying meteorological conditions, potential detector 'aging' and other effects. For several remote locations, a darkening of the overcast night sky by up to 1 magnitude is recorded - indicating a very low level of light pollution -, while for the majority of the examined locations, a brightening of the night sky by up to a factor of 15 occurs due to clouds. We present suitable ways to plot and analyze huge long-term NSB datasets, such as mean-NSB histograms, circalunar, annual ('hourglass') and cumulative ('jellyfish') plots. We show that five of the examined locations reach sufficiently low levels of light pollution - with NSB values down to 21.8 magSQM/arcsec2 - as to allow the establishment of dark sky reserves, even to the point of reaching the 'gold tier' defined by the International Dark Sky Association. Based on the 'hourglass' plots, we find a strong circalunar periodicity of the NSB in small towns and villages ( < 5.000 inhabitants), with amplitudes of up to 5 magnitudes. Using the 'jellyfish' plots, on the other hand, we demonstrate that the examined city skies brighten by up to 3 magnitudes under cloudy conditions, which strongly dominate in those cumulative data representations. Nocturnal gradients of the NSB of 0.0-0.14 magSQM/arcsec2/h are found. The long-term development of the night sky
International Nuclear Information System (INIS)
Shafer, R.A.; Fabian, A.C.
1983-01-01
An assessment is made of the extent to which the study of the isotropy of the X-ray sky has contributed to the present understanding of the structure of the universe at moderate redshifts. It is, of course, the anisotropic character of the sky flux that is valuable in this context. Although it is not currently possible to undertake measurements with the precision and small solid angles that are typically achieved in the microwave range, the comparatively crude limits from the X-ray fluctuations place limits on the largest scale structure of the universe. After indicating the nature of measurements made, with the HEAO 1 A-2 experiment, of the X-ray sky and its anisotropies, it is shown how these place limits on the origin of the X-ray sky and on any large scale structure of the universe. 40 references
Generating Milton Babbitt's all-partition arrays
Bemman, Brian; Meredith, David
2016-01-01
In most of Milton Babbitt's (1916–2011) works written since the early 1960s, both the pitch and rhythmic content is organized according to a highly constrained structure known as the all-partition array. The all-partition array provides a framework that ensures that as many different forms of a tone row as possible (generated by any combination of transposition, inversion or reversal) are expressed 'horizontally' and that each integer partition of 12 whose cardinality is no greater than the n...
Sky Mining - Application to Photomorphic Redshift Estimation
Nayak, Pragyansmita
severity every day, alternative method "Photometric redshift" has been studied in the past. It uses the brightness of the object viewed through various standard filters, each of which lets through a relatively broad spectrum of colors. However, these methods are bound by the degeneracy problem (objects with different color profiles have the same redshift) which leads to low predictive accuracy. As part of our study, we are looking beyond color attributes to identify other measured attributes as degeneracy resolvers as well as generate estimators that are highly accurate; termed as "Photomorphic redshift" estimators. The present study investigates the photometric information of the objects such as color and magnitude (= observed flux) and morphology attributes such as shape, size, orientation and concentration in the different wavelengths. The specific type of magnitude used in this study are the PSF, Fiber and Petrosian magnitude. The morphology attributes are the ratio of Fiber to Petrosian magnitude, concentration index and Petrosian radius. All these attributes are in the five bands ugriz of the Sloan Digital Sky Survey (SDSS). Machine learning techniques based on Naive Bayes (NB), Bayesian Network (BN) and Generalized Linear Model (GLM) are researched to better understand their applicability, advantages and resulting predictive performance in terms of efficiency and accuracy. Note: The SDSS Data Release (DR) 10 data was used in the executed experiments (total of 700,777 galaxies with forty-five attributes associated with each galaxy). The significant findings of the present work are as follows: 1. Magnitude and morphology attributes have been found to be successful degeneracy resolvers. 2. Magnitude and morphology attributes have been found to be better redshift estimators than color attributes alone. 3. Naive Bayes, Bayesian Network and GLM have been found to be viable redshift estimation methods. Attribute selection is an important factor in computational performance
Sio, Betsy Menson
2009-01-01
A sky fading from blue to white to red at the horizon, and water darkening from light to midnight blue. Strong diagonals slashing through the image, drawing a viewer's eyes deeper into the picture, and delicate trees poised to convey a sense of beauty. These are the fascinating strengths of the ukiyo-e woodblock prints of Japanese artist Ando…
Dark Skies Awareness Programs for the International Year of Astronomy
Walker, C. E.; Pompea, S. M.
2008-12-01
The loss of a dark night sky as a natural resource is a growing concern. It impacts not only astronomical research, but also our environment in terms of ecology, health, safety, economics and energy conservation. For this reason, "Dark Skies are a Universal Resource" is a cornerstone project for the U.S. International Year of Astronomy (IYA) program in 2009. Its goal is to raise public awareness of the impact of artificial lighting on local environments by getting people involved in a variety of dark skies-related programs. These programs focus on citizen-scientist sky-brightness monitoring programs, a planetarium show, podcasting, social networking, a digital photography contest, the Good Neighbor Lighting Program, Earth Hour, National Dark Skies Week, a traveling exhibit, a video tutorial, Dark Skies Discovery Sites, Astronomy Nights in the (National) Parks, Sidewalk Astronomy, and a Quiet Skies program. Many similar programs are available internationally through the "Dark Skies Awareness" Global Cornerstone Project. Working groups for both the national and international dark skies cornerstone projects are being chaired by the National Optical Astronomy Observatory (NOAO). The presenters from NOAO will provide the "know-how" and the means for session participants to become community advocates in promoting Dark Skies programs as public events at their home institutions. Participants will be able to get information on jump-starting their education programs through the use of well-developed instructional materials and kits. For more information, visit http://astronomy2009.us/darkskies/ and http://www.darkskiesawareness.org/.
SED16 autonomous star tracker night sky testing
Foisneau, Thierry; Piriou, Véronique; Perrimon, Nicolas; Jacob, Philippe; Blarre, Ludovic; Vilaire, Didier
2017-11-01
The SED16 is an autonomous multi-missions star tracker which delivers three axis satellite attitude in an inertial reference frame and the satellite angular velocity with no prior information. The qualification process of this star sensor includes five validation steps using optical star simulator, digitized image simulator and a night sky tests setup. The night sky testing was the final step of the qualification process during which all the functions of the star tracker were used in almost nominal conditions : Autonomous Acquisition of the attitude, Autonomous Tracking of ten stars. These tests were performed in Calern in the premises of the OCA (Observatoire de la Cote d'Azur). The test set-up and the test results are described after a brief review of the sensor main characteristics and qualification process.
New generation of devices for all-optical communications
International Nuclear Information System (INIS)
Glesk, I.; Runser, R.J.; Prucnal, P.R.
2001-01-01
To increase the transmission capacity of future communication networks is becoming very critical. This task can only be accomplished by taking advantage of optical networks where multiplexing techniques such as Dense Wavelength Division Multiplexing (DWDM) and Optical Time Division Multiplexing (OTDM) are employed. To avoid electronic bottlenecks a whole new generation of ultrafast devices is needed. To fulfill these needs a new class of all optical devices has been proposed and developed. By taking advantage of the nonlinear dynamics in semiconductor optical amplifiers in combination with the fiber interferometers a new generation of ultrafast all-optical de multiplexers and wavelength converters has been demonstrated. Other switching technologies are also promising for the future. The latest technologies in the area of micro machining have created very attractive low cost MEMS. Recently announced use of bubble technology for all-optical switching might also lead to the development of next generation large scale switching fabrics. This paper is an overview of the recent development in these areas. (authors)
Derotation of the cosmic microwave background polarization: Full-sky formalism
International Nuclear Information System (INIS)
Gluscevic, Vera; Kamionkowski, Marc; Cooray, Asantha
2009-01-01
Mechanisms have been proposed that might rotate the linear polarization of the cosmic microwave background (CMB) as it propagates from the surface of last scatter. In the simplest scenario, the rotation will be uniform across the sky, but the rotation angle may also vary across the sky. We develop in detail the complete set of full-sky quadratic estimators for the rotation of the CMB polarization that can be constructed from the CMB temperature and polarization. We derive the variance with which these estimators can be measured and show that these variances reduce to the simpler flat-sky expressions in the appropriate limit. We evaluate the variances numerically. While the flat-sky formalism may be suitable if the rotation angle arises as a realization of a random field, the full-sky formalism will be required to search for rotations that vary slowly across the sky as well as for models in which the angular power spectrum for the rotation angle peaks at large angles.
Night-sky brightness monitoring in Hong Kong: a city-wide light pollution assessment.
Pun, Chun Shing Jason; So, Chu Wing
2012-04-01
Results of the first comprehensive light pollution survey in Hong Kong are presented. The night-sky brightness was measured and monitored around the city using a portable light-sensing device called the Sky Quality Meter over a 15-month period beginning in March 2008. A total of 1,957 data sets were taken at 199 distinct locations, including urban and rural sites covering all 18 Administrative Districts of Hong Kong. The survey shows that the environmental light pollution problem in Hong Kong is severe-the urban night skies (sky brightness at 15.0 mag arcsec(- 2)) are on average ~ 100 times brighter than at the darkest rural sites (20.1 mag arcsec(- 2)), indicating that the high lighting densities in the densely populated residential and commercial areas lead to light pollution. In the worst polluted urban location studied, the night-sky at 13.2 mag arcsec(- 2) can be over 500 times brighter than the darkest sites in Hong Kong. The observed night-sky brightness is found to be affected by human factors such as land utilization and population density of the observation sites, together with meteorological and/or environmental factors. Moreover, earlier night skies (at 9:30 p.m. local time) are generally brighter than later time (at 11:30 p.m.), which can be attributed to some public and commercial lightings being turned off later at night. On the other hand, no concrete relationship between the observed sky brightness and air pollutant concentrations could be established with the limited survey sampling. Results from this survey will serve as an important database for the public to assess whether new rules and regulations are necessary to control the use of outdoor lightings in Hong Kong.
Sekar, Sandhya; Karanth, Praveen
2013-01-01
High elevation montane areas are called "sky islands" when they occur as a series of high mountains separated by lowland valleys. Different climatic conditions at high elevations makes sky islands a specialized type of habitat, rendering them naturally fragmented compared to more continuous habitat at lower elevations. Species in sky islands face unsuitable climate in the intervening valleys when moving from one montane area to another. The high elevation shola-grassland mosaic in the Western Ghats of southern India form one such sky island complex. The fragmented patches make this area ideal to study the effect of the spatial orientation of suitable habitat patches on population genetic structure of species found in these areas. Past studies have suggested that sky islands tend to have genetically structured populations, possibly due to reduced gene flow between montane areas. To test this hypothesis, we adopted the comparative approach. Using Amplified Fragment Length Polymorphisms, we compared population genetic structures of two closely related, similar sized butterfly species: Heteropsis oculus, a high elevation shola-grassland specialist restricted to the southern Western Ghats, and Mycalesis patnia, found more continuously distributed in lower elevations. In all analyses, as per expectation the sky island specialist H. oculus exhibited a greater degree of population genetic structure than M. patnia, implying a difference in geneflow. This difference in geneflow in turn appears to be due to the natural fragmentation of the sky island complexes. Detailed analysis of a subset of H. oculus samples from one sky island complex (the Anamalais) showed a surprising genetic break. A possible reason for this break could be unsuitable conditions of higher temperature and lower rainfall in the intervening valley region. Thus, sky island species are not only restricted by lack of habitat continuity between montane areas, but also by the nature of the intervening habitat.
The great canoes in the sky starlore and astronomy of the South Pacific
Chadwick, Stephen Robert
2017-01-01
Presenting spectacular photographs of astronomical objects of the southern sky, all taken by author Stephen Chadwick, this book explores what peoples of the South Pacific see when they look up at the heavens and what they have done with this knowledge. From wives killing brothers to emus rising out of the desert and great canoes in the sky, this book offers the perfect blend of science, tradition and mythology to bring to life the most famous sights in the heavens above the southern hemisphere. The authors place this starlore in the context of contemporary understandings of astronomy. The night sky of southern societies is as rich in culture as it is in stars. Stories, myths and legends based on constellations, heavenly bodies and other night sky phenomena have played a fundamental role in shaping the culture of pre-modern civilizations throughout the world. Such starlore continues to influence societies throughout the Pacific to this day, with cultures throughout the region – from Australia and New Zealand...
Sky-Hook Control and Kalman Filtering in Nonlinear Model of Tracked Vehicle Suspension System
Directory of Open Access Journals (Sweden)
Jurkiewicz Andrzej
2017-09-01
Full Text Available The essence of the undertaken topic is application of the continuous sky-hook control strategy and the Extended Kalman Filter as the state observer in the 2S1 tracked vehicle suspension system. The half-car model of this suspension system consists of seven logarithmic spiral springs and two magnetorheological dampers which has been described by the Bingham model. The applied continuous sky-hook control strategy considers nonlinear stiffness characteristic of the logarithmic spiral springs. The control is determined on estimates generated by the Extended Kalman Filter. Improve of ride comfort is verified by comparing simulation results, under the same driving conditions, of controlled and passive vehicle suspension systems.
All-sky search for gravitational-wave bursts in the first joint LIGO-GEO-Virgo run
International Nuclear Information System (INIS)
Abadie, J.; Abbott, B. P.; Abbott, R.; Adhikari, R.; Ajith, P.; Anderson, S. B.; Araya, M.; Aso, Y.; Ballmer, S.; Betzwieser, J.; Billingsley, G.; Black, E.; Blackburn, J. K.; Bork, R.; Brooks, A. F.; Cannon, K. C.; Cardenas, L.; Cepeda, C.; Chalermsongsak, T.; Chatterji, S.
2010-01-01
We present results from an all-sky search for unmodeled gravitational-wave bursts in the data collected by the LIGO, GEO 600 and Virgo detectors between November 2006 and October 2007. The search is performed by three different analysis algorithms over the frequency band 50-6000 Hz. Data are analyzed for times with at least two of the four LIGO-Virgo detectors in coincident operation, with a total live time of 266 days. No events produced by the search algorithms survive the selection cuts. We set a frequentist upper limit on the rate of gravitational-wave bursts impinging on our network of detectors. When combined with the previous LIGO search of the data collected between November 2005 and November 2006, the upper limit on the rate of detectable gravitational-wave bursts in the 64-2048 Hz band is 2.0 events per year at 90% confidence. We also present event rate versus strength exclusion plots for several types of plausible burst waveforms. The sensitivity of the combined search is expressed in terms of the root-sum-squared strain amplitude for a variety of simulated waveforms and lies in the range 6x10 -22 Hz -1/2 to 2x10 -20 Hz -1/2 . This is the first untriggered burst search to use data from the LIGO and Virgo detectors together, and the most sensitive untriggered burst search performed so far.
Determination of the sun area in sky camera images using radiometric data
International Nuclear Information System (INIS)
Alonso, J.; Batlles, F.J.; Villarroel, C.; Ayala, Rosa; Burgaleta, J.I.
2014-01-01
Highlights: • We have developed a model for the determination of solar area on sky camera imagery. • An estimation of direct normal irradiance is given for cloudless sky. • The presented model resolves the problem of saturation of pixels in the solar area. • The model allows to identify clouds in the solar area of sky camera imagery. • Developed model has an 92% of agreement between processed and observed images. - Abstract: Due to the increasing development and expansion of solar power plants, it is necessary to have complete and absolute knowledge of all factors and occurrences that can affect the dynamics and quality of their production. The importance of clouds in the attenuation of solar radiation is a transcendental and decisive factor in the incident energy from the sun. Detecting clouds with sky cameras is a very problematic issue. The captured solar area in the images exhibits a pronounced saturation of pixels as a consequence of sunlight penetration and the appearance of various atmospheric features. The present article reports a methodology based on radiometric data that is used to determine the causes of saturation in the solar zone and its vicinity on images from a TSI-880 model sky camera. The correct method identifies the presence or absence of clouds in the saturated zone with 92% success
Favé, Marie-Julie; Johnson, Robert A; Cover, Stefan; Handschuh, Stephan; Metscher, Brian D; Müller, Gerd B; Gopalan, Shyamalika; Abouheif, Ehab
2015-09-04
A fundamental and enduring problem in evolutionary biology is to understand how populations differentiate in the wild, yet little is known about what role organismal development plays in this process. Organismal development integrates environmental inputs with the action of gene regulatory networks to generate the phenotype. Core developmental gene networks have been highly conserved for millions of years across all animals, and therefore, organismal development may bias variation available for selection to work on. Biased variation may facilitate repeatable phenotypic responses when exposed to similar environmental inputs and ecological changes. To gain a more complete understanding of population differentiation in the wild, we integrated evolutionary developmental biology with population genetics, morphology, paleoecology and ecology. This integration was made possible by studying how populations of the ant species Monomorium emersoni respond to climatic and ecological changes across five 'Sky Islands' in Arizona, which are mountain ranges separated by vast 'seas' of desert. Sky Islands represent a replicated natural experiment allowing us to determine how repeatable is the response of M. emersoni populations to climate and ecological changes at the phenotypic, developmental, and gene network levels. We show that a core developmental gene network and its phenotype has kept pace with ecological and climate change on each Sky Island over the last ~90,000 years before present (BP). This response has produced two types of evolutionary change within an ant species: one type is unpredictable and contingent on the pattern of isolation of Sky lsland populations by climate warming, resulting in slight changes in gene expression, organ growth, and morphology. The other type is predictable and deterministic, resulting in the repeated evolution of a novel wingless queen phenotype and its underlying gene network in response to habitat changes induced by climate warming. Our
IMPROVED BACKGROUND SUBTRACTION FOR THE SLOAN DIGITAL SKY SURVEY IMAGES
International Nuclear Information System (INIS)
Blanton, Michael R.; Kazin, Eyal; Muna, Demitri; Weaver, Benjamin A.; Price-Whelan, Adrian
2011-01-01
We describe a procedure for background subtracting Sloan Digital Sky Survey (SDSS) imaging that improves the resulting detection and photometry of large galaxies on the sky. Within each SDSS drift scan run, we mask out detected sources and then fit a smooth function to the variation of the sky background. This procedure has been applied to all SDSS-III Data Release 8 images, and the results are available as part of that data set. We have tested the effect of our background subtraction on the photometry of large galaxies by inserting fake galaxies into the raw pixels, reanalyzing the data, and measuring them after background subtraction. Our technique results in no size-dependent bias in galaxy fluxes up to half-light radii r 50 ∼ 100 arcsec; in contrast, for galaxies of that size the standard SDSS photometric catalog underestimates fluxes by about 1.5 mag. Our results represent a substantial improvement over the standard SDSS catalog results and should form the basis of any analysis of nearby galaxies using the SDSS imaging data.
Design of a device for sky light polarization measurements.
Wang, Yujie; Hu, Xiaoping; Lian, Junxiang; Zhang, Lilian; Xian, Zhiwen; Ma, Tao
2014-08-14
Sky polarization patterns can be used both as indicators of atmospheric turbidity and as a sun compass for navigation. The objective of this study is to improve the precision of sky light polarization measurements by optimal design of the device used. The central part of the system is composed of a Charge Coupled Device (CCD) camera; a fish-eye lens and a linear polarizer. Algorithms for estimating parameters of the polarized light based on three images are derived and the optimal alignments of the polarizer are analyzed. The least-squares estimation is introduced for sky light polarization pattern measurement. The polarization patterns of sky light are obtained using the designed system and they follow almost the same patterns of the single-scattering Rayleigh model. Deviations of polarization angles between observation and the theory are analyzed. The largest deviations occur near the sun and anti-sun directions. Ninety percent of the deviations are less than 5° and 40% percent of them are less than 1°. The deviations decrease evidently as the degree of polarization increases. It also shows that the polarization pattern of the cloudy sky is almost identical as in the blue sky.
Reconstruction of Sky Illumination Domes from Ground-Based Panoramas
Coubard, F.; Lelégard, L.; Brédif, M.; Paparoditis, N.; Briottet, X.
2012-07-01
The knowledge of the sky illumination is important for radiometric corrections and for computer graphics applications such as relighting or augmented reality. We propose an approach to compute environment maps, representing the sky radiance, from a set of ground-based images acquired by a panoramic acquisition system, for instance a mobile-mapping system. These images can be affected by important radiometric artifacts, such as bloom or overexposure. A Perez radiance model is estimated with the blue sky pixels of the images, and used to compute additive corrections in order to reduce these radiometric artifacts. The sky pixels are then aggregated in an environment map, which still suffers from discontinuities on stitching edges. The influence of the quality of estimated sky radiance on the simulated light signal is measured quantitatively on a simple synthetic urban scene; in our case, the maximal error for the total sensor radiance is about 10%.
Suzuki, Yutaka; Urashima, Mitsuyoshi; Yoshida, Hideki; Iwase, Tsuyoshi; Kura, Toshiroh; Imazato, Shin; Kudo, Michiaki; Ohta, Tomoyuki; Mizuhara, Akihiro; Tamamori, Yutaka; Muramatsu, Hirohito; Nishiguchi, Yukio; Nishiyama, Yorihiro; Takahashi, Mikako; Nishiwaki, Shinji; Matsumoto, Masami; Goshi, Satoshi; Sakamoto, Shigeo; Uchida, Nobuyuki; Ijima, Masashi; Ogawa, Tetsushi; Shimazaki, Makoto; Takei, Shinichi; Kimura, Chikou; Yamashita, Satoyoshi; Endo, Takao; Nakahori, Masato; Itoh, Akihiko; Kusakabe, Toshiro; Ishizuka, Izumi; Iiri, Takao; Fukasawa, Shingo; Arimoto, Yukitsugu; Kajitani, Nobuaki; Ishida, Kazuhiko; Onishi, Koji; Taira, Akihiko; Kobayashi, Makoto; Itano, Yasuto; Kobuke, Toshiya
2009-01-01
During tube exchange for percutaneous endoscopic gastrostomy (PEG), a misplaced tube can cause peritonitis and death. Thus, endoscopic or radiologic observation is required at tube exchange to make sure the tube is placed correctly. However, these procedures cost extensive time and money to perform in all patients at the time of tube exchange. Therefore, we developed the "sky blue method" as a screening test to detect misplacement of the PEG tube during tube exchange. First, sky blue solution consisting of indigocarmine diluted with saline was injected into the gastric space via the old PEG tube just before the tube exchange. Next, the tube was exchanged using a standard method. Then, we checked whether the sky blue solution could be collected through the new tube or not. Finally, we confirmed correct placement of the tube by endoscopic or radiologic observation for all patients. A total of 961 patients were enrolled. Each tube exchange took 1 to 3 minutes, and there were no adverse effects. Four patients experienced a misplaced tube, all of which were detectable with the sky blue method. Diagnostic parameters of the sky blue method were as follows: sensitivity, 94% (95%CI: 92-95%); specificity, 100% (95%CI: 40-100%); positive predictive value, 100% (95%CI: 100-100%); negative predictive value, 6% (95%CI: 2-16%). These results suggest that the number of endoscopic or radiologic observations to confirm correct replacement of the PEG tube may be reduced to one fifteenth using the sky blue method.
Stability of the nine sky quality meters in the Dutch night sky brightness monitoring network.
den Outer, Peter; Lolkema, Dorien; Haaima, Marty; van der Hoff, Rene; Spoelstra, Henk; Schmidt, Wim
2015-04-22
In the context of monitoring abundance of artificial light at night, the year-to-year stability of Sky Quality Meters (SQMs) is investigated by analysing intercalibrations derived from two measurement campaigns that were held in 2011 and 2012. An intercalibration comprises a light sensitivity factor and an offset for each SQM. The campaigns were concerned with monitoring measurements, each lasting one month. Nine SQMs, together forming the Night Sky Brightness Monitoring network (MHN) in The Netherlands, were involved in both campaigns. The stability of the intercalibration of these instruments leads to a year-to-year uncertainty (standard deviation) of 5% in the measured median luminance occurring at the MHN monitoring locations. For the 10-percentiles and 90-percentiles, we find 8% and 4%, respectively. This means that, for urban and industrial areas, changes in the sky brightness larger than 5% become detectable. Rural and nature areas require an 8%-9% change of the median luminance to be detectable. The light sensitivety agrees within 8% for the whole group of SQMs.
Sky luminosity for Rio de Janeiro City - Brazil
International Nuclear Information System (INIS)
Corbella, O.D.
1995-12-01
This paper presents sky luminosity data for Rio de Janeiro City, useful to be used in daylighting design in architecture. The data are presented as monthly graphics that correlate sunshine-hours with the frequency of occurrence during the day of a specific type of sky, that would present one of five defined characteristics (among clear and overcast sky). These results were derived from the knowledge of daily solar radiation and sunshine-hours data, for every day for a twelve year period. (author). 10 refs, 13 figs, 16 tabs
The Transient High Energy Sky and Early Universe Surveyor (THESEUS)
Amati, Lorenzo; O'Brien, Paul T.; Götz, Diego
2016-07-01
The Transient High Energy Sky and Early Universe Surveyor (THESEUS) is a mission concept under development by a large international collaboration aimed at exploiting gamma-ray bursts for investigating the early Universe. The main scientific objectives of THESEUS include: investigating the star formation rate and metallicity evolution of the ISM and IGM up to redshift 9-10, detecting the first generation (pop III) of stars, studying the sources and physics of re-ionization, detecting the faint end of galaxies luminosity function. These goals will be achieved through a unique combination of instruments allowing GRB detection and arcmin localization over a broad FOV (more than 1sr) and an energy band extending from several MeVs down to 0.3 keV with unprecedented sensitivity, as well as on-board prompt (few minutes) follow-up with a 0.6m class IR telescope with both imaging and spectroscopic capabilities. Such instrumentation will also allow THESEUS to unveil and study the population of soft and sub-energetic GRBs, and, more in general, to perform monitoring and survey of the X-ray sky with unprecedented sensitivity.
RECONSTRUCTION OF SKY ILLUMINATION DOMES FROM GROUND-BASED PANORAMAS
Directory of Open Access Journals (Sweden)
F. Coubard
2012-07-01
Full Text Available The knowledge of the sky illumination is important for radiometric corrections and for computer graphics applications such as relighting or augmented reality. We propose an approach to compute environment maps, representing the sky radiance, from a set of ground-based images acquired by a panoramic acquisition system, for instance a mobile-mapping system. These images can be affected by important radiometric artifacts, such as bloom or overexposure. A Perez radiance model is estimated with the blue sky pixels of the images, and used to compute additive corrections in order to reduce these radiometric artifacts. The sky pixels are then aggregated in an environment map, which still suffers from discontinuities on stitching edges. The influence of the quality of estimated sky radiance on the simulated light signal is measured quantitatively on a simple synthetic urban scene; in our case, the maximal error for the total sensor radiance is about 10%.
Association between substorm onsets in auroral all-sky images and geomagnetic Pi2pulsations
Miura, T.; Ieda, A.; Teramoto, M.; Kawashima, T.
2017-12-01
Substorms are explosive disturbances in the magnetosphere and ionosphere of Earth. Substorm onsets are often identified usingsudden auroral brightenings (auroral breakup) or geomagnetic Pi2 pulsations. These auroral brightenings and Pi2 pulsations aresupposed to occur simultaneously within approximately 1 min of each other. However, as auroral brightenings typically includea two-stage development, this simultaneity is not straightforward. In this study, we clarify the correspondence between Pi2 pulsations and auroral brightenings, including the two-stage development.The first stage of the development is the sudden brightening of an auroral arc near the midnight (initial brightening)and the second stage is the poleward expansion of the auroral arc. We compared all-sky images (3 s resolution) in Canada andgeomagnetic observations (0.5-1 s resolution) in North and Central America, using data from the THEMIS project. In this study,we examined three substorms events that exhibit evidence of the two-stage auroral development. In the first event (4 March 2008), an auroral initial brightening occurred at 0533:57 UT and a poleward expansion was observedat 0538:12 UT (4 min after the initial brightening) in Gillam (magnetic latitude:66.0 °, longitude:333 °, MLT:22.9). In contract,the Pi2 pulsation started at 0539:30 UT, which is closer to the time of the poleward expansion, in Carson City (magnetic latitude:45.0 °, longitude:304 °). and San Juan (magnetic latitude:27.9 °, longitude:6.53 °). Thus, we consider this Pi2 pulsation ascorresponding to the poleward expansion rather than the initial brightening. This correspondence was also seen in the other twoevents, suggesting that it is not exceptional. We interpret that the Pi2 pulsation corresponds to the poleward expansion becauseboth are caused by the magnetic field dipolarization, which is a drastic change that propagates from low- to high-latitude fieldlines.
Exploring the extreme gamma-ray sky with HESS
International Nuclear Information System (INIS)
Sol, Helene
2006-01-01
The international HESS experiment. High Energy Stereoscopic System, fully operational since January 2004, is opening a new era for extreme gamma-ray astronomy. Located in Namibia, it is now the most sensitive detector for cosmic sources of very high energy (VHE) gamma-rays, in the tera-electron-volt (TeV) range. In July 2005, it had already more than double the number of sources detected at such energies, with the discovery of several active galactic nuclei (AGN), supernova remnants and plerions, a binary pulsar system, a microquasar candidate, and a sample of yet unidentified sources. HESS has also provide for the first time gamma-ray images of extended sources with the first astrophysical jet resolved in gamma-rays, and the first mapping of a shell supernova remnant, which proves the efficiency of in situ acceleration of particles up to 100 TeV and beyond
Lacy, Mark; VLASS Survey Team, VLASS Survey Science Group
2018-01-01
The VLA Sky Survey (VLASS), which began in September 2017, is a seven year project to image the entire sky north of Declination -40 degrees in three epochs. The survey is being carried out in I,Q and U polarization at a frequency of 2-4GHz, and a resolution of 2.5 arcseconds, with each epoch being separated by 32 months. Raw data from the survey, along with basic "quicklook" images are made freely available shortly after observation. Within a few months, NRAO will begin making available further basic data products, including refined images and source lists. In this talk I shall describe the science goals and methodology of the survey, the current survey status, and some early results, along with plans for collaborations with external groups to produce enhanced, high level data products.
Majewski, S. R.; Boles, M. S.; Patterson, R. J.
1999-12-01
We have created an exhibit, Under Southern Skies -- Aboriginal and Western Scientific Perspectives of the Australian Night Sky, which has shown since June, 1999 in newly refurbished exhibit space at the Leander McCormick Observatory. The University of Virginia has a long and continuing tradition of astrometry starting with early parallax work at the McCormick Observatory, extending to our own NSF CAREER Award-funded projects, and including a long-term, ongoing southern parallax program at Mt. Stromlo and Siding Springs Observatories in Australia. Recently, through a gift of Mr. John Kluge, the University of Virginia has obtained one of the most extensive collections of Australian Aboriginal art outside of Australia. The goal of our exhibit is to unite the University's scientific, artistic and cultural connections to Australia through an exhibit focusing on different perspectives of the Australian night sky. We have brought together Australian Aboriginal bark and canvas paintings that feature astronomical themes, e.g., Milky Way, Moon, Magellanic Cloud and Seven Sisters Dreamings, from the Kluge-Ruhe and private collections. These paintings, from the Central Desert and Arnhem Land regions of Australia, are intermingled with modern, large format, color astronomical images of the same scenes. Descriptive panels and a small gallery guide explain the cultural, artistic and scientific aspects of the various thematic groupings based on particular southern hemisphere night sky objects and associated Aboriginal traditions and stories. This unusual combination of art and science not only provides a unique avenue for educating the public about both astronomy and Australian Aboriginal culture, but highlights mankind's ancient and continuing connection to the night sky. We appreciate funding from NSF CAREER Award #AST-9702521, a Cottrell Scholar Award from The Research Corporation, and the Dept. of Astronomy and Ruhe-Kluge Collection at the University of Virginia.
Energy Technology Data Exchange (ETDEWEB)
Habte, Aron M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Roberts, Billy J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kutchenreiter, Mark C [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sengupta, Manajit [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Wilcox, Steve [Solar Resource Solutions, LLC, Lakewood, CO (United States); Stoffel, Tom [Solar Resource Solutions, LLC, Lakewood, CO (United States)
2017-07-21
The National Renewable Energy Laboratory (NREL) and collaborators have created a clear-sky probability analysis to help guide viewers of the August 21, 2017, total solar eclipse, the first continent-spanning eclipse in nearly 100 years in the United States. Using cloud and solar data from NREL's National Solar Radiation Database (NSRDB), the analysis provides cloudless sky probabilities specific to the date and time of the eclipse. Although this paper is not intended to be an eclipse weather forecast, the detailed maps can help guide eclipse enthusiasts to likely optimal viewing locations. Additionally, high-resolution data are presented for the centerline of the path of totality, representing the likelihood for cloudless skies and atmospheric clarity. The NSRDB provides industry, academia, and other stakeholders with high-resolution solar irradiance data to support feasibility analyses for photovoltaic and concentrating solar power generation projects.
The night sky brightness at McDonald Observatory
Kalinowski, J. K.; Roosen, R. G.; Brandt, J. C.
1975-01-01
Baseline observations of the night sky brightness in B and V are presented for McDonald Observatory. In agreement with earlier work by Elvey and Rudnick (1937) and Elvey (1943), significant night-to-night and same-night variations in sky brightness are found. Possible causes for these variations are discussed. The largest variation in sky brightness found during a single night is approximately a factor of two, a value which corresponds to a factor-of-four variation in airglow brightness. The data are used to comment on the accuracy of previously published surface photometry of M 81.
Energy Technology Data Exchange (ETDEWEB)
Shi, Yong [School of Astronomy and Space Science, Nanjing University, Nanjing 210093 (China); Rieke, G. H.; Su, K. Y. L. [Department of Astronomy And Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Ogle, P. M. [Infrared Processing and Analysis Center, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Balog, Z., E-mail: yshipku@gmail.com [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany)
2014-10-01
As a step toward a comprehensive overview of the infrared (IR) diagnostics of the central engines and host galaxies of quasars at low redshift, we present Spitzer Space Telescope spectroscopic (5-40 μm) and photometric (24, 70, and 160 μm) measurements of all Palomar-Green (PG) quasars at z < 0.5 and Two Micron All Sky Survey (2MASS) quasars at z < 0.3. We supplement these data with Herschel measurements at 160 μm. The sample is composed of 87 optically selected PG quasars and 52 near-IR-selected 2MASS quasars. Here we present the data, measure the prominent spectral features, and separate emission due to star formation from that emitted by the dusty circumnuclear torus. We find that the mid-IR (5-30 μm) spectral shape for the torus is largely independent of quasar IR luminosity with scatter in the spectral energy distribution (SED) shape of ≲0.2 dex. Except for the silicate features, no large difference is observed between PG (unobscured—silicate emission) and 2MASS (obscured—silicate absorption) quasars. Only mild silicate features are observed in both cases. When in emission, the peak wavelength of the silicate feature tends to be longer than 9.7 μm, possibly indicating effects on grain properties near the active galactic nucleus. The IR color is shown to correlate with the equivalent width of the aromatic features, indicating that the slope of the quasar mid- to far-IR SED is to first order driven by the fraction of radiation from star formation in the IR bands.
Mining the SDSS SkyServer SQL queries log
Hirota, Vitor M.; Santos, Rafael; Raddick, Jordan; Thakar, Ani
2016-05-01
SkyServer, the Internet portal for the Sloan Digital Sky Survey (SDSS) astronomic catalog, provides a set of tools that allows data access for astronomers and scientific education. One of SkyServer data access interfaces allows users to enter ad-hoc SQL statements to query the catalog. SkyServer also presents some template queries that can be used as basis for more complex queries. This interface has logged over 330 million queries submitted since 2001. It is expected that analysis of this data can be used to investigate usage patterns, identify potential new classes of queries, find similar queries, etc. and to shed some light on how users interact with the Sloan Digital Sky Survey data and how scientists have adopted the new paradigm of e-Science, which could in turn lead to enhancements on the user interfaces and experience in general. In this paper we review some approaches to SQL query mining, apply the traditional techniques used in the literature and present lessons learned, namely, that the general text mining approach for feature extraction and clustering does not seem to be adequate for this type of data, and, most importantly, we find that this type of analysis can result in very different queries being clustered together.
The BlueSky Smoke Modeling Framework: Recent Developments
Sullivan, D. C.; Larkin, N.; Raffuse, S. M.; Strand, T.; ONeill, S. M.; Leung, F. T.; Qu, J. J.; Hao, X.
2012-12-01
BlueSky systems—a set of decision support tools including SmartFire and the BlueSky Framework—aid public policy decision makers and scientific researchers in evaluating the air quality impacts of fires. Smoke and fire managers use BlueSky systems in decisions about prescribed burns and wildland firefighting. Air quality agencies use BlueSky systems to support decisions related to air quality regulations. We will discuss a range of recent improvements to the BlueSky systems, as well as examples of applications and future plans. BlueSky systems have the flexibility to accept basic fire information from virtually any source and can reconcile multiple information sources so that duplication of fire records is eliminated. BlueSky systems currently apply information from (1) the National Oceanic and Atmospheric Administration's (NOAA) Hazard Mapping System (HMS), which represents remotely sensed data from the Moderate Resolution Imaging Spectroradiometer (MODIS), Advanced Very High Resolution Radiometer (AVHRR), and Geostationary Operational Environmental Satellites (GOES); (2) the Monitoring Trends in Burn Severity (MTBS) interagency project, which derives fire perimeters from Landsat 30-meter burn scars; (3) the Geospatial Multi-Agency Coordination Group (GeoMAC), which produces helicopter-flown burn perimeters; and (4) ground-based fire reports, such as the ICS-209 reports managed by the National Wildfire Coordinating Group. Efforts are currently underway to streamline the use of additional ground-based systems, such as states' prescribed burn databases. BlueSky systems were recently modified to address known uncertainties in smoke modeling associated with (1) estimates of biomass consumption derived from sparse fuel moisture data, and (2) models of plume injection heights. Additional sources of remotely sensed data are being applied to address these issues as follows: - The National Aeronautics and Space Administration's (NASA) Tropical Rainfall Measuring Mission
Short timescale variability in the faint sky variability survey
Morales-Rueda, L.; Groot, P.J.; Augusteijn, T.; Nelemans, G.A.; Vreeswijk, P.M.; Besselaar, E.J.M. van den
2006-01-01
We present the V-band variability analysis of the Faint Sky Variability Survey (FSVS). The FSVS combines colour and time variability information, from timescales of 24 minutes to tens of days, down to V = 24. We find that �1% of all point sources are variable along the main sequence reaching �3.5%
Citizen Sky, IYA 2009 and What's To Come
Turner, Rebecca; Price, A.; Henden, A.
2010-01-01
Citizen Sky is a multi-year, NSF funded citizen science project involving the bright and mysterious variable star eps Aur. The project was conceived by the IYA 2009 working group on Research Experiences for Students, Teachers, and Citizen-Scientists. Citizen Sky is going beyond simple observing to include a major data analysis component. The goal is to introduce the participant to the full scientific process from background research to paper writing for a peer-reviewed journal. During IYA 2009 the Citizen Sky team was fully assembled, the website was developed and put online, and the first of two participant workshops was held. However, Citizen Sky does not stop or even slow down with the conclusion of IYA 2009. The project will continue to grow in the coming years. New participants are being recruited and trained as the observing phase of the project continues, a second participant workshop is planned for 2010, and the data analysis phase of the project will begin in earnest.
International Nuclear Information System (INIS)
Riechelmann, Stefan; Schrempf, Michael; Seckmeyer, Gunther
2013-01-01
We present a novel non-scanning multidirectional spectroradiometer (MUDIS) measuring the spectral sky radiance as a function of zenith and azimuth angle with a high spectral and temporal resolution. The instrument is based on a hyperspectral imager and measures spectral sky radiance in the wavelength range of 250–600 nm at 113 different directions simultaneously. MUDIS has been intercalibrated with a sky scanning CCD spectroradiometer (SCCD). Sky radiance measurements have been performed with both instruments under cloudless and overcast sky. The spectral actinic irradiance derived from those measurements agrees within 8% for wavelengths higher than 320 nm. The bias between synchronous MUDIS and SCCD sky radiance measurements during cloudless and overcast sky is below 5% for 320 and 500 nm with a 1σ standard deviation of less than 10%. MUDIS enables us to perform more than 220 000 spectral sky radiance measurements instead of approximately 6000 SCCD spectral sky radiance measurements per day and to measure spatial variations of spectral sky radiance simultaneously. (paper)
Automated exploitation of sky polarization imagery.
Sadjadi, Firooz A; Chun, Cornell S L
2018-03-10
We propose an automated method for detecting neutral points in the sunlit sky. Until now, detecting these singularities has been done manually. Results are presented that document the application of this method on a limited number of polarimetric images of the sky captured with a camera and rotating polarizer. The results are significant because a method for automatically detecting the neutral points may aid in the determination of the solar position when the sun is obscured and may have applications in meteorology and pollution detection and characterization.
Stellar activity for every TESS star in the Southern sky
Howard, Ward S.; Law, Nicholas; Fors, Octavi; Corbett, Henry T.; Ratzloff, Jeff; del Ser, Daniel
2018-01-01
Although TESS will search for Earths around more than 200,000 nearby stars, the life-impacting superflare occurrence of these stars remains poorly characterized. We monitor long-term stellar flare occurrence for every TESS star in the accessible sky at 2-minute cadence with the CTIO-based Evryscope, a combination of twenty-four telescopes, together giving instantaneous sky coverage of 8000 square degrees. In collaboration with Owens Valley Long Wavelength Array (LWA) all-sky monitoring, Evryscope also provides optical counterparts to radio flare, CME, and exoplanet-magnetosphere stellar activity searches. A Northern Evryscope will be installed at Mount Laguna Observatory, CA in collaboration with SDSU later this year, enabling stellar activity characterization for the full TESS target list and both continuous viewing zones, as well as providing 100% overlap with LWA radio activity. Targets of interest (e.g. Proxima Cen, TRAPPIST-1) are given special focus. We are currently sensitive to stellar activity down to 1% precision at g' ~ 10 and about 0.2 of a magnitude at g' ~ 15. With 2-minute cadence and a projected 5-year timeline, with 2+ years already recorded, we present preliminary results from an activity characterization of every Southern TESS target.
Imaging the Southern Sky An Amateur Astronomer's Guide
Chadwick, Stephen
2012-01-01
"If you're looking for a handy reference guide to help you image and explore the many splendors of the southern sky, Imaging the Southern Sky is the book for you. The work features not only stunning color images, all taken by Stephen Chadwick, of the best galaxies, nebulae, and clusters available to astrophotographers, but also lesser-known objects, some of which have gone largely unexplored! Beginners and experienced observers alike should appreciate the book's remarkable imagery and simple text, which provides concise and accurate information on each object and its epoch 2000.0 position, and also expert testimony on its visual nature. Each object essay also includes a section on technical information that should help astrophotographers in their planning, including telescope aperture, focal length and ratio, camera used, exposure times, and field size. As a charming bonus, the authors have taken the liberty to name many of the lesser-known objects to reflect their New Zealand heritage. Constellation by con...
SNAP sky background at the north ecliptic pole
International Nuclear Information System (INIS)
Aldering, Greg
2002-01-01
I summarize the extant direct and indirect data on the sky background SNAP will see at the North Ecliptic Pole over the wavelength range 0.4 < λ < 1.7 (micro)m. At the spatial resolution of SNAP the sky background due to stars and galaxies is resolved, so the only source considered is zodiacal light. Several models are explored to provide interpolation in wavelength between the broadband data from HST and COBE observations. I believe the input data are now established well enough that the accuracy of the sky background presented here is sufficient for SNAP simulations, and that it will stand up to scrutiny by reviewers
Urban, Otmar; Klem, Karel; Holišová, Petra; Šigut, Ladislav; Šprtová, Mirka; Teslová-Navrátilová, Petra; Zitová, Martina; Špunda, Vladimír; Marek, Michal V; Grace, John
2014-02-01
It has been suggested that atmospheric CO2 concentration and frequency of cloud cover will increase in future. It remains unclear, however, how elevated CO2 influences photosynthesis under complex clear versus cloudy sky conditions. Accordingly, diurnal changes in photosynthetic responses among beech trees grown at ambient (AC) and doubled (EC) CO2 concentrations were studied under contrasting sky conditions. EC stimulated the daily sum of fixed CO2 and light use efficiency under clear sky. Meanwhile, both these parameters were reduced under cloudy sky as compared with AC treatment. Reduction in photosynthesis rate under cloudy sky was particularly associated with EC-stimulated, xanthophyll-dependent thermal dissipation of absorbed light energy. Under clear sky, a pronounced afternoon depression of CO2 assimilation rate was found in sun-adapted leaves under EC compared with AC conditions. This was caused in particular by stomata closure mediated by vapour pressure deficit. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.
Erpylev, N. P.; Smirnov, M. A.; Bagrov, A. V.
A night sky model is proposed. It includes different components of light polution, such as solar twilight, moon scattered light, zodiacal light, Milky Way, air glow and artificial light pollution. The model is designed for calculating the efficiency of astronomical installations.
"Dark Skies, Bright Kids" -- Astronomy Education and Outreach in Rural Virginia
Zasowski, Gail; Johnson, K.; Beaton, R.; Carlberg, J.; Czekala, I.; de Messieres, G.; Drosback, M.; Filipetti, C.; Gugliucci, N.; Hoeft, A.; Jackson, L.; Lynch, R.; Romero, C.; Sivakoff, G.; Whelan, D.; Wong, A.
2010-01-01
In the hills of central Virginia, the extraordinarily dark nighttime skies of southern Albemarle County provide a natural outdoor classroom for local science education. Until recently, this rural area lacked the financial and educational support to take full advantage of this rare and valuable natural resource. With funds provided by the NSF, a team of volunteers from the University of Virginia introduced a new program this fall called "Dark Skies - Bright Kids," which promotes science education at the elementary school level through a wide range of activities. The program volunteers (comprising undergraduate and graduate students, postdocs, and faculty) have sought to develop a coherent schedule of fun and educational activities throughout the semester, with emphases on hands-on learning and critical thinking. For example, students learn about the constellations by making star-wheels, about rocketry by building and launching rockets, and about comets by assembling miniature analogs. Additional activities include stories about the scientific and cultural history of astronomy, visits by professional astronomers and popular book authors, and astronomy-themed exercises in art, music, and physical education. These projects are designed to make astronomy, and by extension all science, accessible and appealing to each student. Family involvement is important in any educational environment, particularly at the elementary school level. To include the students' families and the larger community in "Dark Skies," we hold weekly telescope observing sessions at the school. Here, all interested parties can come together to hear what the students are learning and view astronomical objects through a small telescope. We hope that this well-received program will soon expand to other disadvantaged schools in the area. The "Dark Skies" team is proud and excited to have an impact on the scientific literacy of the students in these starry-skied communities!
Directory of Open Access Journals (Sweden)
López-Coto Rubén
2016-01-01
Full Text Available The present generation of Imaging Air Cherenkov Telescopes (IACTs has greatly improved our knowledge on the Very High Energy (VHE side of our Universe. The MAGIC IACTs operate since 2004 with one telescope and since 2009 as a two telescope stereoscopic system. I will outline a few of our latest and most relevant results: the discovery of pulsed emission from the Crab pulsar at VHE, recently found to extend up to 400 GeV and along the “bridge” of the light curve, the measurement of the Crab nebula spectrum over three decades of energy, the discovery of VHE γ-ray emission from the PWN 3C 58, the very rapid emission of IC 310, in addition to dark matter studies. The results that will be described here and the planned deep observations in the next years will pave the path for the future generation of IACTs.
Putting Together a Blue Sky: Laying the Foundation for Staff Evaluation
Searcy, Jeny
2012-01-01
Evaluation time can be like putting together a 5,000-piece jigsaw puzzle that is all sky--what, exactly, is the point? When all is said and done, one ends up with a big blue blob--nothing to show for all the effort. However, it doesn't have to be that way. Performance reviews can and should be an effective means of communication for both parties…
Flying Drosophila orient to sky polarization.
Weir, Peter T; Dickinson, Michael H
2012-01-10
Insects maintain a constant bearing across a wide range of spatial scales. Monarch butterflies and locusts traverse continents [1, 2], and foraging bees and ants travel hundreds of meters to return to their nests [1, 3, 4], whereas many other insects fly straight for only a few centimeters before changing direction. Despite this variation in spatial scale, the brain region thought to underlie long-distance navigation is remarkably conserved [5, 6], suggesting that the use of a celestial compass is a general and perhaps ancient capability of insects. Laboratory studies of Drosophila have identified a local search mode in which short, straight segments are interspersed with rapid turns [7, 8]. However, this flight mode is inconsistent with measured gene flow between geographically separated populations [9-11], and individual Drosophila can travel 10 km across desert terrain in a single night [9, 12, 13]-a feat that would be impossible without prolonged periods of straight flight. To directly examine orientation behavior under outdoor conditions, we built a portable flight arena in which a fly viewed the natural sky through a liquid crystal device that could experimentally rotate the polarization angle. Our findings indicate that Drosophila actively orient using the sky's natural polarization pattern. Copyright © 2012 Elsevier Ltd. All rights reserved.
Research on Extraction of Ship Target in Complex Sea-sky Background
International Nuclear Information System (INIS)
Kang, W J; Ding, X M; Cui, J W; Ao, L
2006-01-01
Research on the extraction of ship target in complex sea-sky background has important value to improve the capability of imaging-typed sea navigation and nautical traffic control systems. According to the imaging property of complex sea-sky background, a reliable ship target extraction method is proposed in this paper. The general guide line is that getting the sea-sky division line as a priori knowledge and then the target potential area is determined through discontinuous region of the sea-sky division line. Firstly, a local selective window filter is adopted to filter the image; secondly, eight directions Sobel operator edge detection method and gradient Hough transform are combined to extract sea-sky division line in the image; then a multi-histogram matching technique is adopted to remove the sea and sky background and thus ship target is extracted from complex background. The experiments show that our method has the merits of robustness to noise, small computational complexity and stability
Cao, Bing; Liu, Alan Z.
2016-01-01
The intermittency of gravity wave momentum flux (MF) near the OH airglow layer (˜87 km) in the mesopause region is investigated for the first time using observation of all-sky airglow imager over Maui, Hawaii (20.7°N, 156.3°W), and Cerro Pachón, Chile (30.3°S, 70.7°W). At both sites, the probability density function (pdf) of gravity wave MF shows two distinct distributions depending on the magnitude of the MF. For MF smaller (larger) than ˜16 m2 s-2 (0.091 mPa), the pdf follows a lognormal (power law) distribution. The intermittency represented by the Bernoulli proxy and the percentile ratio shows that gravity waves have higher intermittency at Maui than at Cerro Pachón, suggesting more intermittent background variation above Maui. It is found that most of the MF is contributed by waves that occur very infrequently. But waves that individually contribute little MF are also important because of their higher occurrence frequencies. The peak contribution is from waves with MF around ˜2.2 m2 s-2 at Cerro Pachón and ˜5.5 m2 s-2 at Maui. Seasonal variations of the pdf and intermittency imply that the background atmosphere has larger influence on the observed intermittency in the mesopause region.
Super-sample covariance approximations and partial sky coverage
Lacasa, Fabien; Lima, Marcos; Aguena, Michel
2018-04-01
Super-sample covariance (SSC) is the dominant source of statistical error on large scale structure (LSS) observables for both current and future galaxy surveys. In this work, we concentrate on the SSC of cluster counts, also known as sample variance, which is particularly useful for the self-calibration of the cluster observable-mass relation; our approach can similarly be applied to other observables, such as galaxy clustering and lensing shear. We first examined the accuracy of two analytical approximations proposed in the literature for the flat sky limit, finding that they are accurate at the 15% and 30-35% level, respectively, for covariances of counts in the same redshift bin. We then developed a harmonic expansion formalism that allows for the prediction of SSC in an arbitrary survey mask geometry, such as large sky areas of current and future surveys. We show analytically and numerically that this formalism recovers the full sky and flat sky limits present in the literature. We then present an efficient numerical implementation of the formalism, which allows fast and easy runs of covariance predictions when the survey mask is modified. We applied our method to a mask that is broadly similar to the Dark Energy Survey footprint, finding a non-negligible negative cross-z covariance, i.e. redshift bins are anti-correlated. We also examined the case of data removal from holes due to, for example bright stars, quality cuts, or systematic removals, and find that this does not have noticeable effects on the structure of the SSC matrix, only rescaling its amplitude by the effective survey area. These advances enable analytical covariances of LSS observables to be computed for current and future galaxy surveys, which cover large areas of the sky where the flat sky approximation fails.
eGSM: A extended Sky Model of Diffuse Radio Emission
Kim, Doyeon; Liu, Adrian; Switzer, Eric
2018-01-01
Both cosmic microwave background and 21cm cosmology observations must contend with astrophysical foreground contaminants in the form of diffuse radio emission. For precise cosmological measurements, these foregrounds must be accurately modeled over the entire sky Ideally, such full-sky models ought to be primarily motivated by observations. Yet in practice, these observations are limited, with data sets that are observed not only in a heterogenous fashion, but also over limited frequency ranges. Previously, the Global Sky Model (GSM) took some steps towards solving the problem of incomplete observational data by interpolating over multi-frequency maps using principal component analysis (PCA).In this poster, we present an extended version of GSM (called eGSM) that includes the following improvements: 1) better zero-level calibration 2) incorporation of non-uniform survey resolutions and sky coverage 3) the ability to quantify uncertainties in sky models 4) the ability to optimally select spectral models using Bayesian Evidence techniques.
Open Skies and monitoring a fissile materials cut-off treaty
International Nuclear Information System (INIS)
Allentuck, J.; Lemley, J.R.
1995-01-01
The Treaty on Open Skies (Open Skies) is intended among other things to provide, in the words of its preamble, means ''to facilitate the monitoring of compliance with existing or future arms control agreements.'' Open Skies permits overflights of the territory of member states by aircraft equipped with an array of sensors of various types. Their types and capabilities are treaty-limited. To find useful application in monitoring a cut-off treaty Open Skies would need to be amended. The number of signatories would need to be expanded so as to provide greater geographical coverage, and restrictions on sensor-array capabilities would need to be relaxed. To facilitate the detection of impending violations of a cut-off convention by Open Skies overflights, the data base provided by parties to the former should include among other things an enumeration of existing and former fuel cycle and research facilities including those converted to other uses, their precise geographic location, and a site plan
Measuring and mapping the night sky brightness of Perth, Western Australia
Biggs, James D.; Fouché, Tiffany; Bilki, Frank; Zadnik, Marjan G.
2012-04-01
In order to study the light pollution produced in the city of Perth, Western Australia, we have used a hand-held sky brightness meter to measure the night sky brightness across the city. The data acquired facilitated the creation of a contour map of night sky brightness across the 2400 km2 area of the city - the first such map to be produced for a city. Importantly, this map was created using a methodology borrowed from the field of geophysics - the well proven and rigorous techniques of geostatistical analysis and modelling. A major finding of this study is the effect of land use on night sky brightness. By overlaying the night sky brightness map on to a suitably processed Landsat satellite image of Perth we found that locations near commercial and/or light industrial areas have a brighter night sky, whereas locations used for agriculture or having high vegetation coverage have a fainter night sky than surrounding areas. Urban areas have intermediate amounts of vegetation and are intermediate in brightness compared with the above-mentioned land uses. Regions with a higher density of major highways also appear to contribute to increased night sky brightness. When corrected for the effects of direct illumination from high buildings, we found that the night sky brightness in the central business district (CBD) is very close to that expected for a city of Perth's population from modelling work and observations obtained in earlier studies. Given that our night sky brightness measurements in Perth over 2009 and 2010 are commensurate with that measured in Canadian cities over 30 years earlier implies that the various lighting systems employed in Perth (and probably most other cities) have not been optimised to minimize light pollution over that time. We also found that night sky brightness diminished with distance with an exponent of approximately -0.25 ± 0.02 from 3.5 to 10 km from the Perth CBD, a region characterized by urban and commercial land use. For distances
A new simple parameterization of daily clear-sky global solar radiation including horizon effects
International Nuclear Information System (INIS)
Lopez, Gabriel; Javier Batlles, F.; Tovar-Pescador, Joaquin
2007-01-01
Estimation of clear-sky global solar radiation is usually an important previous stage for calculating global solar radiation under all sky conditions. This is, for instance, a common procedure to derive incoming solar radiation from remote sensing or by using digital elevation models. In this work, we present a new model to calculate daily values of clear-sky global solar irradiation. The main goal is the simple parameterization in terms of atmospheric temperature and relative humidity, Angstroem's turbidity coefficient, ground albedo and site elevation, including a factor to take into account horizon obstructions. This allows us to obtain estimates even though a free horizon is not present as is the case of mountainous locations. Comparisons of calculated daily values with measured data show that this model is able to provide a good level of accurate estimates using either daily or mean monthly values of the input parameters. This new model has also been shown to improve daily estimates against those obtained using the clear-sky model from the European Solar Radiation Atlas and other accurate parameterized daily irradiation models. The introduction of Angstroem's turbidity coefficient and ground albedo should allow us to use the increasing worldwide aerosol information available and to consider those sites affected by snow covers in an easy and fast way. In addition, the proposed model is intended to be a useful tool to select clear-sky conditions
Tansella, Vittorio; Bonvin, Camille; Durrer, Ruth; Ghosh, Basundhara; Sellentin, Elena
2018-03-01
We derive an exact expression for the correlation function in redshift shells including all the relativistic contributions. This expression, which does not rely on the distant-observer or flat-sky approximation, is valid at all scales and includes both local relativistic corrections and integrated contributions, like gravitational lensing. We present two methods to calculate this correlation function, one which makes use of the angular power spectrum Cl(z1,z2) and a second method which evades the costly calculations of the angular power spectra. The correlation function is then used to define the power spectrum as its Fourier transform. In this work theoretical aspects of this procedure are presented, together with quantitative examples. In particular, we show that gravitational lensing modifies the multipoles of the correlation function and of the power spectrum by a few percent at redshift z=1 and by up to 30% and more at z=2. We also point out that large-scale relativistic effects and wide-angle corrections generate contributions of the same order of magnitude and have consequently to be treated in conjunction. These corrections are particularly important at small redshift, z=0.1, where they can reach 10%. This means in particular that a flat-sky treatment of relativistic effects, using for example the power spectrum, is not consistent.
Development of software for estimating clear sky solar radiation in Indonesia
Ambarita, H.
2017-01-01
Research on solar energy applications in Indonesia has come under scrutiny in recent years. Solar radiation is harvested by solar collector or solar cell and convert the energy into useful energy such as heat and or electricity. In order to provide a better configuration of a solar collector or a solar cell, clear sky radiation should be estimated properly. In this study, an in-house software for estimating clear sky radiation is developed. The governing equations are solved simultaneously. The software is tested in Medan city by performing a solar radiation measurements. For clear sky radiation, the results of the software and measurements ones show a good agreement. However, for the cloudy sky condition it cannot predict the solar radiation. This software can be used to estimate the clear sky radiation in Indonesia.
THE GREAT OBSERVATORIES ALL-SKY LIRG SURVEY: COMPARISON OF ULTRAVIOLET AND FAR-INFRARED PROPERTIES
International Nuclear Information System (INIS)
Howell, Justin H.; Armus, Lee; Surace, Jason A.; Petric, Andreea; Bridge, Carrie; Haan, Sebastian; Inami, Hanae; Mazzarella, Joseph M.; Chan, Ben H. P.; Madore, Barry F.; Evans, Aaron S.; Kim, Dong-Chan; Sanders, David B.; Appleton, Phil; Frayer, David T.; Lord, Steven; Schulz, Bernhard; Bothun, Greg; Charmandaris, Vassilis; Melbourne, Jason
2010-01-01
The Great Observatories All-sky LIRG Survey (GOALS) consists of a complete sample of 202 luminous infrared galaxies (LIRGs) selected from the IRAS Revised Bright Galaxy Sample (RBGS). The galaxies span the full range of interaction stages, from isolated galaxies to interacting pairs to late stage mergers. We present a comparison of the UV and infrared properties of 135 galaxies in GOALS observed by GALEX and Spitzer. For interacting galaxies with separations greater than the resolution of GALEX and Spitzer (∼2''-6''), we assess the UV and IR properties of each galaxy individually. The contribution of the FUV to the measured star formation rate (SFR) ranges from 0.2% to 17.9%, with a median of 2.8% and a mean of 4.0% ± 0.4%. The specific star formation rate (SSFR) of the GOALS sample is extremely high, with a median value (3.9 x 10 -10 yr -1 ) that is comparable to the highest SSFRs seen in the Spitzer Infrared Nearby Galaxies Survey sample. We examine the position of each galaxy on the IR excess-UV slope (IRX-β) diagram as a function of galaxy properties, including IR luminosity and interaction stage. The LIRGs on average have greater IR excesses than would be expected based on their UV colors if they obeyed the same relations as starbursts with L IR 11 L sun or normal late-type galaxies. The ratio of L IR to the value one would estimate from the IRX-β relation published for lower luminosity starburst galaxies ranges from 0.2 to 68, with a median value of 2.7. A minimum of 19% of the total IR luminosity in the RBGS is produced in LIRGs and ultraluminous infrared galaxies with red UV colors (β>0). Among resolved interacting systems, 32% contain one galaxy which dominates the IR emission while the companion dominates the UV emission. Only 21% of the resolved systems contain a single galaxy which dominates both wavelengths.
Circles-in-the-sky searches and observable cosmic topology in a flat universe
International Nuclear Information System (INIS)
Mota, B.; Reboucas, M. J.; Tavakol, R.
2010-01-01
In a universe with a detectable nontrivial spatial topology, the last scattering surface contains pairs of matching circles with the same distribution of temperature fluctuations--the so-called circles-in-the-sky. Searches for nearly antipodal circles-in-the-sky in maps of cosmic microwave background radiation have so far been unsuccessful. This negative outcome, along with recent theoretical results concerning the detectability of nearly flat compact topologies, is sufficient to exclude a detectable nontrivial topology for most observers in very nearly flat positively and negatively curved universes, whose total matter-energy density satisfies 0 tot -1| -5 . Here, we investigate the consequences of these searches for observable nontrivial topologies if the Universe turns out to be exactly flat (Ω tot =1). We demonstrate that in this case, the conclusions deduced from such searches can be radically different. We show that, although there is no characteristic topological scale in the flat manifolds, for all multiply-connected orientable flat manifolds, it is possible to directly study the action of the holonomies in order to obtain a general upper bound on the angle that characterizes the deviation from antipodicity of pairs of matching circles associated with the shortest closed geodesic. This bound is valid for all observers and all possible values of the compactification length parameters. We also show that in a flat universe, there are observers for whom the circles-in-the-sky searches already undertaken are insufficient to exclude the possibility of a detectable nontrivial spatial topology. It is remarkable how such small variations in the spatial curvature of the Universe, which are effectively indistinguishable geometrically, can have such a drastic effect on the detectability of cosmic topology. Another important outcome of our results is that they offer a framework with which to make statistical inferences from future circles-in-the-sky searches on whether
Clear sky solar insolation data for Islamabad
International Nuclear Information System (INIS)
Akhter, P.; Baig, A.; Mufti, A.
1990-09-01
Monthly average values of both integrated and instantaneous clear sky solar radiation components for Islamabad territory have been presented and discussed. The components include total, direct normal, direct horizontal, global and diffuse radiations, sun hours, number of clear days and temperature for solar energy applications. Beam irradiance values are used to get clear sky (maximum) sun hours by ab-initio. The need for replacing the conventional sunshine recorder is discussed. (author). 8 refs, 1 fig, 2 tabs
Tropical rainforest response to marine sky brightening climate engineering
Muri, Helene; Niemeier, Ulrike; Kristjánsson, Jón Egill
2015-04-01
Tropical forests represent a major atmospheric carbon dioxide sink. Here the gross primary productivity (GPP) response of tropical rainforests to climate engineering via marine sky brightening under a future scenario is investigated in three Earth system models. The model response is diverse, and in two of the three models, the tropical GPP shows a decrease from the marine sky brightening climate engineering. Partial correlation analysis indicates precipitation to be important in one of those models, while precipitation and temperature are limiting factors in the other. One model experiences a reversal of its Amazon dieback under marine sky brightening. There, the strongest partial correlation of GPP is to temperature and incoming solar radiation at the surface. Carbon fertilization provides a higher future tropical rainforest GPP overall, both with and without climate engineering. Salt damage to plants and soils could be an important aspect of marine sky brightening.
Gruneisen, Mark T.; Sickmiller, Brett A.; Flanagan, Michael B.; Black, James P.; Stoltenberg, Kurt E.; Duchane, Alexander W.
2016-02-01
Spatial filtering is an important technique for reducing sky background noise in a satellite quantum key distribution downlink receiver. Atmospheric turbulence limits the extent to which spatial filtering can reduce sky noise without introducing signal losses. Using atmospheric propagation and compensation simulations, the potential benefit of adaptive optics (AO) to secure key generation (SKG) is quantified. Simulations are performed assuming optical propagation from a low-Earth-orbit satellite to a terrestrial receiver that includes AO. Higher-order AO correction is modeled assuming a Shack-Hartmann wavefront sensor and a continuous-face-sheet deformable mirror. The effects of atmospheric turbulence, tracking, and higher-order AO on the photon capture efficiency are simulated using statistical representations of turbulence and a time-domain wave-optics hardware emulator. SKG rates are calculated for a decoy-state protocol as a function of the receiver field of view for various strengths of turbulence, sky radiances, and pointing angles. The results show that at fields of view smaller than those discussed by others, AO technologies can enhance SKG rates in daylight and enable SKG where it would otherwise be prohibited as a consequence of background optical noise and signal loss due to propagation and turbulence effects.
Karkoschka, E
2007-01-01
This title includes a short introduction to observing, a thorough description of the star charts and tables, a glossary and much more. It is perfect for both the beginner and seasoned observer. It is fully revised edition of a best-selling and highly-praised sky atlas.
A compact, all solid-state LC high voltage generator.
Fan, Xuliang; Liu, Jinliang
2013-06-01
LC generator is widely applied in the field of high voltage generation technology. A compact and all solid-state LC high voltage generator based on saturable pulse transformer is proposed in this paper. First, working principle of the generator is presented. Theoretical analysis and circuit simulation are used to verify the design of the generator. Experimental studies of the proposed LC generator with two-stage main energy storage capacitors are carried out. And the results show that the proposed LC generator operates as expected. When the isolation inductance is 27 μH, the output voltage is 1.9 times larger than the charging voltage on single capacitor. The multiplication of voltages is achieved. On the condition that the primary energy storage capacitor is charged to 857 V, the output voltage of the generator can reach to 59.5 kV. The step-up ratio is nearly 69. When self breakdown gas gap switch is used as main switch, the rise time of the voltage pulse on load resistor is 8.7 ns. It means that the series-wound inductance in the discharging circuit is very small in this system. This generator can be employed in two different applications.
Lang, Kenneth R
2006-01-01
This Second Edition of Sun, Earth and Sky updates the popular text by providing comprehensive accounts of the most recent discoveries made by five modern solar spacecraft during the past decade. Their instruments have used sound waves to peer deep into the Sun’s inner regions and measure the temperature of its central nuclear reactor, and extended our gaze far from the visible Sun to record energetic outbursts that threaten Earth. Breakthrough observations with the underground Sudbury Neutrino Observatory are also included, which explain the new physics of ghostly neutrinos and solve the problematic mismatch between the predicted and observed amounts of solar neutrinos. This new edition of Sun, Earth and Sky also describes our recent understanding of how the Sun’s outer atmosphere is heated to a million degrees, and just where the Sun’s continuous winds come from. As humans we are more intimately linked with our life-sustaining Sun than with any other astronomical object, and the new edition therefore p...
A Model of Triadic Post-Tonality for a Neoconservative Postmodern String Quartet by Sky Macklay
Directory of Open Access Journals (Sweden)
Zane Gillespie
2017-09-01
Full Text Available This article proposes a non-plural perspective on the analysis of triadic music, offering Sky Macklay’s Many Many Cadences as a case study. Part one is a discussion of the work’s harmony-voice leading nexus, followed by a discussion of the five conditions of correspondence as implied by this string quartet that articulate a single tonal identity. Part three focuses on a strictly kinematic analysis of the work’s harmonic progressions that evinces this identity and establishes its general applicability. In the final section, the data generated by this analysis conveys the inherent possibility of a single, all-encompassing kinematic, thereby pointing beyond the particularities of Many Many Cadences while informing my formal interpretation of the work.
THE 2010 VERY HIGH ENERGY {gamma}-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, 24 Marshall Baghramian Avenue, 0019 Yerevan (Armenia); Anton, G.; Balzer, A. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: martin.raue@desy.de [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; MAGIC Collaboration; VERITAS Collaboration; and others
2012-02-20
The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) Multiplication-Sign 10{sup 9} M{sub Sun }) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) {gamma}-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE {gamma}-ray emitter since 2006. The VHE {gamma}-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE {gamma}-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of {tau}{sup rise}{sub d} = (1.69 {+-} 0.30) days and {tau}{sup decay}{sub d} = (0.611 {+-} 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales ({approx}day), peak fluxes ({Phi}{sub >0.35TeV} {approx_equal} (1-3) Multiplication-Sign 10{sup -11} photons cm{sup -2} s{sup -1}), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken {approx}3 days after the peak of the VHE {gamma}-ray emission reveal an enhanced flux from the core (flux increased by factor {approx}2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL
Ramirez, Daniel Perez; Lyamani, H.; Olmo, F. J.; Whiteman, D. N.; Navas-Guzman, F.; Alados-Arboledas, L.
2012-01-01
This paper presents the development and set up of a cloud screening and data quality control algorithm for a star photometer based on CCD camera as detector. These algorithms are necessary for passive remote sensing techniques to retrieve the columnar aerosol optical depth, delta Ae(lambda), and precipitable water vapor content, W, at nighttime. This cloud screening procedure consists of calculating moving averages of delta Ae() and W under different time-windows combined with a procedure for detecting outliers. Additionally, to avoid undesirable Ae(lambda) and W fluctuations caused by the atmospheric turbulence, the data are averaged on 30 min. The algorithm is applied to the star photometer deployed in the city of Granada (37.16 N, 3.60 W, 680 ma.s.l.; South-East of Spain) for the measurements acquired between March 2007 and September 2009. The algorithm is evaluated with correlative measurements registered by a lidar system and also with all-sky images obtained at the sunset and sunrise of the previous and following days. Promising results are obtained detecting cloud-affected data. Additionally, the cloud screening algorithm has been evaluated under different aerosol conditions including Saharan dust intrusion, biomass burning and pollution events.
NIGHT SKY BRIGHTNESS ABOVE ZAGREB 2012.-2017.
Directory of Open Access Journals (Sweden)
Željko Andreić
2018-01-01
Full Text Available The night sky brightness at the RGN site (near the centre of Zagreb, Croatia was monitored form January 2012. to December 2017. The gathered data show that the average night sky brightness in this period did not change significantly, apart from differences caused by yearly variations in meteorological parameters. The nightly minima, maxima and mean values of the sky brightness do change considerably due to changes in meteorological conditions, often being between 2 and 3 magnitudes. The seasonal probability curves and histograms are constructed and are used to obtain additional information on the light pollution at the RGN site. They reveal that the night sky brightness clutters around two peaks, at about 15.0 mag/arcsec2 and at about 18.2 mag/arcsec2. The tendency to slightly lower brightness values in spring and summer can also be seen in the data. Two peaks correspond to cloudy and clear nights respectively, the difference in brightness between them being about 3 magnitudes. A crude clear/cloudy criterion can be defined too: the minimum between two peaks is around 16.7 mag/arcsec2. The brightness values smaller than thisare attributed to clear nights and vice-versa. Comparison with Vienna and Hong-Kong indicates that the light pollution of Zagreb is a few times larger.
Wendy Moore; Wallace M. Meyer; Jeffrey A. Eble; Kimberly Franklin; John F. Wiens; Richard C. Brusca
2013-01-01
The Arizona Sky Island Arthropod Project (ASAP) is a new multi-disciplinary research program at the University of Arizona that combines systematics, biogeography, ecology, and population genetics to study origins and patterns of arthropod diversity along elevation gradients and among mountain ranges in the Madrean Sky Island Region. Arthropods represent taxonomically...
Sky shine of proton synchrotron
International Nuclear Information System (INIS)
Katoh, Kazuaki; Hirayama, Hideo
1978-01-01
This report represents present status of the study on sky shine and the results made at KEK. At present, data at various facilities can be analyzed by the formula presented by R.H. Thomas. Measurement of sky shine at KEK has been carried out since August, 1977. The neutron level around the accelerator, spatial distribution, energy spectra and the intensities at far distant places were measured. The radiation level at the surface of shield of the accelerator is less than 0.8 mrem/h. Therefore, high sensitive detectors are required to measure the neutron at the far distant places. A 2 inch diameter BF 3 detector with polyethylene moderator and a 5.8 inch diameter BF 3 detector with same moderator were used for the measurement. Conversion from the obtained counting rate to the dose rate was made by using the conversion coefficient for fission neutrons of Cf-252. The dose rate distributions at the shielding surface of the main ring of the accelerator and the counter experiment hall were measured. At the main ring, the dose rate was less than 0.16 mrem/h, and at the counter hall the maximum dose rate was 5 mrem/h. The distance dependence of the sky shine level was measured, and the effective attenuation distance was 1300 m. The result can be expressed by the formula by Thomas. (Kato, T.)
Zhang, Wenjing; Cao, Yu; Zhang, Xuanzhe; Liu, Zejin
2015-10-20
Stable information of a sky light polarization pattern can be used for navigation with various advantages such as better performance of anti-interference, no "error cumulative effect," and so on. But the existing method of sky light polarization measurement is weak in real-time performance or with a complex system. Inspired by the navigational capability of a Cataglyphis with its compound eyes, we introduce a new approach to acquire the all-sky image under different polarization directions with one camera and without a rotating polarizer, so as to detect the polarization pattern across the full sky in a single snapshot. Our system is based on a handheld light field camera with a wide-angle lens and a triplet linear polarizer placed over its aperture stop. Experimental results agree with the theoretical predictions. Not only real-time detection but simple and costless architecture demonstrates the superiority of the approach proposed in this paper.
Enhanced solar global irradiance during cloudy sky conditions
Energy Technology Data Exchange (ETDEWEB)
Schade, N.H.; Sandmann, H.; Stick, C. [Kiel Univ. (Germany). Inst. fuer Medizinische Klimatologie; Macke, A. [Kiel Univ. (DE). Leibniz Inst. fuer Meereswissenschaften (IFM-GEOMAR)
2007-06-15
The impact of cloudiness on the shortwave downwelling radiation (SDR) at the surface is investigated by means of collocated pyranometer radiation measurements and all-sky imager observations. The measurements have been performed in Westerland, a seaside resort on the North Sea island of Sylt, Germany, during summer 2004 and 2005. A main improvement to previous studies on this subject resulted from the very high temporal resolution of cloud images and radiation measurements and, therefore, a more robust statistical analysis of the occurrence of this effect. It was possible to observe an excess of solar irradiation compared to clear sky irradiation by more than 500 W/m{sup 2}, the largest observed excess irradiation to our knowledge so far. Camera images reveal that largest excess radiation is reached close to overcast situations with altocumulus clouds partly obscuring the solar disk, and preferably with cumulus clouds in lower levels. The maximum duration of the enhancements depends on its strength and ranges from 20 seconds (enhancements > 400 W/m{sup 2}) up to 140 seconds (enhancements > 200 W/m{sup 2}). (orig.)
Dark Skies Awareness Programs for the U.S. International Year of Astronomy
Walker, Constance E.; U. S. IYA Dark Skies Working Group
2009-01-01
The loss of a dark night sky as a natural resource is a growing concern. It impacts not only astronomical research, but also our ecology, health, safety, economics and energy conservation. For this reason, "Dark Skies are a Universal Resource” is one of seven primary themes of the U.S. International Year of Astronomy program in 2009. Its goal is to raise public awareness of the impact of artificial lighting on local environments by getting people involved in a variety of dark skies-related programs. To reach this goal, activities have been developed that: 1) Teach about dark skies using new technology (e.g., an activity-based planetarium show on DVD, podcasting, social networking, Second Life) 2) Provide thematic events on light pollution at star parties and observatory open houses (Dark Skies Discovery Sites, Astronomy Nights in the (National) Parks, Sidewalk Astronomy Nights) 3) Organize an event in the arts (e.g., a photography contest) 4) Involve citizen-scientists in unaided-eye and digital-meter star counting programs, as well as RFI monitoring (e.g., GLOBE at Night and Quiet Skies) and 5) Raise awareness about the link between light pollution and public health, economic issues, ecological consequences, energy conservation, safety and security (e.g., the Dark Skies Toolkit, Good Neighbor Lighting, Earth Hour, National Dark Skies Week, traveling exhibits and a 6-minute video tutorial). To deliver these programs, strategic networks have been established with astronomy clubs (ASP's Night Sky Network's astronomy clubs and the Astronomical League), science and nature centers (Astronomy from the Ground Up and the Association of Science and Technology), educational programs (Project ASTRO and GLOBE) and the International Dark-sky Association. The poster will describe the "know-how” and the means for people to become community advocates in promoting Dark Skies programs as public events at their home institutions. For more information, visit http://astronomy2009
Tropospheric haze and colors of the clear twilight sky.
Lee, Raymond L; Mollner, Duncan C
2017-07-01
At the earth's surface, clear-sky colors during civil twilights depend on the combined spectral effects of molecular scattering, extinction by tropospheric aerosols, and absorption by ozone. Molecular scattering alone cannot produce the most vivid twilight colors near the solar horizon, for which aerosol scattering and absorption are also required. However, less well known are haze aerosols' effects on twilight sky colors at larger scattering angles, including near the antisolar horizon. To analyze this range of colors, we compare 3D Monte Carlo simulations of skylight spectra with hyperspectral measurements of clear twilight skies over a wide range of aerosol optical depths. Our combined measurements and simulations indicate that (a) the purest antisolar twilight colors would occur in a purely molecular, multiple-scattering atmosphere, whereas (b) the most vivid solar-sky colors require at least some turbidity. Taken together, these results suggest that multiple scattering plays an important role in determining the redness of the antitwilight arch.
The new world atlas of artificial night sky brightness.
Falchi, Fabio; Cinzano, Pierantonio; Duriscoe, Dan; Kyba, Christopher C M; Elvidge, Christopher D; Baugh, Kimberly; Portnov, Boris A; Rybnikova, Nataliya A; Furgoni, Riccardo
2016-06-01
Artificial lights raise night sky luminance, creating the most visible effect of light pollution-artificial skyglow. Despite the increasing interest among scientists in fields such as ecology, astronomy, health care, and land-use planning, light pollution lacks a current quantification of its magnitude on a global scale. To overcome this, we present the world atlas of artificial sky luminance, computed with our light pollution propagation software using new high-resolution satellite data and new precision sky brightness measurements. This atlas shows that more than 80% of the world and more than 99% of the U.S. and European populations live under light-polluted skies. The Milky Way is hidden from more than one-third of humanity, including 60% of Europeans and nearly 80% of North Americans. Moreover, 23% of the world's land surfaces between 75°N and 60°S, 88% of Europe, and almost half of the United States experience light-polluted nights.
International Nuclear Information System (INIS)
Kandilli, C.
2005-01-01
There are fifteen different sky types which range from totally overcast sky to low turbidity clear sky have been defined by CIE (International Commission on Illumination). For the applications of solar energy engineering and day lighting purposes, it has a great importance to determine the physical characteristics of atmosphere and the sky type. The most important parameters which define the sky type are clearness index, turbidity and brightness. In this study, the parameters of clearness index, turbidity and brightness of the sky belong to Izmir was calculated and their relations with solar radiation and its components were represented according to 10 years data (1994-2004) of meteorology station of Ege University Solar Energy Institute. In this study, clearness index, turbidity, sky clearness and brightness were evaluated to put forward the effects of the these parameters on the atmospheric condition for designing and engineering purposes
Spectral and diurnal variations in clear sky planetary albedo
Briegleb, B.; Ramanathan, V.
1982-01-01
Spectral and diurnal variations in the clear sky planetary albedo of the earth are calculated using a radiative transfer model to obtain January and July values for a 5 deg x 5 deg global grid. The model employs observed climatological values of temperatures, humidities, snow and sea-ice cover. The diurnal cycle of clear sky albedo is calculated in the following intervals: 0.2-0.5, 0.5-0.7, and 0.7-4 microns. Observed ozone distribution is specified as a function of latitude and season. The 0.2-0.5 micron spectral albedo is 10-20% higher than the total albedo for all latitudes because of Rayleigh scattering; the 0.5-0.7 micron albedo differs from the total albedo by 1-2% for most latitudes, while the 0.7-4 micron albedo is 5-10% lower than the total because of strong atmospheric absorption. Planetary albedo decreases from morning to local noon, with diurnal variations being particularly strong over water.
Crawford, David L.; McKenna, D.
2006-12-01
A good estimate of sky brightness and its variations throughout the night, the months, and even the years is an essential bit of knowledge both for good observing and especially as a tool in efforts to minimize sky brightness through local action. Hence a stable and accurate monitor can be a valuable and necessary tool. We have developed such a monitor, with the financial help of Vatican Observatory and Walker Management. The device is now undergoing its Beta test in preparation for production. It is simple, accurate, well calibrated, and automatic, sending its data directly to IDA over the internet via E-mail . Approximately 50 such monitors will be ready soon for deployment worldwide including most major observatories. Those interested in having one should enquire of IDA about details.
International Nuclear Information System (INIS)
Madsen, G. J.; Gaensler, B. M.
2013-01-01
A key science driver for the next generation of wide-field optical and radio surveys is the exploration of the time variable sky. These surveys will have unprecedented sensitivity and areal coverage, but will be limited in their ability to detect variability on time scales longer than the lifetime of the surveys. We present a new precision, multi-epoch photometric catalog that spans 60 yr by combining the US Naval Observatory-B (USNO-B) and Sloan Digital Sky Survey (SDSS) Data Release 9 (DR9) catalogs. We recalibrate the photometry of the original USNO-B catalog and create a catalog with two epochs of photometry in up to five different bands for 43,647,887 optical point sources that lie in the DR9 footprint of the northern sky. The recalibrated objects span a magnitude range 14 ≲ m ≲ 20 and are accurate to ≈0.1 mag. We minimize the presence of spurious objects and those with inaccurate magnitudes by identifying and removing several sources of systematic errors in the two originating catalogs, with a focus on spurious objects that exhibit large apparent magnitude variations. After accounting for these effects, we find ≈250,000 stars and quasars that show significant (≥4σ) changes in brightness between the USNO-B and SDSS DR9 epochs. We discuss the historical value of the catalog and its application to the study of long time scale, large amplitude variable stars and quasars
SkyMine Carbon Mineralization Pilot Project
Energy Technology Data Exchange (ETDEWEB)
Joe Jones; Clive Barton; Mark Clayton; Al Yablonsky; David Legere
2010-09-30
This Topical Report addresses accomplishments achieved during Phase 1 of the SkyMine{reg_sign} Carbon Mineralization Pilot Project. The primary objectives of this project are to design, construct, and operate a system to capture CO{sub 2} from a slipstream of flue gas from a commercial coal-fired cement kiln, convert that CO{sub 2} to products having commercial value (i.e., beneficial use), show the economic viability of the CO{sub 2} capture and conversion process, and thereby advance the technology to a point of readiness for commercial scale demonstration and proliferation. The project will also substantiate market opportunities for the technology by sales of chemicals into existing markets, and identify opportunities to improve technology performance and reduce costs at commercial scale. The primary objectives of Phase 1 of the project were to elaborate proven SkyMine{reg_sign} process chemistry to commercial pilot-scale operation and complete the preliminary design ('Reference Plant Design') for the pilot plant to be built and operated in Phase 2. Additionally, during Phase 1, information necessary to inform a DOE determination regarding NEPA requirements for the project was developed, and a comprehensive carbon lifecycle analysis was completed. These items were included in the formal application for funding under Phase 2. All Phase 1 objectives were successfully met on schedule and within budget.
Artificial light alters natural regimes of night-time sky brightness
Davies, Thomas W.; Bennie, Jonathan; Inger, Richard; Gaston, Kevin J.
2013-01-01
Artificial light is globally one of the most widely distributed forms of anthropogenic pollution. However, while both the nature and ecological effects of direct artificial lighting are increasingly well documented, those of artificial sky glow have received little attention. We investigated how city lights alter natural regimes of lunar sky brightness using a novel ten month time series of measurements recorded across a gradient of increasing light pollution. In the city, artificial lights increased sky brightness to levels six times above those recorded in rural locations, nine and twenty kilometers away. Artificial lighting masked natural monthly and seasonal regimes of lunar sky brightness in the city, and increased the number and annual regime of full moon equivalent hours available to organisms during the night. The changes have potentially profound ecological consequences.
Ieda, Akimasa; Kauristie, Kirsti; Nishimura, Yukitoshi; Miyashita, Yukinaga; Frey, Harald U.; Juusola, Liisa; Whiter, Daniel; Nosé, Masahito; Fillingim, Matthew O.; Honary, Farideh; Rogers, Neil C.; Miyoshi, Yoshizumi; Miura, Tsubasa; Kawashima, Takahiro; Machida, Shinobu
2018-05-01
Substorm onset has originally been defined as a longitudinally extended sudden auroral brightening (Akasofu initial brightening: AIB) followed a few minutes later by an auroral poleward expansion in ground-based all-sky images (ASIs). In contrast, such clearly marked two-stage development has not been evident in satellite-based global images (GIs). Instead, substorm onsets have been identified as localized sudden brightenings that expand immediately poleward. To resolve these differences, optical substorm onset signatures in GIs and ASIs are compared in this study for a substorm that occurred on December 7, 1999. For this substorm, the Polar satellite ultraviolet global imager was operated with a fixed-filter (170 nm) mode, enabling a higher time resolution (37 s) than usual to resolve the possible two-stage development. These data were compared with 20-s resolution green-line (557.7 nm) ASIs at Muonio in Finland. The ASIs revealed the AIB at 2124:50 UT and the subsequent poleward expansion at 2127:50 UT, whereas the GIs revealed only an onset brightening that started at 2127:49 UT. Thus, the onset in the GIs was delayed relative to the AIB and in fact agreed with the poleward expansion in the ASIs. The fact that the AIB was not evident in the GIs may be attributed to the limited spatial resolution of GIs for thin auroral arc brightenings. The implications of these results for the definition of substorm onset are discussed herein.[Figure not available: see fulltext.
Pi of the Sky Telescopes in Spain and Chile
Directory of Open Access Journals (Sweden)
M. Siudek
2011-01-01
Full Text Available Pi of the Sky is a system of robotic telescopes designed for observations of short timescale astrophysical phenomena, e.g. prompt optical GRB emissions. The apparatus is designed to monitor a large fraction of the sky with 12–13 m range and time resolution of the order of 1–10 seconds. In October 2010 the first unit of the new Pi of the Sky detector system was successfully installed in the INTA El Arenosillo Test Centre in Spain. We also moved our prototype detector from Las Campanas Observatory to San Pedro de Atacama Observatory in March 2011. The status and performance of both detectors is presented.
Massey, Steve
2009-01-01
A guide to using modern integrating video cameras for deep-sky viewing and imaging with the kinds of modest telescopes available commercially to amateur astronomers. It includes an introduction and a brief history of the technology and camera types. It examines the pros and cons of this unrefrigerated yet highly efficient technology
Solar Wind Charge Exchange Contribution To The ROSAT Sky Survey Maps
Uprety, Y.; Chiao, M.; Collier, M. R.; Cravens, T.; Galeazzi, M.; Koutroumpa, D.; Kuntz, K. D.; Lallement, R.; Lepri, S. T.; Liu, W.;
2016-01-01
DXL (Diffuse X-ray emission from the Local Galaxy) is a sounding rocket mission designed to estimate the contribution of solar wind charge eXchange (SWCX) to the diffuse X-ray background and to help determine the properties of the Local Hot Bubble. The detectors are large area thin-window proportional counters with a spectral response that is similar to that of the PSPC (Position Sensitive Proportional Counters) used in the ROSAT All Sky Survey (RASS). A direct comparison of DXL and RASS data for the same part of the sky viewed from quite different vantage points in the solar system, and the assumption of approximate isotropy for the solar wind, allowed us to quantify the SWCX contribution to all six RASS bands (R1-R7, excluding R3). We find that the SWCX contribution at l = 140 degrees, b = 0 degrees, where the DXL path crosses the Galactic plane, is 33 percent plus or minus 6 percent (statistical) plus or minus 12 percent (systematic) for R1, 44 percent plus or minus 6 percent plus or minus 5 percent for R2, 18 percent plus or minus 12 percent plus or minus 11 percent for R4, 14 percent plus or minus 11 percent plus or minus 9 percent for R5, and negligible for the R6 and R7 bands. Reliable models for the distribution of neutral H and He in the solar system permit estimation of the contribution of interplanetary SWCX emission over the the whole sky and correction of the RASS maps. We find that the average SWCX contribution in the whole sky is 26 percent plus or minus 6 percent plus or minus 13 percent for R1, 30 percent plus or minus 4 percent plus or minus 4 percent for R2, 8 percent plus or minus 5 percent plus or minus 5 percent for R4, 6 percent plus or minus 4 percent plus or minus 4 percent for R5, and negligible for R6 and R7.
76 FR 42704 - Sky River LLC; Notice of Filing
2011-07-19
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket Nos. ER11-3277-000; ER11-3277-001] Sky River LLC; Notice of Filing Take notice that, on July 8, 2011, Sky River LLC filed to amend its Open Access Transmission Tariff (OATT) filing, submitted on April 1, 2011 and amended on April 7...
Gender Roles and Night-Sky Watching among College Students
Kelly, William E.; McGee, Catherine M.
2012-01-01
The present study investigated the relationship between gender roles and night-sky watching in a sample of college students (N=161). The Bem Sex-Role Inventory (BSRI) and the Noctcaelador Inventory (NI) were used to investigate the differences between gender role groups for night-sky watching. The results supported the hypothesis that androgynous…
Adams, Earle; Ward, Tony J.; Vanek, Diana; Marra, Nancy; Hester, Carolyn; Knuth, Randy; Spangler, Todd; Jones, David; Henthorn, Melissa; Hammill, Brock; Smith, Paul; Salisbury, Rob; Reckin, Gene; Boulafentis, Johna
2009-01-01
The University of Montana (UM)-Missoula has implemented a problem-based program in which students perform scientific research focused on indoor air pollution. The Air Toxics Under the Big Sky program (Jones et al. 2007; Adams et al. 2008; Ward et al. 2008) provides a community-based framework for understanding the complex relationship between poor…
Gods, Demons and Deceivers: Jesuits Facing Chaco Skies
López, Alejandro Martín
2015-05-01
The Jesuit missions located in the Chaco are less known than the ones in Paraguay. They are the last step of the Jesuits' missionary device in the Rio de la Plata region. They were dedicated to 'evangelize' and 'civilize' the aboriginal groups considered more hostile: nomadic hunter-gatherers who adopted the use of horses and were not controlled by the colonial government. These groups were seen by Europeans as a radical otherness. That is why the Jesuits' descriptions of Chaco Indian skies are a very interesting example about European attitudes toward other worldviews. This paper explores the use of different paradigms for interpreting these alternative skies: demonic influence, the deception of sorcerers and an Evemeristic reading of the indigenous worldview. This article also addresses some of the interactions between the aboriginal and Christian skies in the mission context.
Proof of Concept for a Simple Smartphone Sky Monitor
Kantamneni, Abhilash; Nemiroff, R. J.; Brisbois, C.
2013-01-01
We present a novel approach of obtaining a cloud and bright sky monitor by using a standard smartphone with a downloadable app. The addition of an inexpensive fisheye lens can extend the angular range to the entire sky visible above the device. A preliminary proof of concept image shows an optical limit of about visual magnitude 5 for a 70-second exposure. Support science objectives include cloud monitoring in a manner similar to the more expensive cloud monitors in use at most major astronomical observatories, making expensive observing time at these observatories more efficient. Primary science objectives include bright meteor tracking, bright comet tracking, and monitoring the variability of bright stars. Citizen science objectives include crowd sourcing of many networked sky monitoring smartphones typically in broader support of many of the primary science goals. The deployment of a citizen smartphone array in an active science mode could leverage the sky monitoring data infrastructure to track other non-visual science opportunities, including monitoring the Earth's magnetic field for the effects of solar flares and exhaustive surface coverage for strong seismic events.
Dark Sky Collaborators: Arizona (AZ) Observatories, Communities, and Businesses
Del Castillo, Elizabeth Alvarez; Corbally, Christopher; Falco, Emilio E.; Green, Richard F.; Hall, Jeffrey C.; Williams, G. Grant
2015-03-01
With outdoor lighting ordinances in Arizona first in place around observatories in 1958 and 1972, then throughout the state since 1986, Arizonans have extensive experience working with communities and businesses to preserve our dark skies. Though communities are committed to the astronomy sector in our state, astronomers must collaborate with other stakeholders to implement solutions. Ongoing education and public outreach is necessary to enable ordinance updates as technology changes. Despite significant population increases, sky brightness measurements over the last 20 years show that ordinance updates are worth our efforts as we seek to maintain high quality skies around our observatories. Collaborations are being forged and actions taken to promote astronomy for the longer term in Arizona.
Moore, Wendy; Meyer, Wallace M; Eble, Jeffrey A; Franklin, Kimberly; Wiens, John F; Brusca, Richard C
2013-01-01
The Arizona Sky Island Arthropod Project (ASAP) is a new multi-disciplinary research program at the University of Arizona that combines systematics, biogeography, ecology, and population genetics to study origins and patterns of arthropod diversity along elevation gradients and among mountain ranges in the Madrean Sky Island Region. Arthropods represent taxonomically and ecologically diverse organisms that drive key ecosystem processes in this mountain archipelago. Using data from museum specimens and specimens we obtain during long-term collecting and monitoring programs, ASAP will document arthropod species across Arizona's Sky Islands to address a number of fundamental questions about arthropods of this region. Baseline data will be used to determine climatic boundaries for target species, which will then be integrated with climatological models to predict future changes in arthropod communities and distributions in the wake of rapid climate change. ASAP also makes use of the natural laboratory provided by the Sky Islands to investigate ecological and genetic factors that influence diversification and patterns of community assembly. Here, we introduce the project, outline overarching goals, and describe preliminary data from the first year of sampling ground-dwelling beetles and ants in the Santa Catalina Mountains.
Sidney, T.; Aylott, B.; Christensen, N.; Farr, B.; Farr, W.; Feroz, F.; Gair, J.; Grover, K.; Graff, P.; Hanna, C.;
2014-01-01
The problem of reconstructing the sky position of compact binary coalescences detected via gravitational waves is a central one for future observations with the ground-based network of gravitational-wave laser interferometers, such as Advanced LIGO and Advanced Virgo. Different techniques for sky localization have been independently developed. They can be divided in two broad categories: fully coherent Bayesian techniques, which are high latency and aimed at in-depth studies of all the parameters of a source, including sky position, and "triangulation-based" techniques, which exploit the data products from the search stage of the analysis to provide an almost real-time approximation of the posterior probability density function of the sky location of a detection candidate. These techniques have previously been applied to data collected during the last science runs of gravitational-wave detectors operating in the so-called initial configuration. Here, we develop and analyze methods for assessing the self consistency of parameter estimation methods and carrying out fair comparisons between different algorithms, addressing issues of efficiency and optimality. These methods are general, and can be applied to parameter estimation problems other than sky localization. We apply these methods to two existing sky localization techniques representing the two above-mentioned categories, using a set of simulated inspiralonly signals from compact binary systems with a total mass of equal to or less than 20M solar mass and nonspinning components. We compare the relative advantages and costs of the two techniques and show that sky location uncertainties are on average a factor approx. equals 20 smaller for fully coherent techniques than for the specific variant of the triangulation-based technique used during the last science runs, at the expense of a factor approx. equals 1000 longer processing time.
Estimates of clear night sky emissivity in the Negev Highlands, Israel
International Nuclear Information System (INIS)
Tang Runsheng; Etzion, Y.; Meir, I.A.
2004-01-01
A simple method was introduced to estimate the atmospheric emissivity of clear night skies based on the water temperature variation inside an open shallow pond. The method used the pond as an absorber of atmospheric radiation by measuring the water evaporation rate from the pond to ambient air and then calculating the heat loss inside the pond due to the radiative heat exchange between the pond and sky dome. An empirical correlation for the calculations of clear night sky emissivity in the Negev Highlands, Israel, was found. It showed that the emissivity of clear night sky in the Negev Highlands is slightly lower than that expected by Berdahl et al. and Clark's correlations under the climatic conditions during the period of measurements
``Dark Skies are a Universal Resource'' Programs Planned for the International Year of Astronomy
Walker, C. E.; Berglund, K.; Bueter, C.; Crelin, B.; Duriscoe, D.; Moore, C.; Gauthier, A.; Gay, P. L.; Foster, T.; Heatherly, S. A.; Maddalena, R.; Mann, T.; Patten, K.; Pompea, S. M.; Sparks, R.; Schaaf, F.; Simmons, M.; Smith, C.; Smith, M.; Tafreshi, B.
2008-11-01
In an effort to help more people appreciate the ongoing loss of a dark night sky for much of the world's population and to raise public knowledge about diverse impacts of excess artificial lighting on local environments, the International Year of Astronomy's Dark Skies Working Group has established six ``Dark Skies'' programs and six ``Dark Skies'' resources. The Dark Skies programs include GLOBE at Night (with Earth Hour), Astronomy Nights in the [National] Parks, Dark Skies Discovery Sites, Quiet Skies, Good Neighbor Lighting, and a digital photography contest. Resources include the light education toolkit, the ``Let There Be Night'' DVD and planetarium program, the 6-minute video, online interactions like Second Life, podcasts, and traveling exhibits. The programs and resources are summarized here, as they were in a poster for the June 2008 ASP/AAS conference. For more information on these programs and resources, visit http://astronomy2009.us/darkskies/.
Combined interpretation of SkyTEM and high-resolution seismic data
DEFF Research Database (Denmark)
Høyer, Anne-Sophie; Lykke-Andersen, Holger; Jørgensen, Flemming Voldum
2011-01-01
made based on AEM (SkyTEM) and high-resolution seismic data from an area covering 10 km2 in the western part of Denmark. As support for the interpretations, an exploration well was drilled to provide lithological and logging information in the form of resistivity and vertical seismic profiling. Based...... on the resistivity log, synthetic SkyTEM responses were calculated with a varying number of gate-times in order to illustrate the effect of the noise-level. At the exploration well geophysical data were compared to the lithological log; in general there is good agreement. The same tendency was recognised when Sky...
Night sky a field guide to the constellations
Poppele, Jonathan
2009-01-01
Stargazing is among the most peaceful and inspiring outdoor activities. Night Sky, the award-winning book by Jonathan Poppele, makes it more fun than ever! Take a simple approach to finding 62 constellations by focusing on one constellation at a time, instead of attempting to study dizzying charts. Start with the easy-to-find constellations during each season and work toward the more difficult ones. Better yet, you'll learn how to locate any constellation in relation to the Big Dipper, the North Star and the top of the sky. With two ways to locate each constellation, you'll know where in the sky to look and what to look for! Along the way, you'll be introduced to mythology, facts and tidbits, as well as details about the planets, solar system and more! As an added bonus, the book comes with a red-light flashlight for night reading.
BlueSky Cloud Framework: An E-Learning Framework Embracing Cloud Computing
Dong, Bo; Zheng, Qinghua; Qiao, Mu; Shu, Jian; Yang, Jie
Currently, E-Learning has grown into a widely accepted way of learning. With the huge growth of users, services, education contents and resources, E-Learning systems are facing challenges of optimizing resource allocations, dealing with dynamic concurrency demands, handling rapid storage growth requirements and cost controlling. In this paper, an E-Learning framework based on cloud computing is presented, namely BlueSky cloud framework. Particularly, the architecture and core components of BlueSky cloud framework are introduced. In BlueSky cloud framework, physical machines are virtualized, and allocated on demand for E-Learning systems. Moreover, BlueSky cloud framework combines with traditional middleware functions (such as load balancing and data caching) to serve for E-Learning systems as a general architecture. It delivers reliable, scalable and cost-efficient services to E-Learning systems, and E-Learning organizations can establish systems through these services in a simple way. BlueSky cloud framework solves the challenges faced by E-Learning, and improves the performance, availability and scalability of E-Learning systems.
Non-sky-averaged sensitivity curves for space-based gravitational-wave observatories
International Nuclear Information System (INIS)
Vallisneri, Michele; Galley, Chad R
2012-01-01
The signal-to-noise ratio (SNR) is used in gravitational-wave observations as the basic figure of merit for detection confidence and, together with the Fisher matrix, for the amount of physical information that can be extracted from a detected signal. SNRs are usually computed from a sensitivity curve, which describes the gravitational-wave amplitude needed by a monochromatic source of given frequency to achieve a threshold SNR. Although the term 'sensitivity' is used loosely to refer to the detector's noise spectral density, the two quantities are not the same: the sensitivity includes also the frequency- and orientation-dependent response of the detector to gravitational waves and takes into account the duration of observation. For interferometric space-based detectors similar to LISA, which are sensitive to long-lived signals and have constantly changing position and orientation, exact SNRs need to be computed on a source-by-source basis. For convenience, most authors prefer to work with sky-averaged sensitivities, accepting inaccurate SNRs for individual sources and giving up control over the statistical distribution of SNRs for source populations. In this paper, we describe a straightforward end-to-end recipe to compute the non-sky-averaged sensitivity of interferometric space-based detectors of any geometry. This recipe includes the effects of spacecraft motion and of seasonal variations in the partially subtracted confusion foreground from Galactic binaries, and it can be used to generate a sampling distribution of sensitivities for a given source population. In effect, we derive error bars for the sky-averaged sensitivity curve, which provide a stringent statistical interpretation for previously unqualified statements about sky-averaged SNRs. As a worked-out example, we consider isotropic and Galactic-disk populations of monochromatic sources, as observed with the 'classic LISA' configuration. We confirm that the (standard) inverse-rms average sensitivity
DeSouza-Machado, Sergio; Larrabee Strow, L.; Tangborn, Andrew; Huang, Xianglei; Chen, Xiuhong; Liu, Xu; Wu, Wan; Yang, Qiguang
2018-01-01
One-dimensional variational retrievals of temperature and moisture fields from hyperspectral infrared (IR) satellite sounders use cloud-cleared radiances (CCRs) as their observation. These derived observations allow the use of clear-sky-only radiative transfer in the inversion for geophysical variables but at reduced spatial resolution compared to the native sounder observations. Cloud clearing can introduce various errors, although scenes with large errors can be identified and ignored. Information content studies show that, when using multilayer cloud liquid and ice profiles in infrared hyperspectral radiative transfer codes, there are typically only 2-4 degrees of freedom (DOFs) of cloud signal. This implies a simplified cloud representation is sufficient for some applications which need accurate radiative transfer. Here we describe a single-footprint retrieval approach for clear and cloudy conditions, which uses the thermodynamic and cloud fields from numerical weather prediction (NWP) models as a first guess, together with a simple cloud-representation model coupled to a fast scattering radiative transfer algorithm (RTA). The NWP model thermodynamic and cloud profiles are first co-located to the observations, after which the N-level cloud profiles are converted to two slab clouds (TwoSlab; typically one for ice and one for water clouds). From these, one run of our fast cloud-representation model allows an improvement of the a priori cloud state by comparing the observed and model-simulated radiances in the thermal window channels. The retrieval yield is over 90 %, while the degrees of freedom correlate with the observed window channel brightness temperature (BT) which itself depends on the cloud optical depth. The cloud-representation and scattering package is benchmarked against radiances computed using a maximum random overlap (RMO) cloud scheme. All-sky infrared radiances measured by NASA's Atmospheric Infrared Sounder (AIRS) and NWP thermodynamic and cloud
Directory of Open Access Journals (Sweden)
S. DeSouza-Machado
2018-01-01
Full Text Available One-dimensional variational retrievals of temperature and moisture fields from hyperspectral infrared (IR satellite sounders use cloud-cleared radiances (CCRs as their observation. These derived observations allow the use of clear-sky-only radiative transfer in the inversion for geophysical variables but at reduced spatial resolution compared to the native sounder observations. Cloud clearing can introduce various errors, although scenes with large errors can be identified and ignored. Information content studies show that, when using multilayer cloud liquid and ice profiles in infrared hyperspectral radiative transfer codes, there are typically only 2–4 degrees of freedom (DOFs of cloud signal. This implies a simplified cloud representation is sufficient for some applications which need accurate radiative transfer. Here we describe a single-footprint retrieval approach for clear and cloudy conditions, which uses the thermodynamic and cloud fields from numerical weather prediction (NWP models as a first guess, together with a simple cloud-representation model coupled to a fast scattering radiative transfer algorithm (RTA. The NWP model thermodynamic and cloud profiles are first co-located to the observations, after which the N-level cloud profiles are converted to two slab clouds (TwoSlab; typically one for ice and one for water clouds. From these, one run of our fast cloud-representation model allows an improvement of the a priori cloud state by comparing the observed and model-simulated radiances in the thermal window channels. The retrieval yield is over 90 %, while the degrees of freedom correlate with the observed window channel brightness temperature (BT which itself depends on the cloud optical depth. The cloud-representation and scattering package is benchmarked against radiances computed using a maximum random overlap (RMO cloud scheme. All-sky infrared radiances measured by NASA's Atmospheric Infrared Sounder (AIRS and NWP
Classification of Variable Objects in Massive Sky Monitoring Surveys
Woźniak, Przemek; Wyrzykowski, Łukasz; Belokurov, Vasily
2012-03-01
The era of great sky surveys is upon us. Over the past decade we have seen rapid progress toward a continuous photometric record of the optical sky. Numerous sky surveys are discovering and monitoring variable objects by hundreds of thousands. Advances in detector, computing, and networking technology are driving applications of all shapes and sizes ranging from small all sky monitors, through networks of robotic telescopes of modest size, to big glass facilities equipped with giga-pixel CCD mosaics. The Large Synoptic Survey Telescope will be the first peta-scale astronomical survey [18]. It will expand the volume of the parameter space available to us by three orders of magnitude and explore the mutable heavens down to an unprecedented level of sensitivity. Proliferation of large, multidimensional astronomical data sets is stimulating the work on new methods and tools to handle the identification and classification challenge [3]. Given exponentially growing data rates, automated classification of variability types is quickly becoming a necessity. Taking humans out of the loop not only eliminates the subjective nature of visual classification, but is also an enabling factor for time-critical applications. Full automation is especially important for studies of explosive phenomena such as γ-ray bursts that require rapid follow-up observations before the event is over. While there is a general consensus that machine learning will provide a viable solution, the available algorithmic toolbox remains underutilized in astronomy by comparison with other fields such as genomics or market research. Part of the problem is the nature of astronomical data sets that tend to be dominated by a variety of irregularities. Not all algorithms can handle gracefully uneven time sampling, missing features, or sparsely populated high-dimensional spaces. More sophisticated algorithms and better tools available in standard software packages are required to facilitate the adoption of
Sky brightness and twilight measurements at Jogyakarta city, Indonesia
International Nuclear Information System (INIS)
Herdiwijaya, Dhani
2016-01-01
The sky brightness measurements were performed using a portable photometer. A pocket-sized and low-cost photometer has 20 degree area measurement, and spectral ranges between 320-720 nm with output directly in magnitudes per arc second square (mass) unit. The sky brightness with 3 seconds temporal resolutions was recorded at Jogyakarta city (110° 25’ E; 70° 52’ S; elevation 100 m) within 136 days in years from 2014 to 2016. The darkest night could reach 22.61 mpass only in several seconds, with mean value 18.8±0.7 mpass and temperature variation 23.1±1.2 C. The difference of mean sky brightness between before and after midnight was about -0.76 mpass or 2.0 times brighter. Moreover, the sky brightness and temperature fluctuations were more stable in after midnight than in before midnight. It is suggested that city light pollution affects those variations, and subsequently duration of twilight. By comparing twilight brightness for several places, we also suggest a 17° solar dip or about 66 minutes before sunrise for new time of Fajr prayer. (paper)
[The backgroud sky subtraction around [OIII] line in LAMOST QSO spectra].
Shi, Zhi-Xin; Comte, Georges; Luo, A-Li; Tu, Liang-Ping; Zhao, Yong-Heng; Wu, Fu-Chao
2014-11-01
At present, most sky-subtraction methods focus on the full spectrum, not the particular location, especially for the backgroud sky around [OIII] line which is very important to low redshift quasars. A new method to precisely subtract sky lines in local region is proposed in the present paper, which sloves the problem that the width of Hβ-[OIII] line is effected by the backgroud sky subtraction. The exprimental results show that, for different redshift quasars, the spectral quality has been significantly improved using our method relative to the original batch program by LAMOST. It provides a complementary solution for the small part of LAMOST spectra which are not well handled by LAMOST 2D pipeline. Meanwhile, This method has been used in searching for candidates of double-peaked Active Galactic Nuclei.
Planning and scheduling algorithms for the COSMO-SkyMed constellation
Bianchessi, Nicola; Righini, Giovanni
2008-01-01
The COSMO-SkyMed satellite constellation for the observation of the Earth is made of four satellites equipped with radar instruments and is intended for dual use, i.e. for security as well as for environmental monitoring purpose. The planning and scheduling problem for the COSMO-SkyMed constellation
Qaid, Adeb; Lamit, Hasanuddin Bin; Ossen, Dilshan Remaz; Rasidi, Mohd Hisyam
2018-02-01
Poor daytime and night-time micrometeorological conditions are issues that influence the quality of environmental conditions and can undermine a comfortable human lifestyle. The sky view factor (SVF) is one of the essential physical parameters used to assess the micrometeorological conditions and thermal comfort levels within city streets. The position of the visible sky relative to the path of the sun, in the cardinal and ordinal directions, has not been widely discerned as a parameter that could have an impact on the micrometeorological conditions of urban streets. To investigate this parameter, different urban streets that have a similar SVF value but diverse positions of visible sky were proposed in different street directions intersecting with the path of the sun, namely N-S, NE-SW and NW-SE. The effects of daytime and night-time micrometeorological variables and human thermal comfort variables on the street were investigated by applying ENVI-met V3.1 Beta software. The results show that the position of the visible sky has a greater influence on the street's meteorological and human thermal comfort conditions than the SVF value. It has the ability to maximise or minimise the mean radiation temperature (Tmrt, °C) and the physiological equivalent temperature (PET, °C) at street level. However, the visible sky positioned to the zenith in a NE-SW or N-S street direction and to the SW of a NW-SE street direction achieves the best daytime micrometeorological and thermal comfort conditions. Alternatively, the visible sky positioned to the NE for a NW-SE street direction, to the NW and the zenith for a NE-SW street direction and to the zenith for a N-S street direction reduces the night-time air temperature (Ta, °C). Therefore, SVF and the position of the visible sky relative to the sun's trajectory, in the cardinal and ordinal directions, must be considered during urban street planning to better understand the resultant micrometeorological and human thermal
Building on the International Year of Astronomy: The Dark Skies Awareness Program
Walker, C. E.; Sparks, R. T.; Pompea, S. M.
2010-08-01
The International Year of Astronomy (IYA2009) offered opportunities to create exemplary educational programs in astronomy, such as those through the cornerstone project, Dark Skies Awareness (DSA). The preservation of dark skies is important for many reasons including astronomy, energy conservation, wildlife conservation, and even human health. Light pollution is a growing concern, yet it is one of the easiest global environmental problems citizen scientists can address on a local level. The Dark Skies workshop imparted the skills necessary for participants to lead activities at their home institution for conserving dark skies. Workshop participants experienced the hands-on activities, which are suitable for use in a variety of settings including museums, science centers, planetariums, schools, university outreach efforts, and astronomy club events. Participants were immersed in activities that illustrate proper lighting, light pollution's effects on wildlife, and how to measure the darkness of your skies. Several citizen science projects were highlighted, including GLOBE at Night, the Great World Wide Star Count, and How Many Stars. These programs enlist the help of students and the general public to collect data on the night sky conditions in their community and contribute to a worldwide database on light pollution. The data can be analyzed using various online tools. A CD of activities, a light shielding demonstration, a book, a two DVD set with a planetarium show, and many other resources are included in a Dark Skies Education Kit, which workshop participants received at the close of the workshop.
Region of Nova Cygni 1975 on the Palomar Sky Survey
International Nuclear Information System (INIS)
Beardsley, W.R.; King, M.W.; Russell, J.L.; Stein, J.W.
1975-01-01
Careful superposition of a blue Palomar Sky Survey print onto a sectored photograph of Nova Cygni 1975 obtained with the Thaw 30-inch (76-cm) refractor at the Allegheny Observatory decisively confirms the fact that no star brighter than magnitude 21 appears on the Sky Survey print at that position
Somayajula, Srikanth Ayyala; Devred, Emmanuel; Bélanger, Simon; Antoine, David; Vellucci, V; Babin, Marcel
2018-04-20
In this study, we report on the performance of satellite-based photosynthetically available radiation (PAR) algorithms used in published oceanic primary production models. The performance of these algorithms was evaluated using buoy observations under clear and cloudy skies, and for the particular case of low sun angles typically encountered at high latitudes or at moderate latitudes in winter. The PAR models consisted of (i) the standard one from the NASA-Ocean Biology Processing Group (OBPG), (ii) the Gregg and Carder (GC) semi-analytical clear-sky model, and (iii) look-up-tables based on the Santa Barbara DISORT atmospheric radiative transfer (SBDART) model. Various combinations of atmospheric inputs, empirical cloud corrections, and semi-analytical irradiance models yielded a total of 13 (11 + 2 developed in this study) different PAR products, which were compared with in situ measurements collected at high frequency (15 min) at a buoy site in the Mediterranean Sea (the "BOUée pour l'acquiSition d'une Série Optique à Long termE," or, "BOUSSOLE" site). An objective ranking method applied to the algorithm results indicated that seven PAR products out of 13 were well in agreement with the in situ measurements. Specifically, the OBPG method showed the best overall performance with a root mean square difference (RMSD) (bias) of 19.7% (6.6%) and 10% (6.3%) followed by the look-up-table method with a RMSD (bias) of 25.5% (6.8%) and 9.6% (2.6%) at daily and monthly scales, respectively. Among the four methods based on clear-sky PAR empirically corrected for cloud cover, the Dobson and Smith method consistently underestimated daily PAR while the Budyko formulation overestimated daily PAR. Empirically cloud-corrected methods using cloud fraction (CF) performed better under quasi-clear skies (CF0.7), however, all methods showed larger RMSD differences (biases) ranging between 32% and 80.6% (-54.5%-8.7%). Finally, three methods tested for low sun elevations revealed
Radiative sky cooling: fundamental physics, materials, structures, and applications
Sun, Xingshu; Sun, Yubo; Zhou, Zhiguang; Alam, Muhammad Ashraful; Bermel, Peter
2017-07-01
Radiative sky cooling reduces the temperature of a system by promoting heat exchange with the sky; its key advantage is that no input energy is required. We will review the origins of radiative sky cooling from ancient times to the modern day, and illustrate how the fundamental physics of radiative cooling calls for a combination of properties that may not occur in bulk materials. A detailed comparison with recent modeling and experiments on nanophotonic structures will then illustrate the advantages of this recently emerging approach. Potential applications of these radiative cooling materials to a variety of temperature-sensitive optoelectronic devices, such as photovoltaics, thermophotovoltaics, rectennas, and infrared detectors, will then be discussed. This review will conclude by forecasting the prospects for the field as a whole in both terrestrial and space-based systems.
CFHT's SkyProbe: True Atmospheric Attenuation Measurement in the Telescope Field
Cuillandre, J.-C.; Magnier, E. A.; Isani, S.; Sabin, D.; Knight, W.; Kras, S.; Lai, K.
Developed at the Canada France Hawaii Telescope (CFHT), SkyProbe is a system that allows the direct measurement of the true attenuation by clouds. This measurement is performed approximately once per min, directly on the field viewed by the telescope. It has been possible to make this system relatively inexpensively due to low cost CCD cameras available on the amateur market. A crucial addition to this hardware is the recent availability of a full-sky photometry catalog at the appropriate depth: the Tycho catalog from the Hipparcos mission. A very important element in the SkyProbe data set creation is the automatic data analysis pipeline, Elixir, developed at CFHT for the improved operation of the CFHT wide-field imagers CFH12K and MegaCam. SkyProbe's FITS images are processed in real time, and the pipeline output (a zero point attenuation) provides the current sky transmission to the observers and aids immediate decision making. These measurements are also attached to the archived data, adding a key tool for future use by other astronomers. Specific features of the detector, such as intra pixel quantum efficiency variations, must be taken into consideration since the data are strongly undersampled.
International Nuclear Information System (INIS)
Henley, David B.; Shelton, Robin L.
2012-01-01
We present an all-sky catalog of diffuse O VII and O VIII line intensities, extracted from archival XMM-Newton observations. This catalog supersedes our previous catalog, which covered the sky between l = 120° and l = 240°. We attempted to reduce the contamination from near-Earth solar wind charge exchange (SWCX) emission by excluding times of high solar wind proton flux from the data. Without this filtering, we were able to extract measurements from 1868 observations. With this filtering, nearly half of the observations became unusable, and only 1003 observations yielded measurements. The O VII and O VIII intensities are typically ∼2-11 and ∼ –2 s –1 sr –1 (line unit, L.U.), respectively, although much brighter intensities were also recorded. Our data set includes 217 directions that have been observed multiple times by XMM-Newton. The time variation of the intensities from such directions may be used to constrain SWCX models. The O VII and O VIII intensities typically vary by ∼ 10 L.U. were observed. We compared our measurements with models of the heliospheric and geocoronal SWCX. The heliospheric SWCX intensity is expected to vary with ecliptic latitude and solar cycle. We found that the observed oxygen intensities generally decrease from solar maximum to solar minimum, both at high ecliptic latitudes (which is as expected) and at low ecliptic latitudes (which is not as expected). The geocoronal SWCX intensity is expected to depend on the solar wind proton flux incident on the Earth and on the sightline's path through the magnetosheath. The intensity variations seen in directions that have been observed multiple times are in poor agreement with the predictions of a geocoronal SWCX model. We found that the oxygen lines account for ∼40%-50% of the 3/4 keV X-ray background that is not due to unresolved active galactic nuclei, in good agreement with a previous measurement. However, we found that this fraction is not easily explainable by a
Daylighting on the working plane in oriented attic rooms under overcast and clear sky
Directory of Open Access Journals (Sweden)
Kondáš Kristián
2014-06-01
Full Text Available The evaluation of daylight conditions in building interiors is based on the Daylight Factor concept after current Slovak standards. Criteria and requirements determined in these standards consider the worst daylight exterior conditions which are described by CIE overcast sky model. The sky luminance distribution of overcast sky is centrical to the zenith, so independence of window orientation to cardinal points is characteristic in daylighting calculations. The sky luminance distribution modelling is one of the main task of the daylight source research more than 50 years. It is evident that also other types of sky conditions exist in nature. An introduction of a new criterion based on photometric variables, which also consider sunlight influence, is expected. This article represents a study of the influence of the interior orientation on distribution of daylighting in attic spaces under an overcast and clear sky
Verification of the ISO calibration method for field pyranometers under tropical sky conditions
Janjai, Serm; Tohsing, Korntip; Pattarapanitchai, Somjet; Detkhon, Pasakorn
2017-02-01
Field pyranomters need to be annually calibrated and the International Organization for Standardization (ISO) has defined a standard method (ISO 9847) for calibrating these pyranometers. According to this standard method for outdoor calibration, the field pyranometers have to be compared to a reference pyranometer for the period of 2 to 14 days, depending on sky conditions. In this work, the ISO 9847 standard method was verified under tropical sky conditions. To verify the standard method, calibration of field pyranometers was conducted at a tropical site located in Nakhon Pathom (13.82o N, 100.04o E), Thailand under various sky conditions. The conditions of the sky were monitored by using a sky camera. The calibration results for different time periods used for the calibration under various sky conditions were analyzed. It was found that the calibration periods given by this standard method could be reduced without significant change in the final calibration result. In addition, recommendation and discussion on the use of this standard method in the tropics were also presented.
Roman-Duval, Julia; Bot, Caroline; Chastenet, Jeremy; Gordon, Karl
2017-06-01
Observations and modeling suggest that dust abundance (gas-to-dust ratio, G/D) depends on (surface) density. Variations of the G/D provide timescale constraints for the different processes involved in the life cycle of metals in galaxies. Recent G/D measurements based on Herschel data suggest a factor of 5-10 decrease in dust abundance between the dense and diffuse interstellar media (ISM) in the Magellanic Clouds. However, the relative nature of the Herschel measurements precludes definitive conclusions as to the magnitude of those variations. We investigate variations of the dust abundance in the LMC and SMC using all-sky far-infrared surveys, which do not suffer from the limitations of Herschel on their zero-point calibration. We stack the dust spectral energy distribution (SED) at 100, 350, 550, and 850 microns from IRAS and Planck in intervals of gas surface density, model the stacked SEDs to derive the dust surface density, and constrain the relation between G/D and gas surface density in the range 10-100 M ⊙ pc-2 on ˜80 pc scales. We find that G/D decreases by factors of 3 (from 1500 to 500) in the LMC and 7 (from 1.5× {10}4 to 2000) in the SMC between the diffuse and dense ISM. The surface-density-dependence of G/D is consistent with elemental depletions, and with simple modeling of the accretion of gas-phase metals onto dust grains. This result has important implications for the sub-grid modeling of galaxy evolution, and for the calibration of dust-based gas-mass estimates, both locally and at high redshift.
The first all-sky view of the Milky Way stellar halo with Gaia+2MASS RR Lyrae
Iorio, G.; Belokurov, V.; Erkal, D.; Koposov, S. E.; Nipoti, C.; Fraternali, F.
2018-02-01
We exploit the first Gaia data release to study the properties of the Galactic stellar halo as traced by RR Lyrae. We demonstrate that it is possible to select a pure sample of RR Lyrae using only photometric information available in the Gaia+2MASS catalogue. The final sample contains about 21 600 RR Lyrae covering an unprecedented fraction ( ˜ 60 per cent) of the volume of the Galactic inner halo (R < 28 kpc). We study the morphology of the stellar halo by analysing the RR Lyrae distribution with parametric and non-parametric techniques. Taking advantage of the uniform all-sky coverage, we test halo models more sophisticated than usually considered in the literature, such as those with varying flattening, tilts and/or offset of the halo with respect to the Galactic disc. A consistent picture emerges: the inner halo is well reproduced by a smooth distribution of stars settled on triaxial density ellipsoids. The shortest axis is perpendicular to the Milky Way's disc, while the longest axis forms an angle of ˜70° with the axis connecting the Sun and the Galactic Centre. The elongation along the major axis is mild (p = 1.27), and the vertical flattening is shown to evolve from a squashed state with q ≈ 0.57 in the centre to a more spherical q ≈ 0.75 at the outer edge of our data set. Within the radial range probed, the density profile of the stellar halo is well approximated by a single power law with exponent α = -2.96. We do not find evidence of tilt or offset of the halo with respect to the Galaxy's disc.
The Infrared Astronomical Satellite /IRAS/ Scientific Data Analysis System /SDAS/ sky flux subsystem
Stagner, J. R.; Girard, M. A.
1980-01-01
The sky flux subsystem of the Infrared Astronomical Satellite Scientific Data Analysis System is described. Its major output capabilities are (1) the all-sky lune maps (8-arcminute pixel size), (2) galactic plane maps (2-arcminute pixel size) and (3) regional maps of small areas such as extended sources greater than 1-degree in extent. The major processing functions are to (1) merge the CRDD and pointing data, (2) phase the detector streams, (3) compress the detector streams in the in-scan and cross-scan directions, and (4) extract data. Functional diagrams of the various capabilities of the subsystem are given. Although this device is inherently nonimaging, various calibrated and geometrically controlled imaging products are created, suitable for quantitative and qualitative scientific interpretation.
Radiative sky cooling: fundamental physics, materials, structures, and applications
Directory of Open Access Journals (Sweden)
Sun Xingshu
2017-07-01
Full Text Available Radiative sky cooling reduces the temperature of a system by promoting heat exchange with the sky; its key advantage is that no input energy is required. We will review the origins of radiative sky cooling from ancient times to the modern day, and illustrate how the fundamental physics of radiative cooling calls for a combination of properties that may not occur in bulk materials. A detailed comparison with recent modeling and experiments on nanophotonic structures will then illustrate the advantages of this recently emerging approach. Potential applications of these radiative cooling materials to a variety of temperature-sensitive optoelectronic devices, such as photovoltaics, thermophotovoltaics, rectennas, and infrared detectors, will then be discussed. This review will conclude by forecasting the prospects for the field as a whole in both terrestrial and space-based systems.
Hawaiian Starlight: Sharing the Beauty of the Hawaiian Skies
Cuillandre, J. C.
Canada-France-Hawaii Telescope Corp. The summit of Mauna Kea (14,000 feet) offers the best viewing of the Cosmos in the northern hemisphere, and the film "Hawaiian Starlight" delivers a pure esthetic experience from the mountain into the Universe. Seven years in the making, this cinematic symphony reveals the spectacular beauty of the mountain and its connection to the Cosmos through the magical influence of time-lapse cinematography scored exclusively (no narration) with the awe-inspiring, critically acclaimed, Halo music by Martin O'Donnell and Michael Salvatori. Daytime and nighttime landscapes and skyscapes alternate with stunning true color images of the Universe captured by an observatory on Mauna Kea, all free of any computer generated imagery. An extended segment of the film will be presented at the Advanced Maui Optical and Space Surveillance Technologies Conference to celebrate the international year of Astronomy 2009, a global effort initiated by the IAU (International Astronomical Union) and UNESCO (United Nations Educational, Scientific and Cultural Organization) to help the citizens of the world rediscover their place in the Universe through the day- and night-time sky, and thereby engage a personal sense of wonder and discovery. Hawaiian Starlight is true to this commitment. The inspiration and technology of the film will be shortly presented by the film's director.
EGG: Empirical Galaxy Generator
Schreiber, C.; Elbaz, D.; Pannella, M.; Merlin, E.; Castellano, M.; Fontana, A.; Bourne, N.; Boutsia, K.; Cullen, F.; Dunlop, J.; Ferguson, H. C.; MichaÅowski, M. J.; Okumura, K.; Santini, P.; Shu, X. W.; Wang, T.; White, C.
2018-04-01
The Empirical Galaxy Generator (EGG) generates fake galaxy catalogs and images with realistic positions, morphologies and fluxes from the far-ultraviolet to the far-infrared. The catalogs are generated by egg-gencat and stored in binary FITS tables (column oriented). Another program, egg-2skymaker, is used to convert the generated catalog into ASCII tables suitable for ingestion by SkyMaker (ascl:1010.066) to produce realistic high resolution images (e.g., Hubble-like), while egg-gennoise and egg-genmap can be used to generate the low resolution images (e.g., Herschel-like). These tools can be used to test source extraction codes, or to evaluate the reliability of any map-based science (stacking, dropout identification, etc.).
Detecting new γ-ray sources based on multi-frequency data the case of 1WHSPJ031423.9+061956
Arsioli, Bruno; Chang, Yu Ling
2015-12-01
We use the Fermi Science Tools in an attempt to unveil faint γ-ray blazars that may be above the threshold for detectability with Fermi-LAT and are not identified by automated methods. Our search for new sources in the 100MeV-300GeV band is mainly driven by the 1/2WHSP catalogs, which list high synchrotron peaked blazars expected to be emitters of VHE photons. Here we present the γ-ray detection of 1WHSP J031423.9+061956, modelling its high energy spectrum as a power law. We describe an example where multi-frequency selection, performed at much lower energies (from radio to X-ray), helps to pin-point a high energy source. The 1/2WHSP catalogs are built with the aim of providing a list of TeV targets for the VHE arrays of Cherenkov telescopes. Moreover, these catalogs provide useful seeds for identifying new high energy sources within the raw-data from Fermi. With the aid of multi-frequency data, we can explore the very high energy domain in greater details, improving the description of the γ-ray sky.
Pilots 2.0: DIRAC pilots for all the skies
Stagni, F; McNab, A; Luzzi, C
2015-01-01
In the last few years, new types of computing infrastructures, such as IAAS (Infrastructure as a Service) and IAAC (Infrastructure as a Client), gained popularity. New resources may come as part of pledged resources, while others are opportunistic. Most of these new infrastructures are based on virtualization techniques. Meanwhile, some concepts, such as distributed queues, lost appeal, while still supporting a vast amount of resources. Virtual Organizations are therefore facing heterogeneity of the available resources and the use of an Interware software like DIRAC to hide the diversity of underlying resources has become essential. The DIRAC WMS is based on the concept of pilot jobs that was introduced back in 2004. A pilot is what creates the possibility to run jobs on a worker node. Within DIRAC, we developed a new generation of pilot jobs, that we dubbed Pilots 2.0. Pilots 2.0 are not tied to a specific infrastructure; rather they are generic, fully configurable and extendible pilots. A Pilot 2.0 can be s...
SOUTH POL: Revealing the Polarized Southern Sky
Magalhaes, Antonio Mario Mario; Ramírez, Edgar; Ribeiro, Nadili; Seriacopi, Daiane; Rubinho, Marcelo; Ferrari, Tiberio; Rodrigues, Claudia; Schoenell, William; Herpich, Fabio; Pereyra, Antonio
2018-01-01
SOUTH POL will be a survey of the Southern sky in optical polarized light. It will use a newly built polarimeter for T80-S, an 84 cm robotic telescope installed at Cerro Tololo (CTIO), Chile. It will initially cover the sky South of declination -15 deg with a polarimetric accuracy Solar System.The polarimeter has just been commissioned in mid-November, 2017. The data reduction pipeline has already been built. We will describe the instrument and the data reduction, as well as a few of the science cases. The survey is expected to begin midway through the 1st semester of 2018. Both catalog data and raw images will be made available.
40 CFR 1048.140 - What are the provisions for certifying Blue Sky Series engines?
2010-07-01
... Blue Sky Series engines? 1048.140 Section 1048.140 Protection of Environment ENVIRONMENTAL PROTECTION... Sky Series engines? This section defines voluntary standards for a recognized level of superior emission control for engines designated as “Blue Sky Series” engines. If you certify an engine family under...
Integration of polarization and chromatic cues in the insect sky compass.
el Jundi, Basil; Pfeiffer, Keram; Heinze, Stanley; Homberg, Uwe
2014-06-01
Animals relying on a celestial compass for spatial orientation may use the position of the sun, the chromatic or intensity gradient of the sky, the polarization pattern of the sky, or a combination of these cues as compass signals. Behavioral experiments in bees and ants, indeed, showed that direct sunlight and sky polarization play a role in sky compass orientation, but the relative importance of these cues are species-specific. Intracellular recordings from polarization-sensitive interneurons in the desert locust and monarch butterfly suggest that inputs from different eye regions, including polarized-light input through the dorsal rim area of the eye and chromatic/intensity gradient input from the main eye, are combined at the level of the medulla to create a robust compass signal. Conflicting input from the polarization and chromatic/intensity channel, resulting from eccentric receptive fields, is eliminated at the level of the anterior optic tubercle and central complex through internal compensation for changing solar elevations, which requires input from a circadian clock. Across several species, the central complex likely serves as an internal sky compass, combining E-vector information with other celestial cues. Descending neurons, likewise, respond both to zenithal polarization and to unpolarized cues in an azimuth-dependent way.
Sky-Radiance Models for Monte Carlo Radiative Transfer Applications
Santos, I.; Dalimonte, D.; Santos, J. P.
2012-04-01
Photon-tracing can be initialized through sky-radiance (Lsky) distribution models when executing Monte Carlo simulations for ocean color studies. To be effective, the Lsky model should: 1) properly represent sky-radiance features of interest; 2) require low computing time; and 3) depend on a limited number of input parameters. The present study verifies the satisfiability of these prerequisite by comparing results from different Lsky formulations. Specifically, two Lsky models were considered as reference cases because of their different approach among solutions presented in the literature. The first model, developed by the Harrisson and Coombes (HC), is based on a parametric expression where the sun geometry is the unique input. The HC model is one of the sky-radiance analytical distribution applied in state-of-art simulations for ocean optics. The coefficients of the HC model were set upon broad-band field measurements and the result is a model that requires a few implementation steps. The second model, implemented by Zibordi and Voss (ZV), is based on physical expressions that accounts for the optical thickness of permanent gases, aerosol, ozone and water vapour at specific wavelengths. Inter-comparisons between normalized ^LskyZV and ^LskyHC (i.e., with unitary scalar irradiance) are discussed by means of individual polar maps and percent difference between sky-radiance distributions. Sky-radiance cross-sections are presented as well. Considered cases include different sun zenith values and wavelengths (i.e., λ=413, 490 and 665 nm, corresponding to selected center-bands of the MEdium Resolution Imaging Spectrometer MERIS). Results have shown a significant convergence between ^LskyHC and ^LskyZV at 665 nm. Differences between models increase with the sun zenith and mostly with wavelength. For Instance, relative differences up to 50% between ^ L skyHC and ^ LskyZV can be observed in the antisolar region for λ=665 nm and θ*=45°. The effects of these
Polarization of sky light from a canopy atmosphere
International Nuclear Information System (INIS)
Hannay, J H
2004-01-01
Light from the clear sky is produced by the scattering of unpolarized sunlight by molecules of the atmosphere and is partially linearly polarized in the process. Singly scattered light, for instance, is fully polarized in viewing directions perpendicular to the sun direction and less and less so towards the parallel and antiparallel directions, where it is unpolarized. The true, multiple, scattering is much less tractable, but importantly different, changing the polarization pattern's topology by splitting the unpolarized directions into pairs. The underlying cause of this 'symmetry breaking' is that the atmosphere is 'wider' than it is deep. Simplifying as much as possible while retaining this feature leads to the caricature atmosphere analysed here: a flattened sheet atmosphere in the sky, a canopy. The multiple scattering is fully tractable and leads to a simple polarization pattern in the sky: the ellipses and hyperbolas of standard confocal ellipsoidal coordinates. The model realizes physically a mathematical pattern of polarization in terms of a complex function proposed by Berry, Dennis and Lee (2004 New J. Phys.6 162) as the simplest one which captures the topology
The gamma-ray sky as seen with HAWC
Hüntemeyer, Petra
2015-12-01
The High-Altitude Water Cherenkov (HAWC) TeV Gamma-Ray Observatory located at a site about two hours drive east of Puebla, Mexico on the Sierra Negra plateau (4100 m a.s.l.) was inaugurated in March 2015. The array of 300 water Cherenkov detectors can observe large portions of the sky simultaneously and, with an energy range of 100 GeV to 100 TeV, is currently one of the most sensitive instruments capable of probing particle acceleration near PeV energies. HAWC has already started science operation in the Summer of 2013 and preliminary sky maps have been produced from 260 days of data taken with a partial array. Multiple > 5 σ (pre-trials) hotspots are visible along the galactic plane and some appear to coincide with known TeV sources from the H.E.S.S. catalog, SNRs and molecular cloud associations, and pulsars wind nebulae (PWNe). The sky maps based on partial HAWC array data are discussed as well as the scientific potential of the completed instrument especially in the context of multi-wavelengths studies.
Variable gamma-ray sky at 1 GeV
International Nuclear Information System (INIS)
Pshirkov, M. S.; Rubtsov, G. I.
2013-01-01
We search for the long-term variability of the gamma-ray sky in the energy range E > 1 GeV with 168 weeks of the gamma-ray telescope Fermi-LAT data. We perform a full sky blind search for regions with variable flux looking for deviations from uniformity. We bin the sky into 12288 pixels using the HEALPix package and use the Kolmogorov-Smirnov test to compare weekly photon counts in each pixel with the constant flux hypothesis. The weekly exposure of Fermi-LAT for each pixel is calculated with the Fermi-LAT tools. We consider flux variations in a pixel significant if the statistical probability of uniformity is less than 4 × 10 −6 , which corresponds to 0.05 false detections in the whole set. We identified 117 variable sources, 27 of which have not been reported variable before. The sources with previously unidentified variability contain 25 active galactic nuclei (AGN) belonging to the blazar class (11 BL Lacs and 14 FSRQs), one AGN of an uncertain type, and one pulsar PSR J0633+1746 (Geminga).
Kinesthetic Astronomy: Significant Upgrades to the Sky Time Lesson that Support Student Learning
Morrow, C. A.; Zawaski, M.
2004-12-01
This paper will report on a significant upgrade to the first in a series of innovative, experiential lessons we call Kinesthetic Astronomy. The Sky Time lesson reconnects students with the astronomical meaning of the day, year, and seasons. Like all Kinesthetic Astronomy lessons, it teaches basic astronomical concepts through choreographed bodily movements and positions that provide educational sensory experiences. They are intended for sixth graders up through adult learners in both formal and informal educational settings. They emphasize astronomical concepts and phenomenon that people can readily encounter in their "everyday" lives such as time, seasons, and sky motions of the Sun, Moon, stars, and planets. Kinesthetic Astronomy lesson plans are fully aligned with national science education standards, both in content and instructional practice. Our lessons offer a complete learning cycle with written assessment opportunities now embedded throughout the lesson. We have substantially strengthened the written assessment options for the Sky Time lesson to help students translate their kinesthetic and visual learning into the verbal-linguistic and mathematical-logical realms of expression. Field testing with non-science undergraduates, middle school science teachers and students, Junior Girl Scouts, museum education staff, and outdoor educators has been providing evidence that Kinesthetic Astronomy techniques allow learners to achieve a good grasp of concepts that are much more difficult to learn in more conventional ways such as via textbooks or even computer animation. Field testing of the Sky Time lesson has also led us to significant changes from the previous version to support student learning. We will report on the nature of these changes.
SkyQuery - A Prototype Distributed Query and Cross-Matching Web Service for the Virtual Observatory
Thakar, A. R.; Budavari, T.; Malik, T.; Szalay, A. S.; Fekete, G.; Nieto-Santisteban, M.; Haridas, V.; Gray, J.
2002-12-01
We have developed a prototype distributed query and cross-matching service for the VO community, called SkyQuery, which is implemented with hierarchichal Web Services. SkyQuery enables astronomers to run combined queries on existing distributed heterogeneous astronomy archives. SkyQuery provides a simple, user-friendly interface to run distributed queries over the federation of registered astronomical archives in the VO. The SkyQuery client connects to the portal Web Service, which farms the query out to the individual archives, which are also Web Services called SkyNodes. The cross-matching algorithm is run recursively on each SkyNode. Each archive is a relational DBMS with a HTM index for fast spatial lookups. The results of the distributed query are returned as an XML DataSet that is automatically rendered by the client. SkyQuery also returns the image cutout corresponding to the query result. SkyQuery finds not only matches between the various catalogs, but also dropouts - objects that exist in some of the catalogs but not in others. This is often as important as finding matches. We demonstrate the utility of SkyQuery with a brown-dwarf search between SDSS and 2MASS, and a search for radio-quiet quasars in SDSS, 2MASS and FIRST. The importance of a service like SkyQuery for the worldwide astronomical community cannot be overstated: data on the same objects in various archives is mapped in different wavelength ranges and looks very different due to different errors, instrument sensitivities and other peculiarities of each archive. Our cross-matching algorithm preforms a fuzzy spatial join across multiple catalogs. This type of cross-matching is currently often done by eye, one object at a time. A static cross-identification table for a set of archives would become obsolete by the time it was built - the exponential growth of astronomical data means that a dynamic cross-identification mechanism like SkyQuery is the only viable option. SkyQuery was funded by a
Pazmino, John
In previous demonstrations of New York's elimination of luminous graffiti from its skies, I focused attention on large-scale projects in the showcase districts of Manhattan. Although these works earned passionate respect in the dark sky movement, they by the same token were disheartening. New York was in some quarters of the movement regarded more as an unachievable Shangri-La than as a role model to emulate. This presentation focuses on scenes of light abatement efforts in parts of New York which resemble other towns in scale and density. I photographed these scenes along a certain bus route in Brooklyn on my way home from work during October 2001. This route circulates through various "bedroom communities," each similar to a mid-size to large town elsewhere in the United States. The sujbects included individual structures - stores, banks, schools - and streetscapes mimicking downtowns. The latter protrayed a mix of atrocious and excellent lighting practice, being that these streets are in transition by the routine process of replacement and renovation. The fixtures used - box lamps, fluted or Fresnel globes, subdued headsigns, indirect lighting - are casually obtainable by property managers at local outlets for lighting apparatus. They are routinely offered to the property managers by storefront designers, security services, contractors, and the community improvement or betterment councils.
Sky brightness and color measurements during the 21 August 2017 total solar eclipse.
Bruns, Donald G; Bruns, Ronald D
2018-06-01
The sky brightness was measured during the partial phases and during totality of the 21 August 2017 total solar eclipse. A tracking CCD camera with color filters and a wide-angle lens allowed measurements across a wide field of view, recording images every 10 s. The partially and totally eclipsed Sun was kept behind an occulting disk attached to the camera, allowing direct brightness measurements from 1.5° to 38° from the Sun. During the partial phases, the sky brightness as a function of time closely followed the integrated intensity of the unobscured fraction of the solar disk. A redder sky was measured close to the Sun just before totality, caused by the redder color of the exposed solar limb. During totality, a bluer sky was measured, dimmer than the normal sky by a factor of 10,000. Suggestions for enhanced measurements at future eclipses are offered.
Towards the intrahour forecasting of direct normal irradiance using sky-imaging data.
Nou, Julien; Chauvin, Rémi; Eynard, Julien; Thil, Stéphane; Grieu, Stéphane
2018-04-01
Increasing power plant efficiency through improved operation is key in the development of Concentrating Solar Power (CSP) technologies. To this end, one of the most challenging topics remains accurately forecasting the solar resource at a short-term horizon. Indeed, in CSP plants, production is directly impacted by both the availability and variability of the solar resource and, more specifically, by Direct Normal Irradiance (DNI). The present paper deals with a new approach to the intrahour forecasting (the forecast horizon [Formula: see text] is up to [Formula: see text] ahead) of DNI, taking advantage of the fact that this quantity can be split into two terms, i.e. clear-sky DNI and the clear sky index. Clear-sky DNI is forecasted from DNI measurements, using an empirical model (Ineichen and Perez, 2002) combined with a persistence of atmospheric turbidity. Moreover, in the framework of the CSPIMP (Concentrating Solar Power plant efficiency IMProvement) research project, PROMES-CNRS has developed a sky imager able to provide High Dynamic Range (HDR) images. So, regarding the clear-sky index, it is forecasted from sky-imaging data, using an Adaptive Network-based Fuzzy Inference System (ANFIS). A hybrid algorithm that takes inspiration from the classification algorithm proposed by Ghonima et al. (2012) when clear-sky anisotropy is known and from the hybrid thresholding algorithm proposed by Li et al. (2011) in the opposite case has been developed to the detection of clouds. Performance is evaluated via a comparative study in which persistence models - either a persistence of DNI or a persistence of the clear-sky index - are included. Preliminary results highlight that the proposed approach has the potential to outperform these models (both persistence models achieve similar performance) in terms of forecasting accuracy: over the test data used, RMSE (the Root Mean Square Error) is reduced of about [Formula: see text], with [Formula: see text], and [Formula: see
Visual astronomy under dark skies a new approach to observing deep space
Cooke, Antony
2005-01-01
Modern astronomical telescopes, along with other advances in technology, have brought the deep sky - star clusters, nebulae and the galaxies - within reach of amateur astronomers. And it isn't even necessary to image many of these deep-sky objects in order to see them; they are within reach of visual observers using modern techniques and enhancement technology. The first requirement is truly dark skies; if you are observing from a light-polluted environment you need Tony Cooke's book, Visual Astronomy in the Suburbs. Given a site with clear, dark night skies everything else follows… this book will provide the reader with everything he needs to know about what to observe, and using some of today's state-of-the-art technique and commercial equipment, how to get superb views of faint and distant astronomical objects.
The Second Data Release of the Sloan Digital Sky Survey
Abazajian, Kevork; ̈ueros, Marcel A. Ag; Allam, Sahar S.; Anderson, KurtS. J.; Anderson, Scott F.; Annis, James; Bahcall, Neta A.; Baldry, Ivan K.; StevenBastian; Berlind, Andreas; Bernardi, Mariangela; Blanton, Michael R.; BochanskiJr., John J.; Boroski, William N.; Briggs, John W.; Brinkmann, J.; Brunner, Robert J.; ́ari, Tam ́asBudav; Carey, Larry N.; Carliles, Samuel; Castander, Francisco J.; Connolly, A. J.; Csabai, Istvan; Doi, Mamoru; Dong, Feng; Eisenstein, Daniel J.; Evans, Michael L.; Fan, Xiaohui; Finkbeiner, Douglas P.; Friedman, Scott D.; Frieman, Joshua A.; Fukugita, Masataka; Gal, RoyR.; Gillespie, Bruce; Glazebrook, Karl; Gray, Jim; Grebel, Eva K.; Gunn, James E.; Gurbani, Vijay K.; Hall, Patrick B.; Hamabe, Masaru; Harris, Frederick H.; C.Harris, Hugh; Harvanek, Michael; Heckman, Timothy M.; Hendry, John S.; Hennessy, Gregory S.; Hindsley, Robert B.; Hogan, Craig J.; Hogg, David W.; Holmgren, Donald J.; Ichikawa, Shin-ichi; Ichikawa, Takashi; Ivezic, Zeljko; Jester, Sebastian; Johnston, David E.; Jorgensen, AndersM.; Kent, Stephen M.; Kleinman, S. J.; Knapp, G. R.; Kniazev, Alexei Yu.; Kron, Richard G.; Krzesinski, Jurek; Kunszt, Peter Z.; Kuropatkin, Nickolai; Q.Lamb, Donald; Lampeitl, Hubert; Lee, Brian C.; Leger, R. French; Li, Nolan; Lin, Huan; Loh, Yeong-Shang; Long, Daniel C.; Loveday, Jon; Lupton, Robert H.; Malik, Tanu; BruceMargon; Matsubara, Takahiko; McGehee, Peregrine M.; McKay, Timothy A.; AveryMeiksin; Munn, Jeffrey A.; Nakajima, Reiko; Nash, Thomas; Neilsen, Eric H. Jr.; JoNewberg, Heidi; Newman, Peter R.; Nichol, Robert C.; Nicinski, Tom; Nieto-Santisteban, Maria; Nitta, Atsuko; Okamura, Sadanori; O'Mullane, William; Ostriker, Jeremiah P.; Owen, Russell; Padmanabhan, Nikhil; Peoples, John; Pier, Jeffrey R.; Pope, Adrian C.; Quinn, Thomas R.; Richards, Gordon T.; Richmond, Michael W.; Rix, Hans-Walter; Rockosi, Constance M.; Schlegel, David J.; Schneider, Donald P.; Scranton, Ryan; Sekiguchi, Maki; Seljak, Uros; Sergey, Gary; Sesar, Branimir; Sheldon, Erin; Shimasaku, Kazu; Siegmund, Walter A.; Silvestri, Nicole M.; Smith, J. Allyn; ́c, Vernesa Smolči; Snedden, Stephanie A.; AlbertStebbins; Stoughton, Chris; Strauss, Michael A.; SubbaRao, Mark; Szalay, Alexander S.; Szapudi, Istv ́an; Szkody, Paula; Szokoly, Gyula P.; Tegmark, Max; Teodoro, Luis; Thakar, AniruddhaR.; Tremonti, Christy; Tucker, Douglas L.; Uomoto, Alan; Vanden Berk, Daniel E.; Vandenberg, Jan; Vogeley, Michael S.; Voges, Wolfgang; Vogt, Nicole P.; M.Walkowicz, Lucianne; Wang, Shu-i; Weinberg, David H.; West, Andrew A.; White, Simon D.M.; Wilhite, BrianC.; Xu, Yongzhong; Yanny, Brian; Yasuda, Naoki; Yip, Ching-Wa; Yocum, D. R.; York, Donald G.; Zehavi, Idit; Zibetti, Stefano; Zucker, Daniel B.
2004-01-01
The Sloan Digital Sky Survey has validated and made publicly available its Second Data Release. This data release consists of 3324 square degrees of five-band (u g r i z) imaging data with photometry for over 88 million unique objects, 367,360 spectra of galaxies, quasars, stars and calibrating blank sky patches selected over 2627 degrees of this area, and tables of measured parameters from these data. The imaging data reach a depth of r ~ 22.2 (95% completeness limit for point sources) and are photometrically and astrometrically calibrated to 2% rms and 100 milli-arcsec rms per coordinate, respectively. The imaging data have all been processed through a new version of the SDSS imaging pipeline, in which the most important improvement since the last data release is fixing an error in the model fits to each object. The result is that model magnitudes are now a good proxy for point spread function (PSF) magnitudes for point sources, and Petrosian magnitudes for extended sources. The spectroscopy extends from 38...
The Sloan Digital Sky Survey: Status and prospects
Energy Technology Data Exchange (ETDEWEB)
Loveday, J.; SDSS Collaboration
1996-05-01
The Sloan Digital Sky Survey (SDSS) is a project to definitively map {pi} steradians of the local Universe. An array of CCD detectors used in drift-scan mode will digitally image the sky in five passbands to a limiting magnitude of r{prime} {approximately} 23. Selected from the imaging survey, 10{sup 6} galaxies and 10{sup 5} quasars will be observed spectroscopically. I describe the current status of the survey, which is due to begin observations early in 1997, and its prospects for constraining models for dark matter in the Universe. 8 refs., 7 figs.
Energy Technology Data Exchange (ETDEWEB)
Rana, Javed; Singhal, Akshat; Gadre, Bhooshan; Bhalerao, Varun; Bose, Sukanta, E-mail: javed@iucaa.in [Inter-University Centre for Astronomy and Astrophysics, Post Bag 4, Ganeshkhind, Pune 411 007 (India)
2017-04-01
The discovery and subsequent study of optical counterparts to transient sources is crucial for their complete astrophysical understanding. Various gamma-ray burst (GRB) detectors, and more notably the ground-based gravitational wave detectors, typically have large uncertainties in the sky positions of detected sources. Searching these large sky regions spanning hundreds of square degrees is a formidable challenge for most ground-based optical telescopes, which can usually image less than tens of square degrees of the sky in a single night. We present algorithms for better scheduling of such follow-up observations in order to maximize the probability of imaging the optical counterpart, based on the all-sky probability distribution of the source position. We incorporate realistic observing constraints such as the diurnal cycle, telescope pointing limitations, available observing time, and the rising/setting of the target at the observatory’s location. We use simulations to demonstrate that our proposed algorithms outperform the default greedy observing schedule used by many observatories. Our algorithms are applicable for follow-up of other transient sources with large positional uncertainties, such as Fermi -detected GRBs, and can easily be adapted for scheduling radio or space-based X-ray follow-up.
Ward, Tony J.; Delaloye, Naomi; Adams, Earle Raymond; Ware, Desirae; Vanek, Diana; Knuth, Randy; Hester, Carolyn Laurie; Marra, Nancy Noel; Holian, Andrij
2016-01-01
"Air Toxics Under the Big Sky" is an environmental science outreach/education program that incorporates the Next Generation Science Standards (NGSS) 8 Practices with the goal of promoting knowledge and understanding of authentic scientific research in high school classrooms through air quality research. This research explored: (1)…
A Study of Sasin-Animal Sky Map on Chonmunryucho
Directory of Open Access Journals (Sweden)
Hong-Jin Yang
2003-03-01
Full Text Available Chon-Mun-Ryu-Cho, written (edited by Lee Sun-Ji during the period of King Se-Jong, is a representative astronomy book of Cho-Sun (A.D. 1392 -1910 Dynasty. We find and study in the first page of the book; the description of 28 oriental constellations as a Sasin (four mythical oriental animals-animal sky map which is not widely known yet. The map consists of four groups of constellations, each of which represents the Sasin: Chang-Ryong (dragon, Baek-Ho (tigers with Ki-Rin [Oriental giraffe], Ju-Jak (Chinese phoenix, Hyun-Mu (a tortoise interwined with a snake. Each group (animals spans 2˜7 of 28 oriental constellations As we know from the illustration of the Chon-Sang-Yol-Cha-Bun-Ya-Ji-Do a representative sky map of Cho-Sun Dynasty, astronomy in Cho-Sun Dynasty is closely related to that in Go-Gu-Ryer (B.C. 37 -A.D. 668 Dynasty. Since these Sasin-animals appear in most mural paintings of Go-Gu-Ryer tombs, visualization of sky with these animal constellations could have been established as early as in Go-Gu-Ryer Dynasty. We also reconstruct this ''A Sasin-animal Korean sky map'' based on the shapes of the Sasin and Ki-Rin from Go-Gu-Ryer paintings and 28 oriental constellations in Chon-Sang-Yol-Cha-Bun-Ya-Ji-Do.
Anisotropy in the Microwave Sky at 90 GHz: Results From Python III
Platt, S. R.; Kovac, J.; Dragovan, M.; Peterson, J. B.; Ruhl, J. E.
1996-01-01
The third year of observations with the Python microwave background experiment densely sample a $5.5^o\\times 22^o$ region of sky that includes the fields measured during the first two years of observations with this instrument. The sky is sampled in two multipole bands centered at $l \\approx 92$ and $l \\approx 177$. These two data sets are analyzed to place limits on fluctuations in the microwave sky at 90 GHz. Interpreting the observed fluctuations as anisotropy in the cosmic microwave backg...
Losing Sleep to Watch the Night-Sky: The Relationship between Sleep-Length and Noctcaelador
Kelly, William E.; Rose, Callie
2005-01-01
For most of history, humans have been watching the night-sky (Hawkins, 1983). Historically, individuals have watched the night-sky for aesthetic appreciation and to gain insights and knowledge (Brecher & Feirtag, 1979). Despite the long history of night-sky watching among humans and the apparent importance of the behavior to large groups of…
Dark Skies are a Universal Resource: Programs Planned for the International Year of Astronomy
Walker, Constance E.; US IYA Dark Skies Working Group
2008-05-01
The dark night sky is a natural resource that is being lost by much of the world's population. This loss is a growing, serious issue that impacts not only astronomical research, but also human health, ecology, safety, economics and energy conservation. One of the themes of the US Node targeted for the International Year of Astronomy (IYA) is "Dark Skies are a Universal Resource". The goal is to raise public awareness of the impact of artificial lighting on local environments by getting people involved locally in a variety of dark skies-related events. To reach this goal, activities are being developed that: 1) Teach about dark skies using new technology (e.g., an activity-based planetarium show on DVD, podcasting, social networking) 2) Provide thematic events on light pollution at star parties and observatory open houses (Dark Skies Teaching Sites, Astronomy Nights in the (National) Parks, Sidewalk Astronomy Nights) 3) Organize events in the arts (e.g., a photography contest) 4) Involve citizen-scientists in unaided-eye and digital-meter star counting programs (e.g., GLOBE at Night, "How Many Stars?” and the Great World Wide Star Count) and 5) Raise awareness about the link between light pollution and public health, economic issues, ecological consequences, energy conservation, safety and security (e.g., The Great Switch Out, Earth Hour, National Dark Skies Week, traveling exhibits and a 6-minute video tutorial on lighting issues). To deliver these programs, strategic networks have been established with the ASP's Night Sky Network's astronomy clubs, Astronomy from the Ground Up's science and nature centers and the Project and Family ASTRO programs, as well as the International Dark-Sky Association, GLOBE and the Astronomical League, among others. The poster presentation will outline the activities being developed, the plans for funding, implementation, marketing and the connections to the global cornerstone IYA project, "Dark Skies Awareness".
Dark Skies Awareness Programs for the International Year of Astronomy
Walker, Constance E.; US IYA Dark Skies Working Group
2009-05-01
The arc of the Milky Way seen from a truly dark location is part of our planet's cultural and natural heritage. More than 1/5 of the world population, 2/3 of the United States population and 1/2 of the European Union population have already lost naked-eye visibility of the Milky Way. This loss, caused by light pollution, is a serious and growing issue that impacts astronomical research, the economy, ecology, energy conservation, human health, public safety and our shared ability to see the night sky. For this reason, "Dark Skies” is a cornerstone project of the International Year of Astronomy. Its goal is to raise public awareness of the impact of artificial lighting on local environments by getting people worldwide involved in a variety of programs that: 1) Teach about dark skies using new technology (e.g., an activity-based planetarium show on DVD, podcasting, social networking on Facebook and MySpace, a Second Life presence) 2) Provide thematic events on light pollution at star parties and observatory open houses (Dark Skies Discovery Sites, Nights in the (National) Parks, Sidewalk Astronomy) 3) Organize events in the arts (e.g., a photography contest) 4) Involve citizen-scientists in naked-eye and digital-meter star hunting programs (e.g., GLOBE at Night, "How Many Stars?", the Great World Wide Star Count and the radio frequency interference equivalent: "Quiet Skies") and 5) Raise awareness about the link between light pollution and public health, economic issues, ecological consequences, energy conservation, safety and security, and astronomy (e.g., The Starlight Initiative, World Night in Defense of Starlight, International Dark Sky Week, International Dark-Sky Communities, Earth Hour, The Great Switch Out, a traveling exhibit, downloadable posters and brochures). The poster will provide an update, describe how people can continue to participate, and take a look ahead at the program's sustainability. For more information, visit www.darkskiesawareness.org.
Photometric Assessment of Night Sky Quality over Chaco Culture National Historical Park
Hung, Li-Wei; Duriscoe, Dan M.; White, Jeremy M.; Meadows, Bob; Anderson, Sharolyn J.
2018-06-01
The US National Park Service (NPS) characterizes night sky conditions over Chaco Culture National Historical Park using measurements in the park and satellite data. The park is located near the geographic center of the San Juan Basin of northwestern New Mexico and the adjacent Four Corners state. In the park, we capture a series of night sky images in V-band using our mobile camera system on nine nights from 2001 to 2016 at four sites. We perform absolute photometric calibration and determine the image placement to obtain multiple 45-million-pixel mosaic images of the entire night sky. We also model the regional night sky conditions in and around the park based on 2016 VIIRS satellite data. The average zenith brightness is 21.5 mag/arcsec2, and the whole sky is only ~16% brighter than the natural conditions. The faintest stars visible to naked eyes have magnitude of approximately 7.0, reaching the sensitivity limit of human eyes. The main impacts to Chaco’s night sky quality are the light domes from Albuquerque, Rio Rancho, Farmington, Bloomfield, Gallup, Santa Fe, Grants, and Crown Point. A few of these light domes exceed the natural brightness of the Milky Way. Additionally, glare sources from oil and gas development sites are visible along the north and east horizons. Overall, the night sky quality at Chaco Culture National Historical Park is very good. The park preserves to a large extent the natural illumination cycles, providing a refuge for crepuscular and nocturnal species. During clear and dark nights, visitors have an opportunity to see the Milky Way from nearly horizon to horizon, complete constellations, and faint astronomical objects and natural sources of light such as the Andromeda Galaxy, zodiacal light, and airglow.
International Nuclear Information System (INIS)
Gruen, M.; Koubsky, P.
1977-01-01
The history is described of the discoveries of X-ray sources in the sky. The individual X-ray detectors are described in more detail, i.e., gas counters, scintillation detectors, semiconductor detectors, and the principles of X-ray spectrometry and of radiation collimation aimed at increased resolution are discussed. Currently, over 200 celestial X-ray sources are known. Some were identified as nebulae, in some pulsations were found or the source was identified as a binary star. X-ray bursts of novae were also observed. The X-ray radiation is briefly mentioned of spherical star clusters and of extragalactic X-ray sources. (Oy)
Vázquez Ramió, H.; Díaz-Martín, M. C.; Varela, J.; Ederoclite, A.; Maícas, N. Lamadrid, J. L.; Abril, J.; Iglesias-Marzoa, R.; Rodríguez, S.; Tilve, V.; Cenarro, A. J.; Antón Bravo, J. L.; Bello Ferrer, R.; Cristóbal-Hornillos, D.; Guillén Civera, L.; Hernández-Fuertes, J.; Jiménez Mejías, D.; Lasso-Cabrera, N. M.; López Alegre, G.; López Sainz, A.; Luis-Simoes, R. M.; Marín-Franch, A.; Moles, M.; Rueda-Teruel, F.; Rueda-Teruel, S.; Suárez López, O.; Yanes-Díaz, A.
2015-05-01
The Javalambre-Physics of the Accelerating Universe Astrophysical Survey (J-PAS; see Benítez et al. 2014) and the Javalambre-Photometric Local Universe Survey (J-PLUS) will be conducted at the brand-new Observatorio Astrofísico de Javalambre (OAJ) in Teruel, Spain. J-PLUS is planned to start by the first half of 2015 while J-PAS first light is expected to happen along 2015. Besides the two main telescopes (with 2.5 m and 80 cm apertures), several smaller-sized facilities are present at the OAJ devoted to site characterization and supporting measurements to be used to calibrate the J-PAS and J-PLUS photometry and to feed up the OAJ's Sequencer with the integrated seeing and the sky transparency. These instruments are: i) an extinction monitor, an 11 " telescope estimating the atmospheric extinction to finally obtain the OAJ extinction curve, which is the initial step to J-PAS overall photometric calibration procedure; ii) an 8 " telescope implementing the Differential Image Motion Monitor (DIMM) technique to obtain the integrated seeing; and iii) an All-Sky Transmission MONitor (ASTMON), a roughly all-sky instrument providing the sky transparency as well as sky brightness and the atmospheric extinction too.
CMB spectra and bispectra calculations: making the flat-sky approximation rigorous
International Nuclear Information System (INIS)
Bernardeau, Francis; Pitrou, Cyril; Uzan, Jean-Philippe
2011-01-01
This article constructs flat-sky approximations in a controlled way in the context of the cosmic microwave background observations for the computation of both spectra and bispectra. For angular spectra, it is explicitly shown that there exists a whole family of flat-sky approximations of similar accuracy for which the expression and amplitude of next to leading order terms can be explicitly computed. It is noted that in this context two limiting cases can be encountered for which the expressions can be further simplified. They correspond to cases where either the sources are localized in a narrow region (thin-shell approximation) or are slowly varying over a large distance (which leads to the so-called Limber approximation). Applying this to the calculation of the spectra it is shown that, as long as the late integrated Sachs-Wolfe contribution is neglected, the flat-sky approximation at leading order is accurate at 1% level for any multipole. Generalization of this construction scheme to the bispectra led to the introduction of an alternative description of the bispectra for which the flat-sky approximation is well controlled. This is not the case for the usual description of the bispectrum in terms of reduced bispectrum for which a flat-sky approximation is proposed but the next-to-leading order terms of which remain obscure
The Transient High Energy Sky and Early Universe Surveyor
O'Brien, P. T.
2016-04-01
The Transient High Energy Sky and Early Universe Surveyor is a mission which will be proposed for the ESA M5 call. THESEUS will address multiple components in the Early Universe ESA Cosmic Vision theme:4.1 Early Universe,4.2 The Universe taking shape, and4.3 The evolving violent Universe.THESEUS aims at vastly increasing the discovery space of the high energy transient phenomena over the entire cosmic history. This is achieved via a unique payload providing an unprecedented combination of: (i) wide and deep sky monitoring in a broad energy band(0.3 keV-20 MeV; (ii) focusing capabilities in the soft X-ray band granting large grasp and high angular resolution; and (iii) on board near-IR capabilities for immediate transient identification and first redshift estimate.The THESEUS payload consists of: (i) the Soft X--ray Imager (SXI), a set of Lobster Eye (0.3--6 keV) telescopes with CCD detectors covering a total FOV of 1 sr; (ii) the X--Gamma-rays spectrometer (XGS), a non-imaging spectrometer (XGS) based on SDD+CsI, covering the same FOV than the Lobster telescope extending the THESEUS energy band up to 20 MeV; and (iii) a 70cm class InfraRed Telescope (IRT) observing up to 2 microns with imaging and moderate spectral capabilities.The main scientific goals of THESEUS are to:(a) Explore the Early Universe (cosmic dawn and reionization era) by unveiling the Gamma--Ray Burst (GRBs) population in the first billion years}, determining when did the first stars form, and investigating the re-ionization epoch, the interstellar medium (ISM) and the intergalactic medium (IGM) at high redshifts.(b) Perform an unprecedented deep survey of the soft X-ray transient Universe in order to fill the present gap in the discovery space of new classes of transient; provide a fundamental step forward in the comprehension of the physics of various classes of Galactic and extra--Galactic transients, and provide real time trigger and accurate locations of transients for follow-up with next-generation
Directory of Open Access Journals (Sweden)
Xingming Liang
2016-03-01
Full Text Available Clear-sky brightness temperatures (BT in five bands of the Advanced Himawari Imager (AHI; flown onboard Himawari-8 satellite centered at 3.9, 8.6, 10.4, 11.2, and 12.3 µm (denoted by IR37, IR86, IR10, IR11, and IR12, respectively are used in the NOAA Advanced Clear-Sky Processor for Oceans (ACSPO sea surface temperature (SST retrieval system. Here, AHI BTs are preliminarily evaluated for stability and consistency with the corresponding VIIRS and MODIS BTs, using the sensor observation minus model simulation (O-M biases and corresponding double differences. The objective is to ensure accurate and consistent SST products from the polar and geo sensors, and to prepare for the launch of the GOES-R satellite in 2016. All five AHI SST bands are found to be largely in-family with their polar counterparts, but biased low relative to the VIIRS and MODIS (which, in turn, were found to be stable and consistent, except for Terra IR86, which is biased high by 1.5 K. The negative biases are larger in IR37 and IR12 (up to ~−0.5 K, followed by the three remaining longwave IR bands IR86, IR10, and IR11 (from −0.3 to −0.4 K. These negative biases may be in part due to the uncertainties in AHI calibration and characterization, although uncertainties in the coefficients of the Community Radiative Transfer Model (CRTM, used to generate the “M” term may also contribute. Work is underway to add AHI analyses in the NOAA Monitoring of IR Clear-Sky Radiances over Oceans for SST (MICROS system and improve AHI BTs by collaborating with the sensor calibration and CRTM teams. The Advanced Baseline Imager (ABI analyses will be also added in MICROS when GOES-R is launched in late 2016 and the ABI IR data become available.
Cooling load reduction by means of night sky radiation
International Nuclear Information System (INIS)
Kamaruddin Abdullah; Armansyah, H.T.; Dyah, W.; Gunadnya, I.B.P.
2006-01-01
Nocturnal cooling can work under clear sky condition of the humid tropical climate. Such effect had been observed in a cool storage facilities for potatoes and for temporary storage of fresh vegetables installed in highland area of Candi kuning village of Bali. Test results have shown that the rate of heat dissipation to the sky could reduce storage temperature to 15 o C had been achieved when the nocturnal cooling unit was combined with modified cooling tower and 1 kW cooling effect of an auxiliary cooling unit. Under such condition the facility could maintain better quality of stored vegetables, such as broccoli, shallot, and celery as compared to those stored in room without cooling facility. The estimated average cooling rate due to night sky radiation was 47.6 W/m 2 , on September 28, 1999 and 47.2 W/m 2 with the lowest water temperature of 14 o C under ambient temperature of 16 o C
THE ELEVENTH AND TWELFTH DATA RELEASES OF THE SLOAN DIGITAL SKY SURVEY: FINAL DATA FROM SDSS-III
International Nuclear Information System (INIS)
Alam, Shadab; Albareti, Franco D.; Prieto, Carlos Allende; Anders, F.; Anderson, Scott F.; Anderton, Timothy; Andrews, Brett H.; Armengaud, Eric; Aubourg, Éric; Bautista, Julian E.; Bailey, Stephen; Basu, Sarbani; Beaton, Rachael L.; Beers, Timothy C.
2015-01-01
The third generation of the Sloan Digital Sky Survey (SDSS-III) took data from 2008 to 2014 using the original SDSS wide-field imager, the original and an upgraded multi-object fiber-fed optical spectrograph, a new near-infrared high-resolution spectrograph, and a novel optical interferometer. All of the data from SDSS-III are now made public. In particular, this paper describes Data Release 11 (DR11) including all data acquired through 2013 July, and Data Release 12 (DR12) adding data acquired through 2014 July (including all data included in previous data releases), marking the end of SDSS-III observing. Relative to our previous public release (DR10), DR12 adds one million new spectra of galaxies and quasars from the Baryon Oscillation Spectroscopic Survey (BOSS) over an additional 3000 deg 2 of sky, more than triples the number of H-band spectra of stars as part of the Apache Point Observatory (APO) Galactic Evolution Experiment (APOGEE), and includes repeated accurate radial velocity measurements of 5500 stars from the Multi-object APO Radial Velocity Exoplanet Large-area Survey (MARVELS). The APOGEE outputs now include the measured abundances of 15 different elements for each star. In total, SDSS-III added 5200 deg 2 of ugriz imaging; 155,520 spectra of 138,099 stars as part of the Sloan Exploration of Galactic Understanding and Evolution 2 (SEGUE-2) survey; 2,497,484 BOSS spectra of 1,372,737 galaxies, 294,512 quasars, and 247,216 stars over 9376 deg 2 ; 618,080 APOGEE spectra of 156,593 stars; and 197,040 MARVELS spectra of 5513 stars. Since its first light in 1998, SDSS has imaged over 1/3 of the Celestial sphere in five bands and obtained over five million astronomical spectra
The Eleventh and Twelfth Data Releases of the Sloan Digital Sky Survey: Final Data from SDSS-III
Alam, Shadab; Albareti, Franco D.; Allende Prieto, Carlos; Anders, F.; Anderson, Scott F.; Anderton, Timothy; Andrews, Brett H.; Armengaud, Eric; Aubourg, Éric; Bailey, Stephen; Basu, Sarbani; Bautista, Julian E.; Beaton, Rachael L.; Beers, Timothy C.; Bender, Chad F.; Berlind, Andreas A.; Beutler, Florian; Bhardwaj, Vaishali; Bird, Jonathan C.; Bizyaev, Dmitry; Blake, Cullen H.; Blanton, Michael R.; Blomqvist, Michael; Bochanski, John J.; Bolton, Adam S.; Bovy, Jo; Shelden Bradley, A.; Brandt, W. N.; Brauer, D. E.; Brinkmann, J.; Brown, Peter J.; Brownstein, Joel R.; Burden, Angela; Burtin, Etienne; Busca, Nicolás G.; Cai, Zheng; Capozzi, Diego; Carnero Rosell, Aurelio; Carr, Michael A.; Carrera, Ricardo; Chambers, K. C.; Chaplin, William James; Chen, Yen-Chi; Chiappini, Cristina; Chojnowski, S. Drew; Chuang, Chia-Hsun; Clerc, Nicolas; Comparat, Johan; Covey, Kevin; Croft, Rupert A. C.; Cuesta, Antonio J.; Cunha, Katia; da Costa, Luiz N.; Da Rio, Nicola; Davenport, James R. A.; Dawson, Kyle S.; De Lee, Nathan; Delubac, Timothée; Deshpande, Rohit; Dhital, Saurav; Dutra-Ferreira, Letícia; Dwelly, Tom; Ealet, Anne; Ebelke, Garrett L.; Edmondson, Edward M.; Eisenstein, Daniel J.; Ellsworth, Tristan; Elsworth, Yvonne; Epstein, Courtney R.; Eracleous, Michael; Escoffier, Stephanie; Esposito, Massimiliano; Evans, Michael L.; Fan, Xiaohui; Fernández-Alvar, Emma; Feuillet, Diane; Filiz Ak, Nurten; Finley, Hayley; Finoguenov, Alexis; Flaherty, Kevin; Fleming, Scott W.; Font-Ribera, Andreu; Foster, Jonathan; Frinchaboy, Peter M.; Galbraith-Frew, J. G.; García, Rafael A.; García-Hernández, D. A.; García Pérez, Ana E.; Gaulme, Patrick; Ge, Jian; Génova-Santos, R.; Georgakakis, A.; Ghezzi, Luan; Gillespie, Bruce A.; Girardi, Léo; Goddard, Daniel; Gontcho, Satya Gontcho A.; González Hernández, Jonay I.; Grebel, Eva K.; Green, Paul J.; Grieb, Jan Niklas; Grieves, Nolan; Gunn, James E.; Guo, Hong; Harding, Paul; Hasselquist, Sten; Hawley, Suzanne L.; Hayden, Michael; Hearty, Fred R.; Hekker, Saskia; Ho, Shirley; Hogg, David W.; Holley-Bockelmann, Kelly; Holtzman, Jon A.; Honscheid, Klaus; Huber, Daniel; Huehnerhoff, Joseph; Ivans, Inese I.; Jiang, Linhua; Johnson, Jennifer A.; Kinemuchi, Karen; Kirkby, David; Kitaura, Francisco; Klaene, Mark A.; Knapp, Gillian R.; Kneib, Jean-Paul; Koenig, Xavier P.; Lam, Charles R.; Lan, Ting-Wen; Lang, Dustin; Laurent, Pierre; Le Goff, Jean-Marc; Leauthaud, Alexie; Lee, Khee-Gan; Lee, Young Sun; Licquia, Timothy C.; Liu, Jian; Long, Daniel C.; López-Corredoira, Martín; Lorenzo-Oliveira, Diego; Lucatello, Sara; Lundgren, Britt; Lupton, Robert H.; Mack, Claude E., III; Mahadevan, Suvrath; Maia, Marcio A. G.; Majewski, Steven R.; Malanushenko, Elena; Malanushenko, Viktor; Manchado, A.; Manera, Marc; Mao, Qingqing; Maraston, Claudia; Marchwinski, Robert C.; Margala, Daniel; Martell, Sarah L.; Martig, Marie; Masters, Karen L.; Mathur, Savita; McBride, Cameron K.; McGehee, Peregrine M.; McGreer, Ian D.; McMahon, Richard G.; Ménard, Brice; Menzel, Marie-Luise; Merloni, Andrea; Mészáros, Szabolcs; Miller, Adam A.; Miralda-Escudé, Jordi; Miyatake, Hironao; Montero-Dorta, Antonio D.; More, Surhud; Morganson, Eric; Morice-Atkinson, Xan; Morrison, Heather L.; Mosser, Benôit; Muna, Demitri; Myers, Adam D.; Nandra, Kirpal; Newman, Jeffrey A.; Neyrinck, Mark; Nguyen, Duy Cuong; Nichol, Robert C.; Nidever, David L.; Noterdaeme, Pasquier; Nuza, Sebastián E.; O'Connell, Julia E.; O'Connell, Robert W.; O'Connell, Ross; Ogando, Ricardo L. C.; Olmstead, Matthew D.; Oravetz, Audrey E.; Oravetz, Daniel J.; Osumi, Keisuke; Owen, Russell; Padgett, Deborah L.; Padmanabhan, Nikhil; Paegert, Martin; Palanque-Delabrouille, Nathalie; Pan, Kaike; Parejko, John K.; Pâris, Isabelle; Park, Changbom; Pattarakijwanich, Petchara; Pellejero-Ibanez, M.; Pepper, Joshua; Percival, Will J.; Pérez-Fournon, Ismael; P´rez-Ra`fols, Ignasi; Petitjean, Patrick; Pieri, Matthew M.; Pinsonneault, Marc H.; Porto de Mello, Gustavo F.; Prada, Francisco; Prakash, Abhishek; Price-Whelan, Adrian M.; Protopapas, Pavlos; Raddick, M. Jordan; Rahman, Mubdi; Reid, Beth A.; Rich, James; Rix, Hans-Walter; Robin, Annie C.; Rockosi, Constance M.; Rodrigues, Thaíse S.; Rodríguez-Torres, Sergio; Roe, Natalie A.; Ross, Ashley J.; Ross, Nicholas P.; Rossi, Graziano; Ruan, John J.; Rubiño-Martín, J. A.; Rykoff, Eli S.; Salazar-Albornoz, Salvador; Salvato, Mara; Samushia, Lado; Sánchez, Ariel G.; Santiago, Basílio; Sayres, Conor; Schiavon, Ricardo P.; Schlegel, David J.; Schmidt, Sarah J.; Schneider, Donald P.; Schultheis, Mathias; Schwope, Axel D.; Scóccola, C. G.; Scott, Caroline; Sellgren, Kris; Seo, Hee-Jong; Serenelli, Aldo; Shane, Neville; Shen, Yue; Shetrone, Matthew; Shu, Yiping; Silva Aguirre, V.; Sivarani, Thirupathi; Skrutskie, M. F.; Slosar, Anže; Smith, Verne V.; Sobreira, Flávia; Souto, Diogo; Stassun, Keivan G.; Steinmetz, Matthias; Stello, Dennis; Strauss, Michael A.; Streblyanska, Alina; Suzuki, Nao; Swanson, Molly E. C.; Tan, Jonathan C.; Tayar, Jamie; Terrien, Ryan C.; Thakar, Aniruddha R.; Thomas, Daniel; Thomas, Neil; Thompson, Benjamin A.; Tinker, Jeremy L.; Tojeiro, Rita; Troup, Nicholas W.; Vargas-Magaña, Mariana; Vazquez, Jose A.; Verde, Licia; Viel, Matteo; Vogt, Nicole P.; Wake, David A.; Wang, Ji; Weaver, Benjamin A.; Weinberg, David H.; Weiner, Benjamin J.; White, Martin; Wilson, John C.; Wisniewski, John P.; Wood-Vasey, W. M.; Ye`che, Christophe; York, Donald G.; Zakamska, Nadia L.; Zamora, O.; Zasowski, Gail; Zehavi, Idit; Zhao, Gong-Bo; Zheng, Zheng; Zhou, Xu; Zhou, Zhimin; Zou, Hu; Zhu, Guangtun
2015-07-01
The third generation of the Sloan Digital Sky Survey (SDSS-III) took data from 2008 to 2014 using the original SDSS wide-field imager, the original and an upgraded multi-object fiber-fed optical spectrograph, a new near-infrared high-resolution spectrograph, and a novel optical interferometer. All of the data from SDSS-III are now made public. In particular, this paper describes Data Release 11 (DR11) including all data acquired through 2013 July, and Data Release 12 (DR12) adding data acquired through 2014 July (including all data included in previous data releases), marking the end of SDSS-III observing. Relative to our previous public release (DR10), DR12 adds one million new spectra of galaxies and quasars from the Baryon Oscillation Spectroscopic Survey (BOSS) over an additional 3000 deg2 of sky, more than triples the number of H-band spectra of stars as part of the Apache Point Observatory (APO) Galactic Evolution Experiment (APOGEE), and includes repeated accurate radial velocity measurements of 5500 stars from the Multi-object APO Radial Velocity Exoplanet Large-area Survey (MARVELS). The APOGEE outputs now include the measured abundances of 15 different elements for each star. In total, SDSS-III added 5200 deg2 of ugriz imaging; 155,520 spectra of 138,099 stars as part of the Sloan Exploration of Galactic Understanding and Evolution 2 (SEGUE-2) survey; 2,497,484 BOSS spectra of 1,372,737 galaxies, 294,512 quasars, and 247,216 stars over 9376 deg2; 618,080 APOGEE spectra of 156,593 stars; and 197,040 MARVELS spectra of 5513 stars. Since its first light in 1998, SDSS has imaged over 1/3 of the Celestial sphere in five bands and obtained over five million astronomical spectra.
The eleventh and twelfth data release of the Sloan Digital Sky Survey: Final data from SDSS-III
Energy Technology Data Exchange (ETDEWEB)
Alam, Shadab; Albareti, Franco D.; Prieto, Carlos Allende; Anders, F.; Anderson, Scott F.; Anderton, Timothy; Andrews, Brett H.; Armengaud, Eric; Aubourg, Éric; Bailey, Stephen; Basu, Sarbani; Bautista, Julian E.; Beaton, Rachael L.; Beers, Timothy C.; Bender, Chad F.; Berlind, Andreas A.; Beutler, Florian; Bhardwaj, Vaishali; Bird, Jonathan C.; Bizyaev, Dmitry; Blake, Cullen H.; Blanton, Michael R.; Blomqvist, Michael; Bochanski, John J.; Bolton, Adam S.; Bovy, Jo; Bradley, A. Shelden; Brandt, W. N.; Brauer, D. E.; Brinkmann, J.; Brown, Peter J.; Brownstein, Joel R.; Burden, Angela; Burtin, Etienne; Busca, Nicolás G.; Cai, Zheng; Capozzi, Diego; Rosell, Aurelio Carnero; Carr, Michael A.; Carrera, Ricardo; Chambers, K. C.; Chaplin, William James; Chen, Yen-Chi; Chiappini, Cristina; Chojnowski, S. Drew; Chuang, Chia-Hsun; Clerc, Nicolas; Comparat, Johan; Covey, Kevin; Croft, Rupert A. C.; Cuesta, Antonio J.; Cunha, Katia; Costa, Luiz N. da; Rio, Nicola Da; Davenport, James R. A.; Dawson, Kyle S.; Lee, Nathan De; Delubac, Timothée; Deshpande, Rohit; Dhital, Saurav; Dutra-Ferreira, Letícia; Dwelly, Tom; Ealet, Anne; Ebelke, Garrett L.; Edmondson, Edward M.; Eisenstein, Daniel J.; Ellsworth, Tristan; Elsworth, Yvonne; Epstein, Courtney R.; Eracleous, Michael; Escoffier, Stephanie; Esposito, Massimiliano; Evans, Michael L.; Fan, Xiaohui; Fernández-Alvar, Emma; Feuillet, Diane; Ak, Nurten Filiz; Finley, Hayley; Finoguenov, Alexis; Flaherty, Kevin; Fleming, Scott W.; Font-Ribera, Andreu; Foster, Jonathan; Frinchaboy, Peter M.; Galbraith-Frew, J. G.; García, Rafael A.; García-Hernández, D. A.; Pérez, Ana E. García; Gaulme, Patrick; Ge, Jian; Génova-Santos, R.; Georgakakis, A.; Ghezzi, Luan; Gillespie, Bruce A.; Girardi, Léo; Goddard, Daniel; Gontcho, Satya Gontcho A.; Hernández, Jonay I. González; Grebel, Eva K.; Green, Paul J.; Grieb, Jan Niklas; Grieves, Nolan; Gunn, James E.; Guo, Hong; Harding, Paul; Hasselquist, Sten; Hawley, Suzanne L.; Hayden, Michael; Hearty, Fred R.; Hekker, Saskia; Ho, Shirley; Hogg, David W.; Holley-Bockelmann, Kelly; Holtzman, Jon A.; Honscheid, Klaus; Huber, Daniel; Huehnerhoff, Joseph; Ivans, Inese I.; Jiang, Linhua; Johnson, Jennifer A.; Kinemuchi, Karen; Kirkby, David; Kitaura, Francisco; Klaene, Mark A.; Knapp, Gillian R.; Kneib, Jean-Paul; Koenig, Xavier P.; Lam, Charles R.; Lan, Ting-Wen; Lang, Dustin; Laurent, Pierre; Goff, Jean-Marc Le; Leauthaud, Alexie; Lee, Khee-Gan; Lee, Young Sun; Licquia, Timothy C.; Liu, Jian; Long, Daniel C.; López-Corredoira, Martín; Lorenzo-Oliveira, Diego; Lucatello, Sara; Lundgren, Britt; Lupton, Robert H.; III, Claude E. Mack; Mahadevan, Suvrath; Maia, Marcio A. G.; Majewski, Steven R.; Malanushenko, Elena; Malanushenko, Viktor; Manchado, A.; Manera, Marc; Mao, Qingqing; Maraston, Claudia; Marchwinski, Robert C.; Margala, Daniel; Martell, Sarah L.; Martig, Marie; Masters, Karen L.; Mathur, Savita; McBride, Cameron K.; McGehee, Peregrine M.; McGreer, Ian D.; McMahon, Richard G.; Ménard, Brice; Menzel, Marie-Luise; Merloni, Andrea; Mészáros, Szabolcs; Miller, Adam A.; Miralda-Escudé, Jordi; Miyatake, Hironao; Montero-Dorta, Antonio D.; More, Surhud; Morganson, Eric; Morice-Atkinson, Xan; Morrison, Heather L.; Mosser, Benôit; Muna, Demitri; Myers, Adam D.; Nandra, Kirpal; Newman, Jeffrey A.; Neyrinck, Mark; Nguyen, Duy Cuong; Nichol, Robert C.; Nidever, David L.; Noterdaeme, Pasquier; Nuza, Sebastián E.; O’Connell, Julia E.; O’Connell, Robert W.; O’Connell, Ross; Ogando, Ricardo L. C.; Olmstead, Matthew D.; Oravetz, Audrey E.; Oravetz, Daniel J.; Osumi, Keisuke; Owen, Russell; Padgett, Deborah L.; Padmanabhan, Nikhil; Paegert, Martin; Palanque-Delabrouille, Nathalie; Pan, Kaike; Parejko, John K.; Pâris, Isabelle; Park, Changbom; Pattarakijwanich, Petchara; Pellejero-Ibanez, M.; Pepper, Joshua; Percival, Will J.; Pérez-Fournon, Ismael; Pe´rez-Ra`fols, Ignasi; Petitjean, Patrick; Pieri, Matthew M.; Pinsonneault, Marc H.; Mello, Gustavo F. Porto de; Prada, Francisco; Prakash, Abhishek; Price-Whelan, Adrian M.; Protopapas, Pavlos; Raddick, M. Jordan; Rahman, Mubdi; Reid, Beth A.; Rich, James; Rix, Hans-Walter; Robin, Annie C.; Rockosi, Constance M.; Rodrigues, Thaíse S.; Rodríguez-Torres, Sergio; Roe, Natalie A.; Ross, Ashley J.; Ross, Nicholas P.; Rossi, Graziano; Ruan, John J.; Rubiño-Martín, J. A.; Rykoff, Eli S.; Salazar-Albornoz, Salvador; Salvato, Mara; Samushia, Lado; Sánchez, Ariel G.; Santiago, Basílio; Sayres, Conor; Schiavon, Ricardo P.; Schlegel, David J.; Schmidt, Sarah J.; Schneider, Donald P.; Schultheis, Mathias; Schwope, Axel D.; Scóccola, C. G.; Scott, Caroline; Sellgren, Kris; Seo, Hee-Jong; Serenelli, Aldo; Shane, Neville; Shen, Yue; Shetrone, Matthew; Shu, Yiping; Aguirre, V. Silva; Sivarani, Thirupathi; Skrutskie, M. F.; Slosar, Anže; Smith, Verne V.; Sobreira, Flávia; Souto, Diogo; Stassun, Keivan G.; Steinmetz, Matthias; Stello, Dennis; Strauss, Michael A.; Streblyanska, Alina; Suzuki, Nao; Swanson, Molly E. C.; Tan, Jonathan C.; Tayar, Jamie; Terrien, Ryan C.; Thakar, Aniruddha R.; Thomas, Daniel; Thomas, Neil; Thompson, Benjamin A.; Tinker, Jeremy L.; Tojeiro, Rita; Troup, Nicholas W.; Vargas-Magaña, Mariana; Vazquez, Jose A.; Verde, Licia; Viel, Matteo; Vogt, Nicole P.; Wake, David A.; Wang, Ji; Weaver, Benjamin A.; Weinberg, David H.; Weiner, Benjamin J.; White, Martin; Wilson, John C.; Wisniewski, John P.; Wood-Vasey, W. M.; Ye`che, Christophe; York, Donald G.; Zakamska, Nadia L.; Zamora, O.; Zasowski, Gail; Zehavi, Idit; Zhao, Gong-Bo; Zheng, Zheng; Zhou (周旭), Xu; Zhou (周志民), Zhimin; Zou (邹虎), Hu; Zhu, Guangtun
2015-07-20
The third generation of the Sloan Digital Sky Survey (SDSS-III) took data from 2008 to 2014 using the original SDSS wide-field imager, the original and an upgraded multi-object fiber-fed optical spectrograph, a new near-infrared high-resolution spectrograph, and a novel optical interferometer. All of the data from SDSS-III are now made public. In particular, this paper describes Data Release 11 (DR11) including all data acquired through 2013 July, and Data Release 12 (DR12) adding data acquired through 2014 July (including all data included in previous data releases), marking the end of SDSS-III observing. Relative to our previous public release (DR10), DR12 adds one million new spectra of galaxies and quasars from the Baryon Oscillation Spectroscopic Survey (BOSS) over an additional 3000 deg2 of sky, more than triples the number of H-band spectra of stars as part of the Apache Point Observatory (APO) Galactic Evolution Experiment (APOGEE), and includes repeated accurate radial velocity measurements of 5500 stars from the Multi-object APO Radial Velocity Exoplanet Large-area Survey (MARVELS). The APOGEE outputs now include the measured abundances of 15 different elements for each star. In total, SDSS-III added 5200 deg2 of ugriz imaging; 155,520 spectra of 138,099 stars as part of the Sloan Exploration of Galactic Understanding and Evolution 2 (SEGUE-2) survey; 2,497,484 BOSS spectra of 1,372,737 galaxies, 294,512 quasars, and 247,216 stars over 9376 deg2; 618,080 APOGEE spectra of 156,593 stars; and 197,040 MARVELS spectra of 5513 stars. Since its first light in 1998, SDSS has imaged over 1/3 of the Celestial sphere in five bands and obtained over five million astronomical spectra.
McWilliams, Sean T.; Lang, Ryan N.; Baker, John G.; Thorpe, James Ira
2011-01-01
We investigate the capability of LISA to measure the sky position of equal-mass, nonspinning black hole binaries, including for the first time the entire inspiral-merger-ringdown signal, the effect of the LISA orbits, and the complete three-channel LISA response. For an ensemble of systems near the peak of LISA's sensitivity band, with total rest mass of 2 x l0(exp 6) Stellar Mass at a redshift of z = 1 with random orientations and sky positions, we find median sky localization errors of approximately approx. 3 arcminutes. This is comparable to the field of view of powerful electromagnetic telescopes, such as the James Webb Space Telescope, that could be used to search for electromagnetic signals associated with merging black holes. We investigate the way in which parameter errors decrease with measurement time, focusing specifically on the additional information provided during the merger-ringdown segment of the signal. We find that this information improves all parameter estimates directly, rather than through diminishing correlations with any subset of well-determined parameters.
Impacts of field of view configuration of Cross-track Infrared Sounder on clear-sky observations.
Wang, Likun; Chen, Yong; Han, Yong
2016-09-01
Hyperspectral infrared radiance measurements from satellite sensors contain valuable information on atmospheric temperature and humidity profiles and greenhouse gases, and therefore are directly assimilated into numerical weather prediction (NWP) models as inputs for weather forecasting. However, data assimilations in current operational NWP models still mainly rely on cloud-free observations due to the challenge of simulating cloud-contaminated radiances when using hyperspectral radiances. The limited spatial coverage of the 3×3 field of views (FOVs) in one field of regard (FOR) (i.e., spatial gap among FOVs) as well as relatively large footprint size (14 km) in current Cross-track Infrared Sounder (CrIS) instruments limits the amount of clear-sky observations. This study explores the potential impacts of future CrIS FOV configuration (including FOV size and spatial coverage) on the amount of clear-sky observations by simulation experiments. The radiance measurements and cloud mask products (VCM) from the Visible Infrared Imager Radiometer Suite (VIIRS) are used to simulate CrIS clear-sky observation under different FOV configurations. The results indicate that, given the same FOV coverage (e.g., 3×3), the percentage of clear-sky FOVs and the percentage of clear-sky FORs (that contain at least one clear-sky FOV) both increase as the FOV size decreases. In particular, if the CrIS FOV size were reduced from 14 km to 7 km, the percentage of clear-sky FOVs increases from 9.02% to 13.51% and the percentage of clear-sky FORs increases from 18.24% to 27.51%. Given the same FOV size but with increasing FOV coverage in each FOR, the clear-sky FOV observations increases proportionally with the increasing sampling FOVs. Both reducing FOV size and increasing FOV coverage can result in more clear-sky FORs, which benefit data utilization of NWP data assimilation.
Dark Skies Ahead? Activities to Raise Awareness during the International Year of Astronomy
Walker, Constance E.; Isbell, D.; Pompea, S.
2007-12-01
"Dark Skies as a Universal Resource” is one of 7 themes targeted for the International Year of Astronomy in 2009. The theme's goal is to raise public awareness of the impact of artificial lighting on local environments and the ongoing loss of a dark night sky as a natural resource for much of the world's population. To reach this goal, activities are being developed which highlight dark skies preservation issues 1) through new technology (e.g., programs at planetaria, blogging, podcasting); 2) at events such as star parties and observatory open houses; 3) in arts, entertainment and storytelling (e.g., art competitions, documentaries, lectures, native American traditions); 4) through unaided-eye and digital-meter star count programs involving citizen-scientists; and 5) by relating them to public health, economic issues, ecological consequences, energy conservation, safety and security. A centerpiece of the Dark Skies theme is the unaided-eye and digital-meter versions of the GLOBE at Night program. The unaided-eye version directs citizen-scientists on how to observe and record the brightness of the night sky by matching its appearance toward the constellation of Orion with one of 7 stellar maps of different limiting magnitudes. For the "digital” version, low-cost meters are used by citizen-scientists to measure the integrated sky brightness. Data sets and maps of both versions are supplied on-line for further capstone activities. In the presentation, we will outline the activities being developed as well as plans for funding, implementation, marketing and the connections to the global cornerstone IYA project, "Dark Skies Awareness".
Observation of a VHE Cosmic-Ray Flare-Signal with the L3+C Muon Spectrometer
Adriani, O; Aziz, T; Bähr, J; Banerjee, S; Becattini, F; Bellucci, L; Betev, B L; Blaising, J J; Bobbink, G J; Bottai, S; Bourilkov, D; Cartacci, A; Chemarin, M; Chen, G; Chen, G M; Chen, H S; Chiarusi, T; Coignet, G; Ding, L K; Duran, I; Eline, A; El Mamouni, H; Faber, G; Fay, J; Filthaut, F; Ganguli, S N; Gong, Z F; Grabosch, H J; Groenstege, H; Guo, Y N; Gupta, S; Gurtu, A; Haller, Ch; Hayashi, Y; He, Z X; Hebbeker, T; Herve, A; Hofer, H; Hoferjun, H; Huo, A X; Ito, N; Jing, C L; Jones, L W; Kantserov, V; Kawakami, S; Kittel, W; König, A C; Kok, E; Kuang, H H; Kuijpers, J; Ladron de Guevara, P; Le Coultre, P; Lei, Y; Leich, H; Leiste, R; Li, L; Li, Z C; Liu, Z A; Lohmann, W; Lu, Y S; Ma, W G; Ma, X H; Ma, Y Q; Mele, S; Meng, X W; Meschini, M; Metzger, W J; van Mil, A; Milcent, H; Mohanty, G B; Monteleoni, B; Nahnhauer, R; Naumov, V A; Nowak, H; Parriaud, J -F; Pauss, F; Petersen, B; Pieri, M; Pohl, M; Pojidaev, V; Qing, C R; Ramelli, R; Ranieri, R; Ravindran, K C; Rewiersma, P; Riemann, S; Rojkov, A; Romero, L; Schmitt, V; Schoeneich, B; Schotanus, D J; Shen, C Q; Spillantini, P; Sulanke, H; Tang, X W; Timmermans, C; Tonwar, S C; Trowitzsch, G; Unger, M; Verkooijen, H; Van de Walle, R T; Vogt, H; Wang, R G; Wang, Q; Wang, X L; Wang, X W; Wang, Z M; Wijk, R van; Wijnen, T A M; Wilkens, H; Xu, Y P; Xu, J S; Xu, Z Z; Yang, C G; Yang, X F; Yao, Z G; Yu, Z Q; Zhang, C; Zhang, F; Zhang, J; Zhang, S; Zhou, S J; Zhu, G Y; Zhu, Q Q; Zhuang, H L; Zwart, A N M
2010-01-01
The data collected by the L3+C muon spectrometer at the CERN Large Electron-Positron collider, LEP, have been used to search for short duration signals emitted by cosmic point sources. A sky survey performed from July to November 1999 and from April to November 2000 has revealed one single flux enhancement (chance probability = 2.6X10^{-3}) between the 17th and 20th of August 2000 from a direction with a galactic longitude of (265.02+-0.42)^° and latitude of (55.58+-0.24)^°. The energy of the detected muons was above 15 GeV.
Photometric Analysis of Pi of the Sky Data
Directory of Open Access Journals (Sweden)
Rafał Opiela
2013-01-01
Full Text Available Two fully automatic Pi of the Sky detectors with a large field of view, located in Spain (INTA and in Chile (SPDA observe the sky in search of rare optical phenomena, and also collect observations which include many kinds of variable stars. To be able to draw proper conclusions from the data that is received, adequate quality of the detectors is very important. Pi of the Sky data are subject to systematic errors caused by various factors, e.g. cloud cover seen as significant fluctuations in the number of stars observed by the detector, problems with conducting mounting, a strong background of the moon or the passage of a bright object, e.g. a planet, near the observed star. Some of these adverse effects are already detected during cataloging of the individual measurements, but this is not sufficient to make the quality of the data satisfactory for us. In order to improve the quality of our data, we developed two new procedures based on two different approaches. In this paper we will say some words about these procedures, give some examples, and show how these procedures improve the quality of our data.
The gamma-ray sky as seen with HAWC
Directory of Open Access Journals (Sweden)
Hüntemeyer Petra
2015-01-01
Full Text Available The High-Altitude Water Cherenkov (HAWC TeV Gamma-Ray Observatory located at a site about two hours drive east of Puebla, Mexico on the Sierra Negra plateau (4100 m a.s.l. was inaugurated in March 2015. The array of 300 water Cherenkov detectors can observe large portions of the sky simultaneously and, with an energy range of 100 GeV to 100 TeV, is currently one of the most sensitive instruments capable of probing particle acceleration near PeV energies. HAWC has already started science operation in the Summer of 2013 and preliminary sky maps have been produced from 260 days of data taken with a partial array. Multiple > 5 σ (pre-trials hotspots are visible along the galactic plane and some appear to coincide with known TeV sources from the H.E.S.S. catalog, SNRs and molecular cloud associations, and pulsars wind nebulae (PWNe. The sky maps based on partial HAWC array data are discussed as well as the scientific potential of the completed instrument especially in the context of multi-wavelengths studies.
ACS/WFC Sky Flats from Frontier Fields Imaging
Mack, J.; Lucas, R. A.; Grogin, N. A.; Bohlin, R. C.; Koekemoer, A. M.
2018-04-01
Parallel imaging data from the HST Frontier Fields campaign (Lotz et al. 2017) have been used to compute sky flats for the ACS/WFC detector in order to verify the accuracy of the current set of flat field reference files. By masking sources and then co-adding many deep frames, the F606W and F814W filters have enough combined background signal that from Poisson statistics are efficiency tracks the thickness of the two WFC chips. Observations of blue and red calibration standards measured at various positions on the detector (Bohlin et al. 2017) confirm the fidelity of the F814W flat, with aperture photometry consistent to 1% across the FOV, regardless of spectral type. At bluer wavelengths, the total sky background is substantially lower, and the F435W sky flat shows a combination of both flat errors and detector artifacts. Aperture photometry of the red standard star shows a maximum deviation of 1.4% across the array in this filter. Larger residuals up to 2.5% are found for the blue standard, suggesting that the spatial sensitivity in F435W depends on spectral type.
International Nuclear Information System (INIS)
Maghrabi, A.; Clay, R.
2011-01-01
measured sky temperature. The performances of these models were all different. Whereas most of them underestimated the measured sky temperatures, three of these models showed a reasonable prediction ability. Finally, the multilinear model was compared with the simulated sky temperatures obtained using MODTRAN software. Perfect agreements were found between the two temperatures.
Study of X-ray transients with Scanning Sky Monitor (SSM) onboard ...
Indian Academy of Sciences (India)
M. C. RAMADEVI
MS received 1 September 2017; accepted 19 December 2017; published online 10 February 2018. Abstract. Scanning Sky Monitor (SSM) onboard AstroSat is an X-ray sky monitor in the ..... 31(2–3), 99. Ramadevi M. C., Seetha S., Babu V. C., Ashoka B. N., Sreeku- mar P. 2006, Optimization of Gas Proportional Coun-.
Protecting Dark Skies as a State-Wide Resource
Allen, Lori E.; Walker, Constance E.; Hall, Jeffrey C.; Larson, Steve; Williams, Grant; Falco, Emilio; Hinz, Joannah; Fortin, Pascal; Brocious, Dan; Corbally, Christopher; Gabor, Paul; Veillet, Christian; Shankland, Paul; Jannuzi, Buell; Cotera, Angela; Luginbuhl, Christian
2018-01-01
The state of Arizona contains the highest concentration of research telescopes in the continental United States, contributing more than a quarter of a billion dollars annually to the state's economy. Protecting the dark skies above these observatories is both good for astronomy and good for the state's economy. In this contribution we describe how a coalition of Arizona observatories is working together to protect our dark skies. Efforts date back to the creation of one of the first Outdoor Lighting Codes in the United States and continue today, including educational outreach, public policy engagement, and consensus building. We review some proven strategies, highlight recent successes and look at current threats.
Variable X-ray sky with Lobster Eye Telescopes
International Nuclear Information System (INIS)
Hudec, R.; Pina, L.; Inneman, A.; Sveda, L.
2004-01-01
The variable X-ray sky requires wide-field monitoring with high sensitivity. We refer on novel X-ray telescopes with high sensitivity as well as large field of view. The results are very promising, allowing the proposals for space projects with very wide-field Lobster-eye X-ray optics to be considered. The novel telescopes will monitor the sky with unprecedented sensitivity and angular resolution of order of 1 arcmin. They are expected to contribute essentially to study and to understand various astrophysical objects such as AGN, SNe, GRBs, X-ray flashes, galactic binary sources, stars, CVs, X-ray novae, various transient sources, etc
Brotherton, M.
2004-12-01
My first science fiction novel, Star Dragon, just recently available in paperback from Tor, features a voyage to the cataclysmic variable star system SS Cygni. My second novel, Spider Star, to appear early in 2006, takes place in and around a dark matter ``planet'' orbiting a neutron star. Both novels are ``hard'' science fiction, relying on accurate physics to inform the tales. It's possible to bring to life abstract concepts like special relativity, and alien environments like accretion disks, by using science fiction. Novels are difficult to use in a science class, but short stories offer intriguing possibilities. I'm planning to edit an anthology of hard science fiction stories that contain accurate science and emphasize fundamental ideas in modern astronomy. The working title is Diamonds in the Sky. The collection will be a mix of original stories and reprints, highlighting challenging concepts covered in a typical introductory astronomy course. Larry Niven's classic story, ``Neutron Star," is an excellent demonstration of extreme tidal forces in an astronomical context. Diamonds in the Sky will include forewards and afterwards to the stories, including discussion questions and mathematical formulas/examples as appropriate. I envision this project will be published electronically or through a print-on-demand publisher, providing long-term availabilty and keeping low cost. I encourage interested parties to suggest previously published stories, or to suggest which topics must be included.
A Supplementary Clear-Sky Snow and Ice Recognition Technique for CERES Level 2 Products
Radkevich, Alexander; Khlopenkov, Konstantin; Rutan, David; Kato, Seiji
2013-01-01
Identification of clear-sky snow and ice is an important step in the production of cryosphere radiation budget products, which are used in the derivation of long-term data series for climate research. In this paper, a new method of clear-sky snow/ice identification for Moderate Resolution Imaging Spectroradiometer (MODIS) is presented. The algorithm's goal is to enhance the identification of snow and ice within the Clouds and the Earth's Radiant Energy System (CERES) data after application of the standard CERES scene identification scheme. The input of the algorithm uses spectral radiances from five MODIS bands and surface skin temperature available in the CERES Single Scanner Footprint (SSF) product. The algorithm produces a cryosphere rating from an aggregated test: a higher rating corresponds to a more certain identification of the clear-sky snow/ice-covered scene. Empirical analysis of regions of interest representing distinctive targets such as snow, ice, ice and water clouds, open waters, and snow-free land selected from a number of MODIS images shows that the cryosphere rating of snow/ice targets falls into 95% confidence intervals lying above the same confidence intervals of all other targets. This enables recognition of clear-sky cryosphere by using a single threshold applied to the rating, which makes this technique different from traditional branching techniques based on multiple thresholds. Limited tests show that the established threshold clearly separates the cryosphere rating values computed for the cryosphere from those computed for noncryosphere scenes, whereas individual tests applied consequently cannot reliably identify the cryosphere for complex scenes.
Clynes, F.
2011-06-01
The concept of the sacred world beyond the stars found expression in the works of Plato, into Gnosticism and was incorporated into Christianity where medieval images of the cosmos pictured the heavenly domain as beyond the stars. Today cyberspace literature abounds with descriptions of a transmundane space, a great Beyond. This talk looks at current views of cyberspace and asks if they are a re-packaging of the age-old concept of a sacred sky in a secular and technological format?
International Nuclear Information System (INIS)
Levine, Alan M.; Bradt, Hale V.; Chakrabarty, Deepto; Corbet, Robin H. D.; Harris, Robert J.
2011-01-01
We present the results of a systematic search in ∼14 years of Rossi X-ray Timing Explorer All-Sky Monitor (ASM) data for evidence of periodicities. Two variations of the commonly used Fourier analysis search method have been employed to significantly improve upon the sensitivity achieved by Wen et al. in 2006, who also searched for periodicities in ASM data. In addition, the present search is comprehensive in terms of sources studied and frequency range covered, and has yielded the detection of the signatures of the orbital periods of eight low-mass X-ray binary systems and of ten high-mass X-ray binaries not listed in the tables of Wen et al. Orbital periods, epochs, signal amplitudes, modulation fractions, and folded light curves are given for each of these systems. Seven of the orbital periods are the most precise reported to date. In the course of this work, the 18.545 day orbital period of IGR J18483-0311 was co-discovered, and the first detections in X-rays were made of the ∼3.9 day orbital period of LMC X-1 and the ∼3.79 hr orbital period of 4U 1636-536. The results inform future searches for orbital and other periodicities in X-ray binaries.
When the Sky Falls: Performing Initial Assessments of Bright Atmospheric Events
Cooke, William J.; Brown, Peter; Blaauw, Rhiannon; Kingery, Aaron; Moser, Danielle
2015-01-01
The 2013 Chelyabinsk super bolide was the first "significant" impact event to occur in the age of social media and 24 hour news. Scientists, used to taking many days or weeks to analyze fireball events, were hard pressed to meet the immediate demands (within hours) for answers from the media, general public, and government officials. Fulfilling these requests forced many researchers to exploit information available from various Internet sources - videos were downloaded from sites like Youtube, geolocated via Google Street View, and quickly analyzed with improvised software; Twitter and Facebook were scoured for eyewitness accounts of the fireball and reports of meteorites. These data, combined with infrasound analyses, enabled a fairly accurate description of the Chelyabinsk event to be formed within a few hours; in particular, any relationship to 2012 DA14 (which passed near Earth later that same day) was eliminated. Results of these analyses were quickly disseminated to members of the NEO community for press conferences and media interviews. Despite a few minor glitches, the rapid initial assessment of Chelyabinsk was a triumph, permitting the timely conveyance of accurate information to the public and the incorporation of social media into fireball analyses. Beginning in 2008, the NASA Meteoroid Environments Office, working in cooperation with Western's Meteor Physics Group, developed processes and software that permit quick characterization - mass, trajectory, and orbital properties - of fireball events. These tools include automated monitoring of Twitter to establish the time of events (the first tweet is usually no more than a few seconds after the fireball), mining of Youtube and all sky camera web archives to locate videos suitable for analyses, use of Google Earth and Street View to geolocate the video locations, and software to determine the fireball trajectory and object orbital parameters, including generation of animations suitable for popular media
The fast transient sky with Gaia
Wevers, Thomas; Jonker, Peter G.; Hodgkin, Simon T.; Kostrzewa-Rutkowska, Zuzanna; Harrison, Diana L.; Rixon, Guy; Nelemans, Gijs; Roelens, Maroussia; Eyer, Laurent; van Leeuwen, Floor; Yoldas, Abdullah
2018-01-01
The ESA Gaia satellite scans the whole sky with a temporal sampling ranging from seconds and hours to months. Each time a source passes within the Gaia field of view, it moves over 10 charge coupled devices (CCDs) in 45 s and a light curve with 4.5 s sampling (the crossing time per CCD) is registered. Given that the 4.5 s sampling represents a virtually unexplored parameter space in optical time domain astronomy, this data set potentially provides a unique opportunity to open up the fast transient sky. We present a method to start mining the wealth of information in the per CCD Gaia data. We perform extensive data filtering to eliminate known onboard and data processing artefacts, and present a statistical method to identify sources that show transient brightness variations on ≲2 h time-scales. We illustrate that by using the Gaia photometric CCD measurements, we can detect transient brightness variations down to an amplitude of 0.3 mag on time-scales ranging from 15 s to several hours. We search an area of ∼23.5 deg2 on the sky and find four strong candidate fast transients. Two candidates are tentatively classified as flares on M-dwarf stars, while one is probably a flare on a giant star and one potentially a flare on a solar-type star. These classifications are based on archival data and the time-scales involved. We argue that the method presented here can be added to the existing Gaia Science Alerts infrastructure for the near real-time public dissemination of fast transient events.
Students in Advanced Research for Sky Surveillance
National Research Council Canada - National Science Library
Gehrels, Tom
1997-01-01
.... to 2000 sqare degrees of sky are searched each year to a V magnitude level of 21.3. Spacewatch discoveries support studies of the evolution of the Centaur, Trojan, Main-Belt, and Earth-approaching asteroid populations...
Directory of Open Access Journals (Sweden)
Ben Beheshti
2001-01-01
Full Text Available The way in which cytogenetic aberrations develop in prostate cancer (Cap is poorly understood. Spectral karyotype (SKY analysis of Cap cell lines has shown that they have unstable karyotypes and also have features associated with chromosomal instability (CIN. To accurately determine the incidence of de novo structural and numerical aberrations in vitro in Cap, we performed SKY analysis of three independent clones derived from one representative cell line, DU145. The frequent generation of new chromosomal rearrangements and a wide variation in the number of structural aberrations within two to five passages suggested that this cell line exhibited some of the features associated with a CIN phenotype. To study numerical cell-to-cell variation, chromosome 8 aneusomy was assessed in the LNCaP, DU145, and PC-3 cell lines and a patient cohort of 15 Cap primary tumors by interphase fluorescence in situ hybridization (FISH. This analysis showed that a high frequency of numerical alteration affecting chromosome 8 was present in both in vitro and in Cap tissues. In comparison to normal controls, the patient cohort had a statistically significant (P<.05, greater frequency of cells with one and three centromere 8 copies. These data suggest that a CIN-like process may be contributing towards the generation of de novo numerical and structural chromosome abnormalities in Cap.
International Nuclear Information System (INIS)
Yong Ki Chi; Bokyun Seo; Wantae Kim
2015-01-01
Although most of the sky-shine radiation levels in industrial radiography are below regulatory limits, sky-shine radiation could make a valuable contribution to the total radiation level near shielding facility with little shielding and open field without shielding. Therefore sky-shine radiation should be thoroughly predicted and supervised with the ALARA principle. In this study, we simulated sky-shine radiation for mobile irradiators using MCNP and newly suggested the equation for calculating sky-shine radiation. Also these results were applied to developing Korean regulatory guidance about industrial radiography and to recommending the requirement of the facility design, controlled or supervised area at work places. (author)
A SOUTHERN SKY AND GALACTIC PLANE SURVEY FOR BRIGHT KUIPER BELT OBJECTS
International Nuclear Information System (INIS)
Sheppard, Scott S.; Udalski, Andrzej; Kubiak, Marcin; Pietrzynski, Grzegorz; Poleski, Radoslaw; Soszynski, Igor; Szymanski, Michal K.; Ulaczyk, Krzysztof; Trujillo, Chadwick
2011-01-01
About 2500 deg 2 of sky south of declination -25 0 and/or near the Galactic Plane were surveyed for bright outer solar system objects. This survey is one of the first large-scale southern sky and Galactic Plane surveys to detect dwarf planets and other bright Kuiper Belt Objects in the trans-Neptunian region. The survey was able to obtain a limiting R-band magnitude of 21.6. In all, 18 outer solar system objects were detected, including Pluto which was detected near the Galactic center using optimal image subtraction techniques to remove the high stellar density background. Fourteen of the detections were previously unknown trans-Neptunian objects, demonstrating that the southern sky had not been well searched to date for bright outer solar system objects. Assuming moderate albedos, several of the new discoveries from this survey could be in hydrostatic equilibrium and thus could be considered dwarf planets. Combining this survey with previous surveys from the northern hemisphere suggests that the Kuiper Belt is nearly complete to around 21st magnitude in the R band. All the main dynamical classes in the Kuiper Belt are occupied by at least one dwarf-planet-sized object. The 3:2 Neptune resonance, which is the innermost well-populated Neptune resonance, has several large objects while the main outer Neptune resonances such as the 5:3, 7:4, 2:1, and 5:2 do not appear to have any large objects. This indicates that the outer resonances are either significantly depleted in objects relative to the 3:2 resonance or have a significantly different assortment of objects than the 3:2 resonance. For the largest objects (H < 4.5 mag), the scattered disk population appears to have a few times more objects than the main Kuiper Belt (MKB) population, while the Sedna population could be several times more than that of the MKB.
A new generation all-optical Cs BEC
International Nuclear Information System (INIS)
Gustavsson, M.; Haller, E.; Flir, A.; Rojas Kopeinig, G.; Naegerl, H.C.
2006-01-01
Full text: We have recently produced a Cs BEC in a new generation setup. The condensate is formed in a glass cell, allowing maximum optical access and rapid switching of magnetic fields compared to our first Cs BEC experiment. After a pre-cooling stage consisting of a MOT and 3D Raman sideband cooling, we load 10 7 atoms at a temperature of 1.5 μK in a large-volume crossed optical dipole trap, generated by a high power laser diode stack. To reach degeneracy the atoms are transferred to a focused 'dimple' trap where the density is high enough to allow for efficient evaporation. We report on the progress of loading the BEC in an optical lattice, which together with tunable s-wave scattering length and several Feshbach resonances at low magnetic fields will offer many possibilities for exciting experiments towards the complete control of all degrees of freedom for ultracold molecules. The regime of zero scattering length is another interesting area of study. A BEC without perturbing mean-field shifts is ideally suited for a detailed study of Bloch oscillations in the noninteracting regime. It will also be possible to extend and improve previous BEC based experiments to determine the fine structure constant via a measurement of the photon recoil in an atom interferometer. (author)
International Nuclear Information System (INIS)
Liu, Jin Bo; Tang, Xue Ming; Xu, Nan Wei; Bao, Hong Tao
2008-01-01
Vertebral compression fractures (VCFs) are common complications of osteoporosis. The expansion of VCFs with a Sky Bone Expander is a new procedure which improves kyphotic deformities and decreases pain associated with VCFs. The purpose of this study was to investigate the preliminary results for the treatment of painful osteoporotic VCFs with a Sky Bone Expander. Twenty-six patients with pain-causing VCFs were treated with a Sky Bone Expander. This operation involved the percutaneous insertion of the Sky Bone Expander into a fractured vertebral body transpedicularly. Following the expansion, the Sky Bone Expander was contracted and removed, resulting in a cavity to be filled with bone cement. All fractures were analyzed for improvement in sagittal alignment. Clinical complications, pain relief and ambulation status were evaluated 1 day, 1 week, 1 month, and 3 months after the operation. Twenty-four hours after the operation, all the patients treated experienced some degree of pain relief. In addition, no postoperative neurologic complications were noted. The average operative time was 42.4 ± 15.5 min per vertebra. Moreover, an average cement volume of 3.5 mL (range, 2.5 ± 5.0 mL) was injected per vertebra. The average anterior height was 18.4 ± 5.1 mm preoperatively and 20.5 ± 5.3 mm postoperatively (p < 0.01). Furthermore, the average midline height was 15.5 ± 5.2 mm preoperatively and 18.9 ± 4.0 mm postoperatively (p < 0.01). The Cobb angle improved from 18.5 ± 8.2 degrees preoperatively to 9.2 ± 4.0 degrees postoperatively (p < 0.01). The Visual Anabog Scale scores decreased from 7.7 ± 1.8 points preoperatively to 3.1 ± 2.0, 2.9 ± 1.7, 2.6 ± 1.5 and 2.9 ± 11.3 after 1 day, 1 week, 1 month and 3 months after the operation, respectively. Cement extrusion was observed in four patients without any neurologic symptoms. As a result of this study, we can postulate that the expansion of compressed vetrebra with a Sky Bone Expander is a safe and minimally
Sky Glow from Cities: The Army Illumination Model v2
2011-09-01
corresponding to one 10th magnitude star per square degree and will not be pursued further here). Benn and Ellison find that the sky brightness at La Palma ...not have electricity, liquid and pressurized lamps are 23 included. For these latter two, liquid Citronella, lamp oil , liquid paraffin and...Properties; AFGL-TR-79-0214; Air Force Geophysics Laboratory: Hanscom Air Force Base, MA, 1979. 19. Benn, C. R. and Ellison, S. L. La Palma Night-Sky
MonetDB/SQL Meets SkyServer: the Challenges of a Scientific Database.
M.G. Ivanova (Milena); N.J. Nes (Niels); R.A. Goncalves (Romulo); M.L. Kersten (Martin)
2007-01-01
textabstractThis paper presents our experiences in porting the Sloan Digital Sky Survey(SDSS)/ SkyServer to the state-of-the-art open source database system MonetDB/SQL. SDSS acts as a well-documented benchmark for scientific database management. We have achieved a fully functional prototype for the
Darch, Peter T.; Sands, Ashley E.
2016-06-01
Sky surveys, such as the Sloan Digital Sky Survey (SDSS) and the Large Synoptic Survey Telescope (LSST), generate data on an unprecedented scale. While many scientific projects span a few years from conception to completion, sky surveys are typically on the scale of decades. This paper focuses on critical challenges arising from long timescales, and how sky surveys address these challenges.We present findings from a study of LSST, comprising interviews (n=58) and observation. Conceived in the 1990s, the LSST Corporation was formed in 2003, and construction began in 2014. LSST will commence data collection operations in 2022 for ten years.One challenge arising from this long timescale is uncertainty about future needs of the astronomers who will use these data many years hence. Sources of uncertainty include scientific questions to be posed, astronomical phenomena to be studied, and tools and practices these astronomers will have at their disposal. These uncertainties are magnified by the rapid technological and scientific developments anticipated between now and the start of LSST operations.LSST is implementing a range of strategies to address these challenges. Some strategies involve delaying resolution of uncertainty, placing this resolution in the hands of future data users. Other strategies aim to reduce uncertainty by shaping astronomers’ data analysis practices so that these practices will integrate well with LSST once operations begin.One approach that exemplifies both types of strategy is the decision to make LSST data management software open source, even now as it is being developed. This policy will enable future data users to adapt this software to evolving needs. In addition, LSST intends for astronomers to start using this software well in advance of 2022, thereby embedding LSST software and data analysis approaches in the practices of astronomers.These findings strengthen arguments for making the software supporting sky surveys available as open
SkyProbe, monitoring the absolute atmospheric transmission in the optical
Cuillandre, Jean-charles; Magnier, Eugene; Mahoney, William
2011-03-01
Mauna Kea is known for its pristine seeing conditions, but sky transparency can be an issue for science operations since 25% of the night are not photometric, mostly due to high-altitude cirrus. Since 2001, the original single-channel SkyProbe has gathered one exposure every minute during each observing night using a small CCD camera with a very wide field of view (35 sq. deg.) encompassing the region pointed by the telescope for science operations, and exposures long enough (40 seconds) to capture at least 100 stars of Hipparcos' Tychos catalog at high galactic latitudes (and up to 600 stars at low galactic latitudes). A key advantage of SkyProbe over direct thermal infrared imaging detection of clouds, is that it allows an accurate absolute measurement, within 5%, of the true atmospheric absorption by clouds affecting the data being gathered by the telescope's main science instrument. This system has proven crucial for decision making in the CFHT queued service observing (QSO), representing today 80% of the telescope time: science exposures taken in non-photometric conditions are automatically registered for being re-observed later on (at 1/10th of the original exposure time per pointing in the observed filters) to ensure a proper final absolute photometric calibration. The new dual color system (simultaneous B&V bands) will allow a better characterization of the sky properties atop Mauna Kea and will enable a better detection of the thinner cirrus (absorption down to 0.02 mag., i.e. 2%). SkyProbe is operated within the Elixir pipeline, a collection of tools used for handling the CFHT CCD mosaics (CFH12K and MegaCam), from data pre-processing to astrometric and photometric calibration.
Point source detection using the Spherical Mexican Hat Wavelet on simulated all-sky Planck maps
Vielva, P.; Martínez-González, E.; Gallegos, J. E.; Toffolatti, L.; Sanz, J. L.
2003-09-01
We present an estimation of the point source (PS) catalogue that could be extracted from the forthcoming ESA Planck mission data. We have applied the Spherical Mexican Hat Wavelet (SMHW) to simulated all-sky maps that include cosmic microwave background (CMB), Galactic emission (thermal dust, free-free and synchrotron), thermal Sunyaev-Zel'dovich effect and PS emission, as well as instrumental white noise. This work is an extension of the one presented in Vielva et al. We have developed an algorithm focused on a fast local optimal scale determination, that is crucial to achieve a PS catalogue with a large number of detections and a low flux limit. An important effort has been also done to reduce the CPU time processor for spherical harmonic transformation, in order to perform the PS detection in a reasonable time. The presented algorithm is able to provide a PS catalogue above fluxes: 0.48 Jy (857 GHz), 0.49 Jy (545 GHz), 0.18 Jy (353 GHz), 0.12 Jy (217 GHz), 0.13 Jy (143 GHz), 0.16 Jy (100 GHz HFI), 0.19 Jy (100 GHz LFI), 0.24 Jy (70 GHz), 0.25 Jy (44 GHz) and 0.23 Jy (30 GHz). We detect around 27 700 PS at the highest frequency Planck channel and 2900 at the 30-GHz one. The completeness level are: 70 per cent (857 GHz), 75 per cent (545 GHz), 70 per cent (353 GHz), 80 per cent (217 GHz), 90 per cent (143 GHz), 85 per cent (100 GHz HFI), 80 per cent (100 GHz LFI), 80 per cent (70 GHz), 85 per cent (44 GHz) and 80 per cent (30 GHz). In addition, we can find several PS at different channels, allowing the study of the spectral behaviour and the physical processes acting on them. We also present the basic procedure to apply the method in maps convolved with asymmetric beams. The algorithm takes ~72 h for the most CPU time-demanding channel (857 GHz) in a Compaq HPC320 (Alpha EV68 1-GHz processor) and requires 4 GB of RAM memory; the CPU time goes as O[NRoN3/2pix log(Npix)], where Npix is the number of pixels in the map and NRo is the number of optimal scales needed.
International Nuclear Information System (INIS)
Richards, Joseph W.; Starr, Dan L.; Miller, Adam A.; Bloom, Joshua S.; Brink, Henrik; Crellin-Quick, Arien; Butler, Nathaniel R.
2012-01-01
With growing data volumes from synoptic surveys, astronomers necessarily must become more abstracted from the discovery and introspection processes. Given the scarcity of follow-up resources, there is a particularly sharp onus on the frameworks that replace these human roles to provide accurate and well-calibrated probabilistic classification catalogs. Such catalogs inform the subsequent follow-up, allowing consumers to optimize the selection of specific sources for further study and permitting rigorous treatment of classification purities and efficiencies for population studies. Here, we describe a process to produce a probabilistic classification catalog of variability with machine learning from a multi-epoch photometric survey. In addition to producing accurate classifications, we show how to estimate calibrated class probabilities and motivate the importance of probability calibration. We also introduce a methodology for feature-based anomaly detection, which allows discovery of objects in the survey that do not fit within the predefined class taxonomy. Finally, we apply these methods to sources observed by the All-Sky Automated Survey (ASAS), and release the Machine-learned ASAS Classification Catalog (MACC), a 28 class probabilistic classification catalog of 50,124 ASAS sources in the ASAS Catalog of Variable Stars. We estimate that MACC achieves a sub-20% classification error rate and demonstrate that the class posterior probabilities are reasonably calibrated. MACC classifications compare favorably to the classifications of several previous domain-specific ASAS papers and to the ASAS Catalog of Variable Stars, which had classified only 24% of those sources into one of 12 science classes.
Energy Technology Data Exchange (ETDEWEB)
Richards, Joseph W.; Starr, Dan L.; Miller, Adam A.; Bloom, Joshua S.; Brink, Henrik; Crellin-Quick, Arien [Astronomy Department, University of California, Berkeley, CA 94720-3411 (United States); Butler, Nathaniel R., E-mail: jwrichar@stat.berkeley.edu [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States)
2012-12-15
With growing data volumes from synoptic surveys, astronomers necessarily must become more abstracted from the discovery and introspection processes. Given the scarcity of follow-up resources, there is a particularly sharp onus on the frameworks that replace these human roles to provide accurate and well-calibrated probabilistic classification catalogs. Such catalogs inform the subsequent follow-up, allowing consumers to optimize the selection of specific sources for further study and permitting rigorous treatment of classification purities and efficiencies for population studies. Here, we describe a process to produce a probabilistic classification catalog of variability with machine learning from a multi-epoch photometric survey. In addition to producing accurate classifications, we show how to estimate calibrated class probabilities and motivate the importance of probability calibration. We also introduce a methodology for feature-based anomaly detection, which allows discovery of objects in the survey that do not fit within the predefined class taxonomy. Finally, we apply these methods to sources observed by the All-Sky Automated Survey (ASAS), and release the Machine-learned ASAS Classification Catalog (MACC), a 28 class probabilistic classification catalog of 50,124 ASAS sources in the ASAS Catalog of Variable Stars. We estimate that MACC achieves a sub-20% classification error rate and demonstrate that the class posterior probabilities are reasonably calibrated. MACC classifications compare favorably to the classifications of several previous domain-specific ASAS papers and to the ASAS Catalog of Variable Stars, which had classified only 24% of those sources into one of 12 science classes.
Blue Sky Birds Come to the World
Directory of Open Access Journals (Sweden)
Bura Sabiha Kelek
2015-06-01
Full Text Available The New Supply System comes to all fields for logistics.Drone is an unmanned vehicle for loading and unloading packages.Perhaps we can imagine it as a ‘’blue sky bird’’. This new trend has three important impacts that are determined by technoligical capabilities, ,regularity pressure, and public acceptance so that it will be dealed within current powers and circumstances. This kind of vehicles are used in different capacities, such as multicopter,drone or robot.Logistics’ issues are interested in short-term delivery systems for customer satisfaction but all developments go through GPS so it is based on 21st century technological developments, which have been tested on a short-term basis and will be expected to be of use in 2 years. The purpose of this research is to give lead to researchers information about risk and the advantages of using the technology in this manner.Some advantages and disadvantages ,schedules’ problems in the system will be identifed.
A Comprehensive Approach to Dark Skies Research and Education at NOAO
Walker, Constance E.; Pompea, S. M.; Sparks, R. T.
2013-01-01
NOAO and its Education and Public Outreach group play an important role locally, nationally, and internationally in raising dark skies awareness. For the past 3 years NOAO has co-hosted the international “Earth and Sky” photo contest. In 2012 there were over 600 entries contributed within 3 weeks. NOAO also created a series of audio podcasts based on serial-type skits featuring a caped dark-skies hero who typically “saves the night” by mitigating upward directed lights with shields, thereby saving sea turtles, minimizing health effects, conserving energy, or keeping the public safe. To help understand the effects of light pollution, a citizen-science campaign called GLOBE at Night was started seven years ago. The worldwide campaign involves the public in recording night sky brightness data by matching the view of a constellation like Orion with maps of progressively fainter stars. Every year, NOAO adds more opportunities for participation: more campaigns during the year, Web applications for smart phones, objective measurements with sky brightness meters, and a GLOBE at Night Facebook page. Campaigns will run roughly the first 10 days of January through May in 2013. The EPO group created “Dark Skies Rangers”, a suite of well-tested and evaluated hands-on, minds-on activities that have children building star-brightness “readers,” creating glow-in-the-dark tracings to visualize constellations, and role-playing confused sea turtles. They also created a model city with shielded lights to stop upward light, examine different kinds of bulbs for energy efficiency, and perform an outdoor lighting audit of their school or neighborhood to determine ways to save energy. In the REU program at NOAO North, the undergraduate students have been doing research over the last 3 summers on effect of light pollution on endangered bats and characterizing the behavior of sky brightness over time across Tucson and on nearby astronomical mountaintops. For more information
DEFF Research Database (Denmark)
Carter, Adrian
2009-01-01
to rescue architecture from the sterile impasse of late-modernism. In his works the basic elements of lived space become present: the earth, the sky and the `between` of human existence." Jørn Utzon's architecture ranges from the modest to the monumental; from the Kingo courtyard houses, the finest...... of form, material and function, motivated by social values. To this essentially regional response, Utzon combines a fascination for the architectural legacies of foreign cultures. These influences include the architecture of the ancient Mayan civilisation, as well as the Islamic world, China and Japan...
Imaging Polarimeter for a Sub-MeV Gamma-Ray All-sky Survey Using an Electron-tracking Compton Camera
Energy Technology Data Exchange (ETDEWEB)
Komura, S.; Takada, A.; Mizumura, Y.; Miyamoto, S.; Takemura, T.; Kishimoto, T.; Kubo, H.; Matsuoka, Y.; Mizumoto, T.; Nakamasu, Y.; Nakamura, K.; Oda, M.; Parker, J. D.; Sonoda, S.; Tanimori, T.; Tomono, D.; Yoshikawa, K. [Graduate School of Science, Kyoto University, Sakyo, Kyoto 606-8502 (Japan); Kurosawa, S. [New Industry Creation Hatchery Center (NICHe), Tohoku University, Sendai, Miyagi, 980-8579 (Japan); Miuchi, K. [Department of Physics, Kobe University, Kobe, Hyogo, 658-8501 (Japan); Sawano, T., E-mail: komura@cr.scphys.kyoto-u.ac.jp [College of Science and Engineering, School of Mathematics and Physics, Kanazawa University, Kanazawa, Ishikawa, 920-1192 (Japan)
2017-04-10
X-ray and gamma-ray polarimetry is a promising tool to study the geometry and the magnetic configuration of various celestial objects, such as binary black holes or gamma-ray bursts (GRBs). However, statistically significant polarizations have been detected in few of the brightest objects. Even though future polarimeters using X-ray telescopes are expected to observe weak persistent sources, there are no effective approaches to survey transient and serendipitous sources with a wide field of view (FoV). Here we present an electron-tracking Compton camera (ETCC) as a highly sensitive gamma-ray imaging polarimeter. The ETCC provides powerful background rejection and a high modulation factor over an FoV of up to 2 π sr thanks to its excellent imaging based on a well-defined point-spread function. Importantly, we demonstrated for the first time the stability of the modulation factor under realistic conditions of off-axis incidence and huge backgrounds using the SPring-8 polarized X-ray beam. The measured modulation factor of the ETCC was 0.65 ± 0.01 at 150 keV for an off-axis incidence with an oblique angle of 30° and was not degraded compared to the 0.58 ± 0.02 at 130 keV for on-axis incidence. These measured results are consistent with the simulation results. Consequently, we found that the satellite-ETCC proposed in Tanimori et al. would provide all-sky surveys of weak persistent sources of 13 mCrab with 10% polarization for a 10{sup 7} s exposure and over 20 GRBs down to a 6 × 10{sup −6} erg cm{sup −2} fluence and 10% polarization during a one-year observation.
An Investigation of LED Street Lighting's Impact on Sky Glow
Energy Technology Data Exchange (ETDEWEB)
Kinzey, Bruce R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Perrin, Tess E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Miller, Naomi J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Kocifaj, Miroslav [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Aube, Martin [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lamphar, Hector A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2017-04-25
A significant amount of public attention has recently focused on perceived impacts of converting street lighting from incumbent lamp-based products to LED technology. Much of this attention pertains to the higher content of short wavelength light (commonly referred to as "blue light") of LEDs and its attendant influences on sky glow (a brightening of the night sky that can interfere with astronomical observation and may be associated with a host of other issues). The complexity of this topic leads to common misunderstandings and misperceptions among the public, and for this reason the U.S. Department of Energy Solid-State Lighting Program embarked on a study of sky glow using a well-established astronomical model to investigate some of the primary factors influencing sky glow. This report details the results of the investigation and attempts to present those results in terms accessible to the general lighting community. The report also strives to put the results into a larger context, and help educate interested readers on various topics relevant to the issues being discussed.
Directory of Open Access Journals (Sweden)
N. C. Maynard
2004-09-01
Full Text Available We demonstrate that high-resolution 557.7-nm all-sky images are useful tools for investigating the spatial and temporal evolution of merging on the dayside magnetopause. Analysis of ground and satellite measurements leads us to conclude that high-latitude merging events can occur at multiple sites simultaneously and vary asynchronously on time scales of 30s to 3min. Variations of 557.7nm emissions were observed at a 10s cadence at Ny-Ålesund on 19 December 2001, while significant changes in the IMF clock angle were reaching the magnetopause. The optical patterns are consistent with a scenario in which merging occurs around the rim of the high-latitude cusp at positions dictated by the IMF clock angle. Electrons energized at merging sites represent plausible sources for 557.7nm emissions in the cusp. Polar observations at the magnetopause have directly linked enhanced fluxes of ≥0.5keV electrons with merging. Spectra of electrons responsible for some of the emissions, measured during a DMSP F15 overflight, exhibit "inverted-V" features, indicating further acceleration above the ionosphere. SuperDARN spectral width boundaries, characteristic of open-closed field line transitions, are located at the equatorward edge of the 557.7nm emissions. Optical data suggest that with IMF BY>0, the Northern Hemisphere cusp divides into three source regions. When the IMF clock angle was ~150° structured 557.7-nm emissions came from east of the 13:00 MLT meridian. At larger clock angles the emissions appeared between 12:00 and 13:00 MLT. No significant 557.7-nm emissions were detected in the prenoon MLT sector. MHD simulations corroborate our scenario, showing that with the observed large dipole-tilt and IMF clock angles, merging sites develop near the front and eastern portions of the high-altitude cusp rim in the Northern Hemisphere and near the western part of the cusp rim in the Southern Hemisphere.
Sirius brightest diamond in the night sky
Holberg, Jay B
2007-01-01
This book describes why Sirius has been regarded as an important fixture of the night sky since the beginnings of history. It also examines the part that Sirius has played in how we came to achieve our current scientific understanding of stars.
Yamashita, M.; Yoshimura, M.
2018-04-01
Photosynthetic photon flux density (PPFD: µmol m-2 s-1) is indispensable for plant physiology processes in photosynthesis. However, PPFD is seldom measured, so that PPFD has been estimated by using solar radiation (SR: W m-2) measured in world wide. In method using SR, there are two steps: first to estimate photosynthetically active radiation (PAR: W m-2) by the fraction of PAR to SR (PF) and second: to convert PAR to PPFD using the ratio of quanta to energy (Q / E: µmol J-1). PF and Q/E usually have been used as the constant values, however, recent studies point out that PF and Q / E would not be constants under various sky conditions. In this study, we use the numeric data of sky-conditions factors such cloud cover, sun appearance/hiding and relative sky brightness derived from whole-sky image processing and examine the influences of sky-conditions factors on PF and Q / E of global and diffuse PAR. Furthermore, we discuss our results by comparing with the existing methods.
Directory of Open Access Journals (Sweden)
Editorial Board
2009-12-01
Full Text Available All I want for 2010: Brief notes about practical or totally pie-in-the-sky ideas for things we’d like to see happen in our libraries, in libraries in general, or in the profession We thought the New Year would be a good time for us to get together and do another group post; what do we want [...
Microscopic dust in the infrared sky
International Nuclear Information System (INIS)
Leene, A.; Wesselius, P.
1985-01-01
After ten months of observation IRAS (InfraRed Astronomical Satellite) revealed for the first time an infrared sky map. One of its major discovery has been the display of new constituents in Universe: the infrared cirrus which are interstellar clouds constituted of microparticles abounding in carbon. Results and first hypothesis are presented in this article [fr
ESO unveils an amazing, interactive, 360-degree panoramic view of the entire night sky
2009-09-01
The first of three images of ESO's GigaGalaxy Zoom project - a new magnificent 800-million-pixel panorama of the entire sky as seen from ESO's observing sites in Chile - has just been released online. The project allows stargazers to explore and experience the Universe as it is seen with the unaided eye from the darkest and best viewing locations in the world. This 360-degree panoramic image, covering the entire celestial sphere, reveals the cosmic landscape that surrounds our tiny blue planet. This gorgeous starscape serves as the first of three extremely high-resolution images featured in the GigaGalaxy Zoom project, launched by ESO within the framework of the International Year of Astronomy 2009 (IYA2009). GigaGalaxy Zoom features a web tool that allows users to take a breathtaking dive into our Milky Way. With this tool users can learn more about many different and exciting objects in the image, such as multicoloured nebulae and exploding stars, just by clicking on them. In this way, the project seeks to link the sky we can all see with the deep, "hidden" cosmos that astronomers study on a daily basis. The wonderful quality of the images is a testament to the splendour of the night sky at ESO's sites in Chile, which are the most productive astronomical observatories in the world. The plane of our Milky Way Galaxy, which we see edge-on from our perspective on Earth, cuts a luminous swath across the image. The projection used in GigaGalaxy Zoom place the viewer in front of our Galaxy with the Galactic Plane running horizontally through the image - almost as if we were looking at the Milky Way from the outside. From this vantage point, the general components of our spiral galaxy come clearly into view, including its disc, marbled with both dark and glowing nebulae, which harbours bright, young stars, as well as the Galaxy's central bulge and its satellite galaxies. The painstaking production of this image came about as a collaboration between ESO, the renowned
Matthews, Lynn D.; Cappallo, R. J.; Doeleman, S. S.; Fish, V. L.; Lonsdale, C. J.; Oberoi, D.; Wayth, R. B.
2009-05-01
The Square Kilometer Array (SKA) is a proposed next-generation radio telescope that will operate at frequencies of 0.1-30 GHz and be 50-100 times more sensitive than existing radio arrays. Meeting the performance goals of this instrument will require innovative new hardware and software developments, a variety of which are now under consideration. Key to evaluating the performance characteristics of proposed SKA designs and testing the feasibility of new data calibration and processing algorithms is the ability to carry out realistic simulations of radio wavelength arrays under a variety of observing conditions. The MIT Array Performance Simulator (MAPS) (http://www.haystack.mit.edu/ast/arrays/maps/index.html) is an observations simulation package designed to achieve this goal. MAPS accepts an input source list or sky model and generates a model visibility set for a user-defined "virtual observatory'', incorporating such factors as array geometry, primary beam shape, field-of-view, and time and frequency resolution. Optionally, effects such as thermal noise, out-of-beam sources, variable station beams, and time/location-dependent ionospheric effects can be included. We will showcase current capabilities of MAPS for SKA applications by presenting results from an analysis of the effects of realistic sky backgrounds on the achievable image fidelity and dynamic range of SKA-like arrays comprising large numbers of small-diameter antennas.
Mitigation of Volcanic Risk: The COSMO-SkyMed Contribution
Sacco, Patrizia; Daraio, Maria Girolamo; Battagliere, Maria Libera; Coletta, Alessandro
2015-05-01
The Italian Space Agency (ASI) promotes Earth Observation (EO) applications related to themes such as the prediction, monitoring, management and mitigation of natural and anthropogenic hazards. The approach generally followed is the development and demonstration of prototype services, using currently available data from space missions, in particular the COSMO-SkyMed (Constellation of Small Satellites for Mediterranean basin observation) mission, which represents the largest Italian investment in Space System for EO and thanks to which Italy plays a key role worldwide. Projects funded by ASI provide the convergence of various national industry expertise, research and institutional reference users. In this context a significant example is represented by the ASI Pilot Projects, recently concluded, dealing with various thematic, such as volcanoes. In this paper a special focus will be addressed to the volcanic risk management and the contribution provided in this field by COSMO-SkyMed satellite constellation during the last years. A comprehensive overview of the various national and international projects using COSMO-SkyMed data for the volcanic risk mitigation will be given, highlighting the Italian contribution provided worldwide in this operational framework.
Confirmation of gastric tube bedside placement with the sky blue method.
Imamura, Takashi; Maeda, Hajime; Kinoshita, Hidetoshi; Shibukawa, Yasuko; Suda, Kiyomi; Fukuda, Yutaka; Goto, Aya; Nagasawa, Katsutoshi
2014-02-01
The purpose was to review our experiences and determine if applying the sky blue method is reliable in confirming gastric tube (GT) placement in neonates. The study population consisted of 44 infants (55 placements) who were admitted to the Takeda General Hospital between April 2012 and March 2013 and who required GT exchange. The sky blue method using indigo carmine (IC) was indicated for planned tube exchange only. Diluted IC was injected into the gastric space via the old GT just before the tube exchange. The tube was exchanged using a standard method. Then, we checked whether the diluted IC could be collected through the new GT or not. The reasons for GT placement were a gestational age of sky blue method was considered successful in 52 placements (94.4%), with the remaining 3 placements (5.6%) considered to be failures due to the inability to obtain IC from the gastric space. No adverse events were observed during the tube exchange period. Based on the results, the sky blue method can be considered to be reliable method for the confirmation of GT placement. These results also suggest that the number of radiologic evaluations performed to confirm correct replacement of the GT in infants can be reduced in the future.
A new technique for measuring aerosols with moonlight observations and a sky background model
Jones, Amy; Noll, Stefan; Kausch, Wolfgang; Kimeswenger, Stefan; Szyszka, Ceszary; Unterguggenberger, Stefanie
2014-05-01
There have been an ample number of studies on aerosols in urban, daylight conditions, but few for remote, nocturnal aerosols. We have developed a new technique for investigating such aerosols using our sky background model and astronomical observations. With a dedicated observing proposal we have successfully tested this technique for nocturnal, remote aerosol studies. This technique relies on three requirements: (a) sky background model, (b) observations taken with scattered moonlight, and (c) spectrophotometric standard star observations for flux calibrations. The sky background model was developed for the European Southern Observatory and is optimized for the Very Large Telescope at Cerro Paranal in the Atacama desert in Chile. This is a remote location with almost no urban aerosols. It is well suited for studying remote background aerosols that are normally difficult to detect. Our sky background model has an uncertainty of around 20 percent and the scattered moonlight portion is even more accurate. The last two requirements are having astronomical observations with moonlight and of standard stars at different airmasses, all during the same night. We had a dedicated observing proposal at Cerro Paranal with the instrument X-Shooter to use as a case study for this method. X-Shooter is a medium resolution, echelle spectrograph which covers the wavelengths from 0.3 to 2.5 micrometers. We observed plain sky at six different distances (7, 13, 20, 45, 90, and 110 degrees) to the Moon for three different Moon phases (between full and half). Also direct observations of spectrophotometric standard stars were taken at two different airmasses for each night to measure the extinction curve via the Langley method. This is an ideal data set for testing this technique. The underlying assumption is that all components, other than the atmospheric conditions (specifically aerosols and airglow), can be calculated with the model for the given observing parameters. The scattered
Big Sky Carbon Sequestration Partnership
Energy Technology Data Exchange (ETDEWEB)
Susan Capalbo
2005-12-31
has significant potential to sequester large amounts of CO{sub 2}. Simulations conducted to evaluate mineral trapping potential of mafic volcanic rock formations located in the Idaho province suggest that supercritical CO{sub 2} is converted to solid carbonate mineral within a few hundred years and permanently entombs the carbon. Although MMV for this rock type may be challenging, a carefully chosen combination of geophysical and geochemical techniques should allow assessment of the fate of CO{sub 2} in deep basalt hosted aquifers. Terrestrial carbon sequestration relies on land management practices and technologies to remove atmospheric CO{sub 2} where it is stored in trees, plants, and soil. This indirect sequestration can be implemented today and is on the front line of voluntary, market-based approaches to reduce CO{sub 2} emissions. Initial estimates of terrestrial sinks indicate a vast potential for increasing and maintaining soil Carbon (C) on rangelands, and forested, agricultural, and reclaimed lands. Rangelands can store up to an additional 0.05 mt C/ha/yr, while the croplands are on average four times that amount. Estimates of technical potential for soil sequestration within the region in cropland are in the range of 2.0 M mt C/yr over 20 year time horizon. This is equivalent to approximately 7.0 M mt CO{sub 2}e/yr. The forestry sinks are well documented, and the potential in the Big Sky region ranges from 9-15 M mt CO{sub 2} equivalent per year. Value-added benefits include enhanced yields, reduced erosion, and increased wildlife habitat. Thus the terrestrial sinks provide a viable, environmentally beneficial, and relatively low cost sink that is available to sequester C in the current time frame. The Partnership recognizes the critical importance of measurement, monitoring, and verification technologies to support not only carbon trading but all policies and programs that DOE and other agencies may want to pursue in support of GHG mitigation. The efforts
A Novel Virtual Node Hexahedral Element with Exact Integration and Octree Meshing
Directory of Open Access Journals (Sweden)
Logah Perumal
2016-01-01
Full Text Available The method presented in this work is a 3-dimensional polyhedral finite element (3D PFEM based on virtual node method. Novel virtual node polyhedral elements (termed as VPHE are developed here, particularly virtual node hexahedral element (termed as VHE. Stiffness matrices of these polyhedral elements consist of simple polynomials. Thus, a new algorithm is introduced in this paper, which enables exact integration of monomials without a need for high number of integration points and weights. The number of nodes for VHE elements is not restricted, as opposed to the conventional hexahedral elements. This feature enables formulation of transition elements (termed as T-VHE which are useful to adaptive computation. Performances of the new VHE elements in solid mechanics and conductive heat transfer phenomena are examined through numerical simulations. The new T-VHE elements are utilized in octree mesh. The VHE elements are found to produce good results and T-VHE elements help to reduce number of global nodes for the analysis.
Watanabe, S.; Takemura, T.; Sudo, K.; Yokohata, T.; Kawase, H.
2012-06-01
The historical anthropogenic change in the surface all-sky UV-B (solar ultraviolet: 280-315 nm) radiation through 1850-2005 is evaluated using an Earth system model. Responses of UV-B dose to anthropogenic changes in ozone and aerosols are separately evaluated using a series of historical simulations including/excluding these changes. Increases in these air pollutants cause reductions in UV-B transmittance, which occur gradually/rapidly before/after 1950 in and downwind of industrial and deforestation regions. Furthermore, changes in ozone transport in the lower stratosphere, which is induced by increasing greenhouse gas concentrations, increase ozone concentration in the extratropical upper troposphere and lower stratosphere. These transient changes work to decrease the amount of UV-B reaching the Earth's surface, counteracting the well-known effect increasing UV-B due to stratospheric ozone depletion, which developed rapidly after ca. 1980. As a consequence, the surface UV-B radiation change between 1850 and 2000 is negative in the tropics and NH extratropics and positive in the SH extratropics. Comparing the contributions of ozone and aerosol changes to the UV-B change, the transient change in ozone absorption of UV-B mainly determines the total change in the surface UV-B radiation at most locations. On the other hand, the aerosol direct and indirect effects on UV-B play an equally important role to that of ozone in the NH mid-latitudes and tropics. A typical example is East Asia (25° N-60° N and 120° E-150° E), where the effect of aerosols (ca. 70%) dominates the total UV-B change.
DESCQA: Synthetic Sky Catalog Validation Framework
Mao, Yao-Yuan; Uram, Thomas D.; Zhou, Rongpu; Kovacs, Eve; Ricker, Paul M.; Kalmbach, J. Bryce; Padilla, Nelson; Lanusse, François; Zu, Ying; Tenneti, Ananth; Vikraman, Vinu; DeRose, Joseph
2018-04-01
The DESCQA framework provides rigorous validation protocols for assessing the quality of high-quality simulated sky catalogs in a straightforward and comprehensive way. DESCQA enables the inspection, validation, and comparison of an inhomogeneous set of synthetic catalogs via the provision of a common interface within an automated framework. An interactive web interface is also available at portal.nersc.gov/project/lsst/descqa.
Kiehl, J. T.; Briegleb, B. P.
1992-01-01
The clear sky greenhouse effect is defined in terms of the outgoing longwave clear sky flux at the top of the atmosphere. Recently, interest in the magnitude of the clear sky greenhouse effect has increased due to the archiving of the clear sky flux quantity through the Earth Radiation Budget Experiment (ERBE). The present study investigates to what degree of accuracy this flux can be analyzed by using independent atmospheric and surface data in conjunction with a detailed longwave radiation model. The conclusion from this comparison is that for most regions over oceans the analyzed fluxes agree to within the accuracy of the ERBE-retrieved fluxes (+/- 5 W/sq m). However, in regions where deep convective activity occurs, the ERBE fluxes are significantly higher (10-15 W/sq m) than the calculated fluxes. This bias can arise from either cloud contamination problems or variability in water vapor amount. It is argued that the use of analyzed fluxes may provide a more consistent clear sky flux data set for general circulation modeling validation. Climate implications from the analyzed fluxes are explored. Finally, results for obtaining longwave surface fluxes over the oceans are presented.
Analýza sortimentu firmy SkyTech Corporation s.r.o.
Dvořáková, Šárka
2017-01-01
This thesis focuses on small company SkyTech Corporation s.r.o, which distributes products from the field of cosmetic, decorative cosmetic, cosmetic accessories and make-up brushes. The first part is theoretical and serves as basis for elaboration of the practical part. Theoretical part focus on marketing mix, competition, assortment and analysis connected with them. In practical part SkyTech Corporaton s.r.o. is introduced. Than follows the evaluation of individual brands and their roles in ...