International Nuclear Information System (INIS)
Dunham, Miranda K.; Evans, Neal J.; Harvey, Paul; Merello, Manuel; Rosolowsky, Erik; Cyganowski, Claudia J.; Aguirre, James; Bally, John; Battersby, Cara; Ginsburg, Adam; Glenn, Jason; Stringfellow, Guy S.; Bradley, Eric Todd; Dowell, Darren; Drosback, Meredith; Schlingman, Wayne; Shirley, Yancy L.; Walawender, Josh; Williams, Jonathan P.
2010-01-01
We present the 1.1 mm Bolocam Galactic Plane Survey (BGPS) observations of the Gemini OB1 molecular cloud complex, and targeted NH 3 observations of the BGPS sources. When paired with molecular spectroscopy of a dense gas tracer, millimeter observations yield physical properties such as masses, radii, mean densities, kinetic temperatures, and line widths. We detect 34 distinct BGPS sources above 5σ = 0.37 Jy beam -1 with corresponding 5σ detections in the NH 3 (1,1) transition. Eight of the objects show water maser emission (20%). We find a mean millimeter source FWHM of 1.12 pc and a mean gas kinetic temperature of 20 K for the sample of 34 BGPS sources with detections in the NH 3 (1,1) line. The observed NH 3 line widths are dominated by non-thermal motions, typically found to be a few times the thermal sound speed expected for the derived kinetic temperature. We calculate the mass for each source from the millimeter flux assuming the sources are isothermal and find a mean isothermal mass within a 120'' aperture of 230 ± 180 M sun . We find a total mass of 8400 M sun for all BGPS sources in the Gemini OB1 molecular cloud, representing 6.5% of the cloud mass. By comparing the millimeter isothermal mass to the virial mass calculated from the NH 3 line widths within a radius equal to the millimeter source size, we find a mean virial parameter (M vir /M iso ) of 1.0 ± 0.9 for the sample. We find mean values for the distributions of column densities of 1.0 x 10 22 cm -2 for H 2 , and 3.0 x 10 14 cm -2 for NH 3 , giving a mean NH 3 abundance of 3.0 x 10 -8 relative to H 2 . We find volume-averaged densities on the order of 10 3 -10 4 cm -3 . The sizes and densities suggest that in the Gem OB1 region the BGPS is detecting the clumps from which stellar clusters form, rather than smaller, higher density cores where single stars or small multiple systems form.
Li, Yingjie; Li, Fa-Cheng; Xu, Ye; Wang, Chen; Du, Xin-Yu; Yang, Wenjin; Yang, Ji
2018-03-01
We present a large-scale survey of CO outflows in the Gem OB1 molecular cloud complex and its surroundings, using the Purple Mountain Observatory Delingha 13.7 m telescope. A total of 198 outflow candidates were identified over a large area (∼58.5 square degrees), of which 193 are newly detected. Approximately 68% (134/198) are associated with the Gem OB1 molecular cloud complex, including clouds GGMC 1, GGMC 2, BFS 52, GGMC 3, and GGMC 4. Other regions studied are: the Local arm (Local Lynds, West Front), Swallow, Horn, and Remote cloud. Outflow candidates in GGMC 1, BFS 52, and Swallow are mainly located at ring-like or filamentary structures. To avoid excessive uncertainty in distant regions (≳3.8 kpc), we only estimated the physical parameters for clouds in the Gem OB1 molecular cloud complex and in the Local arm. In those clouds, the total kinetic energy and the energy injection rate of the identified outflow candidates are ≲1% and ≲3% of the turbulent energy and the turbulent dissipation rate of each cloud, indicating that the identified outflow candidates cannot provide enough energy to balance turbulence of their host cloud at the scale of the entire cloud (several to dozens of parsecs). The gravitational binding energy of each cloud is ≳135 times the total kinetic energy of the identified outflow candidates within the corresponding cloud, indicating that the identified outflow candidates cannot cause major disruptions to the integrity of their host cloud at the scale of the entire cloud.
Directory of Open Access Journals (Sweden)
Joanna Kosacka
Full Text Available BACKGROUND: Leptin-deficient ob/ob mice are a model of type 2 diabetes induced peripheral neuropathy. Ob/ob mice exhibit obesity, insulin resistance, hyperglycaemia, and alterations of peripheral nerve fibres and endoneural microvessels. Here we test the hypothesis that cartilage oligomeric matrix protein (COMP-Ang-1, a soluble and stabile form of Ang-1 which promotes angiogenesis and nerve growth, improves regeneration of nerve fibres and endoneural microvessels in ob/ob mice. METHODS AND FINDINGS: COMP-Ang-1 (100 ng/ml or NaCl were intraperitoneally (i.p. injected into male (N = 184, 3-month old, ob/ob or ob/+ mice for 7 and 21 days. We measured expression of Nf68, GAP43, Cx32, Cx26, Cx43, and TNFα in sciatic nerves using Western blot analysis. To investigate the inflammation in sciatic nerves, numbers of macrophages and T-cells were counted after immunofluorescence staining. In ultrathin section, number of myelinated/non-mylinated nerve fibers, g-ratio, the thickness of Schwann cell basal lamina and microvessel endothelium were investigated. Endoneural microvessels were reconstructed with intracardial FITC injection. Treatment with COMP-Ang-1 over 21 days significantly reduced fasting blood glucose and plasma cholesterol concentrations compared to saline treated ob/ob mice. In addition, COMP-Ang-1 treatment: 1 up-regulated expression of Nf68 and GAP43; 2 improved expression of gap junction proteins including connexin 32 and 26; 3 suppressed the expression of TNFα and Cx43 and 4 led to decreased macrophage and T-cell infiltration in sciatic nerve of ob/ob mice. The significant changes of sciatic nerve ultrastructure were not observed after 21-day long COMP-Ang-1 treatment. COMP-Ang-1 treated ob/ob mice displayed regeneration of small-diameter endoneural microvessels. Effects of COMP-Ang-1 corresponded to increased phosphorylation of Akt and p38 MAPK upon Tie-2 receptor. CONCLUSIONS: COMP-Ang-1 recovers molecular biomarkers of neuropathy
Star formation in the Monoceros OB1 dark cloud
International Nuclear Information System (INIS)
Margulis, M.S.
1987-01-01
A survey of the Monoceros OB1 dark cloud was made for molecular outflows and young stellar objects. In all, nine molecular outflows and thirty far-infrared sources were identified in a portion of the cloud composed of about 3 x 10 4 M of material. Statistical arguments suggest that 90% of the far-infrared sources actually are young stellar objects embedded in the cloud. If the star formation rate in the Mon OB1 cloud is roughly constant with time, then molecular outflows in the cloud should be able to support it against collapse due to gravity. This suggests that the birthrate of outflows in the solar neighborhood is very high. In fact, regardless of considerations of cloud support, the large number of outflows identified in the Mon OB1 cloud and the propensity of the youngest stellar objects in the cloud to be associated with outflows suggest that outflows have a high birthrate in the solar neighborhood and are part of a common stage in early stellar evolution. The young stellar objects identified in the cloud can be fit into a spectral classification system. Also, the outflow phase in early stellar evolution tends to occur at about the time that young stellar objects lose a large fraction of their circumstellar envelopes
A Deuteration Survey of Starless Clumps in GemOB1 and the First Quadrant
Henrici, Andrew; Shirley, Yancy L.; Svoboda, Brian
2018-01-01
One very strong chemical process in star-forming regions is the fractionation of deuterium in molecules, which results in an increase in the deuterium ratio many orders of magnitude over the ISM [D]/[H] ratio and provides a chemical probe of cold, dense regions. Recent maps of dust continuum emission at (sub)millimeter wavelengths have identified tens of thousands of dense clumps of gas and dust. By comparing these regions to infrared and radio surveys, we have identified starless clump candidates which have no evidence for embedded star formation. These objects represent the earliest phase of star formation throughout the Milky Way. One benefit of the Milky Way surveys is that it is also possible to study the chemistry of entire core and clump populations within a single cloud. We used the 10m Heinrich Hertz Submillimeter Telescope to survey starless clump candidates in the First Quadrant identified from the Bolocam Galactic Plane Survey 1.1 mm continuum in the deuterated molecular transitions of DCO+ 3-2 and N2D+ 3-2. We also survey the entire clump population of the Gemini OB1 molecular cloud. In both surveys, we compared detection statistics and compare deuteration fraction to physical properties of the clumps and their evolutionary stage. High resolution ALMA observations of 9 starless clump candidates of the same lines are used to analyze how the cold deuterated gas is spatially distributed in these clumps.
Alpha-1 adrenoceptors in brown adipose tissue of lean and ob/ob mice
International Nuclear Information System (INIS)
Behrens-Zaror, G.; Himms-Hagen, J.
1986-01-01
Obese (ob/ob) mice have a low capacity to increase thyroxine 5'-deiodinase (T4 5'-D) in brown adipose tissue (BAT) when exposed to cold. This effect is mediated by alpha-1 (A-1) adrenoceptors. The authors objective was to find out whether BAT of the ob/ob mouse has normal A-1 receptors. Saturation analysis of binding of [3H]-WB4101 at 0.05 nM to 10 μM to crude membrane preparations (100,000 g pellets from Polytron homogenates) using the LIGAND program of Munson and Rodbard, showed two populations of binding sites in BAT of lean (+/+, 11-15 wk old) mice. Acute exposure (12 h, 14 0 C) or acclimation to cold (3 wk, 14 0 C) did not alter affinity or concentration of sites. Displacement with yohimbine and prazosin indicated binding of WB4101 to A-1 receptors. Very young (5 wk) lean (+/.) and obese mice had similar affinity constants (lean 0.13 +/- 0.043 and 34.2 +/- 14.9; obese, 0.12 +/- 0.028 and 20.9 +/- 5.48 nM) and concentrations (lean 22.4 +/- 3.8 and 647 +/- 137; obese, 28.6 +/- 4.6 and 547 +/- 105 fmol/mg protein) of sites. Old (1 yr) mice had high affinity sites similar to those in younger animals (KD lean 0.19 +/- 0.028, obese, 0.25 +/- 0.075; Bmax lean, 60.2 +/- 12.1; obese, 63.1 +/- 13.5 fmol/mg protein). The authors conclude that the ob/ob mouse has normal high affinity A-1 receptors in BAT. Anomalous properties of low affinity binding in old ob/ob mice could not be characterized because of high nonspecific binding. BAT of the ob/ob mouse does not lack A-1 receptors but may have a post-receptor alteration in the A-1 adrenoceptor-mediated response
Formation of massive stars in OB associations and giant molecular clouds
International Nuclear Information System (INIS)
Lada, C.J.
1980-01-01
Certain interesting patterns are being perceived in the morphology of the regions which have recently produced massive OB stars. In particular, current evidence seems to favour the notion that the formation of massive stars takes place at the edges and not the centres of large molecular cloud complexes. It is this aspect of the observations that is discussed in the present paper. The phenomena described here will pertain to massive stars only. Specifically, stars with spectral types earlier than B3 will be considered since it is usually only these stars that produce sufficient havoc (e.g., maser sources, CO bright spots, H II regions) to noticeably affect their early environments. The corresponding phenomena for lower mass stars could be entirely different. A review is first presented of what has been learned about the OB star formation process from studies of the visible OB stars themselves. Then, newly derived information pertaining to the most recent episodes of OB star birth in galactic molecular clouds is discussed. Finally, a short discussion of the significance of the results and their implications for possible star formation mechanisms will be made. (U.K.)
Sáinz, Neira; Rodríguez, Amaia; Catalán, Victoria; Becerril, Sara; Ramírez, Beatriz; Lancha, Andoni; Burgos-Ramos, Emma; Gómez-Ambrosi, Javier; Frühbeck, Gema
2012-01-01
Leptin improves insulin sensitivity in skeletal muscle. Our goal was to determine whether proteins controlling GLUT4 traffic are altered by leptin deficiency and in vivo leptin administration in skeletal muscle of wild type and ob/ob mice. Leptin-deficient ob/ob mice were divided in three groups: control, leptin-treated (1 mg/kg/d) and leptin pair-fed ob/ob mice. Microarray analysis revealed that 1,546 and 1,127 genes were regulated by leptin deficiency and leptin treatment, respectively. Among these, we identified 24 genes involved in intracellular vesicle-mediated transport in ob/ob mice. TBC1 domain family, member 1 (Tbc1d1), a negative regulator of GLUT4 translocation, was up-regulated (P = 0.001) in ob/ob mice as compared to wild types. Importantly, leptin treatment reduced the transcript levels of Tbc1d1 (P<0.001) and Tbc1d4 (P = 0.004) in the leptin-treated ob/ob as compared to pair-fed ob/ob animals. In addition, phosphorylation levels of TBC1D1 and TBC1D4 were enhanced in leptin-treated ob/ob as compared to control ob/ob (P = 0.015 and P = 0.023, respectively) and pair-fed ob/ob (P = 0.036 and P = 0.034, respectively) mice. Despite similar GLUT4 protein expression in wild type and ob/ob groups a different immunolocalization of this protein was evidenced in muscle sections. Leptin treatment increased GLUT4 immunoreactivity in gastrocnemius and extensor digitorum longus sections of leptin-treated ob/ob mice. Moreover, GLUT4 protein detected in immunoprecipitates from TBC1D4 was reduced by leptin replacement compared to control ob/ob (P = 0.013) and pair-fed ob/ob (P = 0.037) mice. Our findings suggest that leptin enhances the intracellular GLUT4 transport in skeletal muscle of ob/ob animals by reducing the expression and activity of the negative regulators of GLUT4 traffic TBC1D1 and TBC1D4. PMID:22253718
A survey of formaldehyde in the Cepheus OB3 molecular cloud
International Nuclear Information System (INIS)
Few, R.W.; Cohen, R.J.
1983-01-01
The 1 11 - 1 10 absorption line of formaldehyde at 6-cm wavelength has been surveyed over the region of the Cepheus OB3 molecular cloud, using the Jodrell Bank Mk II radio telescope (beamwidth 9 x 10 arcmin 2 ). The measurements have a velocity resolution of 0.27 km s - 1 and an rms noise level of approx. 0.01 K. The formaldehyde has a very clumpy distribution which is broadly similar to the CO distribution found by Sargent. A total molecular mass of 1.9 x 10 4 solar masses is implied by the formaldehyde measurements. Cepheus A is not the dominant concentration in the formaldehyde map. The most massive formaldehyde concentration is Cepheus C, which has a mass of 3600 solar masses. It appears to be stabilized by rotation. (author)
Radio observations of the CMa OB1 H II regions
International Nuclear Information System (INIS)
Gaylard, M.J.; Kemball, A.J.
1984-01-01
A sensitive 10 0 x 15 0 13-cm map made of the CMa OB1 H II regions' radio emission shows a strong similarity to Hα emission photographs. Sharpless 296 is shown to consist of a prominent central and western arc completed by a weaker southern loop, and with a faint northern bar. The emission is thermal, superimposed over a predominantly non-thermal background. The H142α recombination line has been detected at eight positions in S296, and in S292 and S297. The average electron temperature in S296 is 6900 +- 1300 K. The UV fluxes from the CMa OB1 stars account for the observed emission measures of the H II regions. The H142α 1sr velocities indicate that the ionized material is in contact with the molecular clouds. (author)
Direct Imaging and Spectroscopy of a Young Extrasolar Kuiper Belt in the Nearest OB Association
Currie, Thayne; Lisse, Carey M.; Kuchner, Marc J.; Madhusudhan, Nikku; Kenyon, Scott J.; Thalmann, Christian; Carson, Joseph; Debes, John H.
2015-01-01
We describe the discovery of a bright, young Kuiper belt-like debris disk around HD 115600, a $\\sim$ 1.4--1.5 M$_\\mathrm{\\odot}$, $\\sim$ 15 Myr old member of the Sco-Cen OB Association. Our H-band coronagraphy/integral field spectroscopy from the \\textit{Gemini Planet Imager} shows the ring has a (luminosity scaled) semi major axis of ($\\sim$ 22 AU) $\\sim$ 48 AU, similar to the current Kuiper belt. The disk appears to have neutral scattering dust, is eccentric (e $\\sim$ 0.1--0.2), and could b...
G 126.1-0.8-14: A molecular shell related to Sh2-187
Cichowolski, S.; Pineault, S.; Gamen, R.; Ortega, M. E.; Arnal, E. M.; Suad, L. A.
2014-10-01
We present a multi-wavelength study of a region where a well defined molecular shell, named G 126.1-0.8-14, is observed. The distance of G 126.1-0.8-14 is about 1 kpc. Based on HI and CO data we analyze the atomic and molecular gas related to the structure and estimate its main physical properties. From the radio continuum and infrared data we analyze whether the emission associated with G 126.1-0.8-14 has a thermal origin. To disentangle the possible origin of the shell, and given the lack of catalogued O-type stars in the area, we observed with GEMINI the spectra of four OB stars located in projection inside the shell, to get their accurate spectral types and distances. The young HII region Sh2-187 is located onto the densest part of this molecular shell. A search for young stellar object candidates (cYSOs) was made using infrared point source catalogs. Several cYSOs are found spread out onto the shell. Based on all the available data, we discuss the possible origin of G 126.1-0.8-14 as well as its role in the formation of a new generation of stars.
Study of clumping in the Cepheus OB 3 molecular cloud
International Nuclear Information System (INIS)
Carr, J.S.
1987-01-01
A portion of the Cep OB 3 molecular cloud has been mapped in the (C-13)O (1-0) line on a completely sampled grid with a 1.5-arcmin spacing. A total of 45 individual clouds, or clumps, have been identified in the map, with masses from 3 to 300 solar mass, sizes 3 pc or smaller, and mean densities of a few hundred/cu cm. Power-law correlations are found among the clump properties, namely, M proportional to R exp 2.5 and Delta(v) exp 0.24. These exponents differ somewhat from those found for similar correlations for molecular clouds in previous studies. Determination of the virial masses for the clumps shows that the clumps are not gravitationally bound and must be expanding on a time scale of about 1 Myr. Measurements of the (C-13)O (2-1) line give volume densities of 2000-5000. Comparisons of these densities with the mean volume densities from the (C-13)O (1-0) data suggest that the gas is clumped on a small scale with a volume filling factor of 0.04-0.10. 31 references
Pazos, Gonzalo; Rivadulla, Marcos L; Pérez-García, Xenxo; Gandara, Zoila; Pérez, Manuel
2014-01-01
The Gemini analogs are the last significant contribution to the family of vitamin D derivatives in medicine, for the treatment of cancer. The first Gemini analog was characterized by two symmetric side chains at C-20. Following numerous modifications, the most active analog bears a C-23-triple bond, C-26, 27- hexafluoro substituents on one side chain and a terminal trideuteromethylhydroxy group on the other side chain. This progression was possible due to improvements in the synthetic methods for the preparation of these derivatives, which allowed for increasing molecular complexity and complete diastereoselective control at C-20 and the substituted sidechains.
Sequential formation of subgroups in OB associations
International Nuclear Information System (INIS)
Elmegreen, B.G.; Lada, C.J.
1977-01-01
We reconsider the structure and formation of OB association in view of recent radio and infrared observations of the adjacent molecular clouds. As a result of this reexamination, we propose that OB subgroups are formed in a step-by-step process which involves the propagation of ionization (I) and shock (S) fronts through a molecular cloud complex. OB stars formed at the edge of a molecular cloud drive these I-S fronts into the cloud. A layer of dense neutral material accumulates between the I and S fronts and eventually becomes gravitationally unstable. This process is analyzed in detail. Several arguments concerning the temperature and mass of this layer suggest that a new OB subgroup will form. After approximately one-half million years, these stars will emerge from and disrupt the star-forming layer. A new shock will be driven into the remaining molecular cloud and will initiate another cycle of star formation.Several observed properties of OB associations are shown to follow from a sequential star-forming mechanism. These include the spatial separation and systematic differences in age of OB subgroups in a given association, the regularity of subgroup masses, the alignment of subgroups along the galactic plane, and their physical expansion. Detailed observations of ionization fronts, masers, IR sources, and molecular clouds are also in agreement with this model. Finally, this mechanism provides a means of dissipating a molecular cloud and exposing less massive stars (e.g., T Tauri stars) which may have formed ahead of the shock as part of the original cloud collapsed and fragmented
Into the Darkness: Interstellar Extinction Near the Cepheus OB3 Molecular Cloud
Fitzpatrick, Edward L.; Jacklin, S.; Massa, D.
2014-01-01
We present the results of a followup investigation to a study performed by Massa and Savage (1984, ApJ, 279, 310) of the properties of UV interstellar extinction in the region of the Cepheus OB3 molecular cloud. That study was performed using UV photometry and spectro-photometry from the ANS and IUE satellites. We have extended this study into the IR, utilizing the uniform database of IR photometry available from the 2MASS project. This is a part of a larger program whose goal is to study the properties of extinction in localized regions, where we hope to find clues to dust grain growth and destruction processes through spatial correlations of extinction with distinct environmental properties. Similarly to Massa and Savage’s UV results, we find that the IR extinction properties on the Cepheus OB3 region vary systematically with the apparent proximity of the target stars to the molecular cloud. We also find that the UV extinction and the IR extinction are crudely correlated. The methodology leading to these results and their implications are discussed.
1965-01-01
The insignia of the Gemini space program is a disc of dark blue as a background for a gold Zodiac Gemini symbol. A white star on each of the two vertical curves of the Gemini symbol represent the Gemini twins, Pollux and Castor.
Structural anatomy of telomere OB proteins.
Horvath, Martin P
2011-10-01
Telomere DNA-binding proteins protect the ends of chromosomes in eukaryotes. A subset of these proteins are constructed with one or more OB folds and bind with G+T-rich single-stranded DNA found at the extreme termini. The resulting DNA-OB protein complex interacts with other telomere components to coordinate critical telomere functions of DNA protection and DNA synthesis. While the first crystal and NMR structures readily explained protection of telomere ends, the picture of how single-stranded DNA becomes available to serve as primer and template for synthesis of new telomere DNA is only recently coming into focus. New structures of telomere OB fold proteins alongside insights from genetic and biochemical experiments have made significant contributions towards understanding how protein-binding OB proteins collaborate with DNA-binding OB proteins to recruit telomerase and DNA polymerase for telomere homeostasis. This review surveys telomere OB protein structures alongside highly comparable structures derived from replication protein A (RPA) components, with the goal of providing a molecular context for understanding telomere OB protein evolution and mechanism of action in protection and synthesis of telomere DNA.
Glucose metabolism and recycling by hepatocytes of OB/OB and ob/ob mice
International Nuclear Information System (INIS)
Lahtela, J.T.; Wals, P.A.; Katz, J.
1990-01-01
Hepatocytes were prepared from livers of ob/ob (obese diabetic) mice and their lean (OB/OB) siblings that had been fasted for 24 h. The hepatocytes were incubated with [U-14C, 2-3H]-, [U-14C, 3-3H]-, and [U-14C, 6-3H]glucose at concentrations from 20 to 120 mM. 14C was recovered mainly in CO2, glycogen, and lactate. Tritium was recovered in water and glycogen. The yield in labeled products from [2-3H]glucose ranged from two to three times that from [U-14C]glucose. The yields from [3-3H]- and [6-3H]glucose were similar, and 1.3-1.7 times that from [U-14C]glucose. At 40 mM, total utilization of glucose by obese mice was about twice that for lean mice, but there was little difference at 120 mM. The rate of recycling between glucose and glucose 6-phosphate was calculated. An equation to calculate the rate of recycling of glucose from the 2-3H/U-14C ratio in glycogen is derived in the APPENDIX. Our results show that (1) the utilization of glucose by hepatocytes from obese diabetic mice exceeds that of their lean controls, (2) the rate of glucose phosphorylation in both groups greatly exceeds glucose uptake and the rate of glycogen synthesis, (3) glucose phosphorylation represents a difference between a high glucokinase rate and hydrolysis of glucose 6-phosphate, and (4) recycling of glucose carbon between glucose 6-phosphate and pyruvate occurs within mouse hepatocytes
Dicationic alkylammonium bromide gemini surfactants. Membrane perturbation and skin irritation.
Directory of Open Access Journals (Sweden)
João A S Almeida
Full Text Available Dicationic alkylammonium bromide gemini surfactants represent a class of amphiphiles potentially effective as skin permeation enhancers. However, only a limited number of studies has been dedicated to the evaluation of the respective cytotoxicity, and none directed to skin irritation endpoints. Supported on a cell viability study, the cytotoxicity of gemini surfactants of variable tail and spacer length was assessed. For this purpose, keratinocyte cells from human skin (NCTC 2544 cell line, frequently used as a model for skin irritation, were employed. The impact of the different gemini surfactants on the permeability and morphology of model vesicles was additionally investigated by measuring the leakage of calcein fluorescent dye and analyzing the NMR spectra of ³¹P, respectively. Detail on the interaction of gemini molecules with model membranes was also provided by a systematic differential scanning calorimetry (DSC and molecular dynamics (MD simulation. An irreversible impact on the viability of the NCTC 2544 cell line was observed for gemini concentrations higher than 25 mM, while no cytotoxicity was found for any of the surfactants in a concentration range up to 10 mM. A higher cytotoxicity was also found for gemini surfactants presenting longer spacer and shorter tails. The same trend was obtained in the calorimetric and permeability studies, with the gemini of longest spacer promoting the highest degree of membrane destabilization. Additional structural and dynamical characterization of the various systems, obtained by ³¹P NMR and MD, provide some insight on the relationship between the architecture of gemini surfactants and the respective perturbation mechanism.
Peripheral nervous system insulin resistance in ob/ob mice
2013-01-01
Background A reduction in peripheral nervous system (PNS) insulin signaling is a proposed mechanism that may contribute to sensory neuron dysfunction and diabetic neuropathy. Neuronal insulin resistance is associated with several neurological disorders and recent evidence has indicated that dorsal root ganglion (DRG) neurons in primary culture display altered insulin signaling, yet in vivo results are lacking. Here, experiments were performed to test the hypothesis that the PNS of insulin-resistant mice displays altered insulin signal transduction in vivo. For these studies, nondiabetic control and type 2 diabetic ob/ob mice were challenged with an intrathecal injection of insulin or insulin-like growth factor 1 (IGF-1) and downstream signaling was evaluated in the DRG and sciatic nerve using Western blot analysis. Results The results indicate that insulin signaling abnormalities documented in other “insulin sensitive” tissues (i.e. muscle, fat, liver) of ob/ob mice are also present in the PNS. A robust increase in Akt activation was observed with insulin and IGF-1 stimulation in nondiabetic mice in both the sciatic nerve and DRG; however this response was blunted in both tissues from ob/ob mice. The results also suggest that upregulated JNK activation and reduced insulin receptor expression could be contributory mechanisms of PNS insulin resistance within sensory neurons. Conclusions These findings contribute to the growing body of evidence that alterations in insulin signaling occur in the PNS and may be a key factor in the pathogenesis of diabetic neuropathy. PMID:24252636
Leptin differentially regulate STAT3 activation in ob/ob mouse adipose mesenchymal stem cells
Directory of Open Access Journals (Sweden)
Zhou Zhou
2012-12-01
Full Text Available Abstract Background Leptin-deficient ob/ob mice exhibit adipocyte hypertrophy and hyperplasia as well as elevated adipose tissue and systemic inflammation. Multipotent stem cells isolated from adult adipose tissue can differentiate into adipocytes ex vivo and thereby contribute toward increased adipocyte cell numbers, obesity, and inflamm ation. Currently, information is lacking regarding regulation of adipose stem cell numbers as well as leptin-induced inflammation and its signaling pathway in ob/ob mice. Methods Using leptin deficient ob/ob mice, we investigated whether leptin injection into ob/ob mice increases adipose stem cell numbers and adipose tissue inflammatory marker MCP-1 mRNA and secretion levels. We also determined leptin mediated signaling pathways in the adipose stem cells. Results We report here that adipose stem cell number is significantly increased following leptin injection in ob/ob mice and with treatment of isolated stem cells with leptin in vitro. Leptin also up-regulated MCP-1 secretion in a dose- and time-dependent manner. We further showed that increased MCP-1 mRNA levels were due to increased phosphorylation of Signal Transducer and Activator of Transcription 3 (STAT3 Ser727 but not STAT3 Tyr705 phosphorylation, suggesting differential regulation of MCP-1 gene expression under basal and leptin-stimulated conditions in adipose stem cells. Conclusions Taken together, these studies demonstrate that leptin increases adipose stem cell number and differentially activates STAT3 protein resulting in up-regulation of MCP-1 gene expression. Further studies of mechanisms mediating adipose stem cell hyperplasia and leptin signaling in obesity are warranted and may help identify novel anti-obesity target strategies.
New Results on the Nearest OB Association: Sco-Cen (Sco OB2)
Mamajek, Eric E.
2013-01-01
The Scorpius-Centaurus OB association (Sco OB2) is the nearest site of recent massive star formation to the Sun. The primary stellar groups in the Sco-Cen complex (including OB subgroups Upper Sco, Upper Cen Lup, and Lower Cen Cru, the neighboring molecular cloud complexes Lup, Cha, CrA, Oph, and dispersed young groups Eta Cha, Epsilon Cha, TW Hya, and Beta Pic) have been participants in a complex episode of stellar birth (and some stellar death) over the past ~20 Myr. Here I summarize some recent results on the Sco-Cen complex from the U. Rochester group: (1) isochronal analysis of the HR diagram positions for >1 Msun stars in the Upper Scorpius subgroup shows it to be twice as old as previously thought (11 Myr vs. 5 Myr), (2) analysis of high resolution optical echelle spectra show that the subgroups are approximately solar in composition, (3) surveys for lower mass members are showing that the complex shows more substructure than previously recognized, including at least one new subgroup ("Lower Sco"), and the velocity and age data for the nearest OB subgroup Lower Cen Cru argue for a bifurcation into a younger 10 Myr) southern part ("Crux") and an older 20 Myr) northern part ("Lower Centaurus"), (4) an eclipsing, multi-ring dust disk system was serendipitously discovered in the SuperWASP and ASAS light curve for the newly discovered K5-type Sco-Cen member 1SWASP J140747.93-394542.6. With regard to some recent results by other investigators, we find that (1) attempts by some authors to subsume the Sco-Cen subgroups into a single sample of a single age are unnecessarily mixing samples with a wide range in ages, and (2) I have been unable to replicate the expansion age determinations claimed by some investigators for the TW Hya and Beta Pic groups (both purported to have expansion ages of 8 and 12 Myr, respectively), which have been used by some investigators to independently age-date the Sco-Cen subgroups. We acknowledge support from NSF grant AST-1008908 and the
A M2FS Spectroscopic Study of Low-mass Young Stars in Orion OB1
Kaleida, Catherine C.; Briceno, Cesar; Calvet, Nuria; Mateo, Mario L.; Hernandez, Jesus
2015-01-01
Surveys of pre-main sequence stars in the ~4-10 Myr range provide a window into the decline of the accretion phase of stars and the formation of planets. Nearby star clusters and stellar associations allow for the study of these young stellar populations all the way down to the lowest mass members. One of the best examples of nearby 4-10 Myr old stellar populations is the Orion OB1 association. The CIDA Variability Survey of Orion OB1 (CVSO - Briceño et al. 2001) has used the variability properties of low-mass pre-main-sequence (PMS) stars to identify hundreds of K and M-type stellar members of the Orion OB1 association, a number of them displaying IR-excess emission and thought to be representative of more evolved disk-bearing young stars. Characterizing these young, low-mass objects using spectroscopy is integral to understanding the accretion phase in young stars. We present preliminary results of a spectroscopic survey of candidate and confirmed Orion OB1 low-mass members taken during November 2014 and February 2014 using the Michigan/Magellan Fiber Spectrograph (M2FS), a PI instrument on the Magellan Clay Telescope (PI: M. Matteo). Target fields located in the off-cloud regions of Orion were identified in the CVSO, and observed using the low and high-resolution modes of M2FS. Both low and high-resolution spectra are needed in order to confirm membership and derive masses, ages, kinematics and accretion properties. Initial analysis of these spectra reveal many new K and M-type members of the Orion OB1 association in these low extinction, off-cloud areas. These are the more evolved siblings of the youngest stars still embedded in the molecular clouds, like those in the Orion Nebula Cluster. With membership and spectroscopic indicators of accretion we are building the most comprehensive stellar census of this association, enabling us to derive a robust estimate of the fraction of young stars still accreting at a various ages, a key constraint for the end of
Cordyceps militaris alleviates non-alcoholic fatty liver disease in ob/ob mice.
Choi, Ha-Neul; Jang, Yang-Hee; Kim, Min-Joo; Seo, Min Jeong; Kang, Byoung Won; Jeong, Yong Kee; Kim, Jung-In
2014-04-01
Non-alcoholic fatty liver disease (NAFLD) is becoming an important public health problem as metabolic syndrome and type 2 diabetes have become epidemic. In this study we investigated the protective effect of Cordyceps militaris (C. militaris) against NAFLD in an obese mouse model. Four-week-old male ob/ob mice were fed an AIN-93G diet or a diet containing 1% C. militaris water extract for 10 weeks after 1 week of adaptation. Serum glucose, insulin, free fatty acid (FFA), alanine transaminase (ALT), and proinflammatory cytokines were measured. Hepatic levels of lipids, glutathione (GSH), and lipid peroxide were determined. Consumption of C. militaris significantly decreased serum glucose, as well as homeostasis model assessment for insulin resistance (HOMA-IR), in ob/ob mice. In addition to lowering serum FFA levels, C. militaris also significantly decreased hepatic total lipids and triglyceride contents. Serum ALT activities and tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6) levels were reduced by C. militaris. Consumption of C. militaris increased hepatic GSH and reduced lipid peroxide levels. These results indicate that C. militaris can exert protective effects against development of NAFLD, partly by reducing inflammatory cytokines and improving hepatic antioxidant status in ob/ob mice.
GEO-ENGINEERING MODELING THROUGH INTERNET INFORMATICS (GEMINI)
Energy Technology Data Exchange (ETDEWEB)
W. Lynn Watney; John H. Doveton
2004-05-13
GEMINI (Geo-Engineering Modeling through Internet Informatics) is a public-domain web application focused on analysis and modeling of petroleum reservoirs and plays (http://www.kgs.ukans.edu/Gemini/index.html). GEMINI creates a virtual project by ''on-the-fly'' assembly and analysis of on-line data either from the Kansas Geological Survey or uploaded from the user. GEMINI's suite of geological and engineering web applications for reservoir analysis include: (1) petrofacies-based core and log modeling using an interactive relational rock catalog and log analysis modules; (2) a well profile module; (3) interactive cross sections to display ''marked'' wireline logs; (4) deterministic gridding and mapping of petrophysical data; (5) calculation and mapping of layer volumetrics; (6) material balance calculations; (7) PVT calculator; (8) DST analyst, (9) automated hydrocarbon association navigator (KHAN) for database mining, and (10) tutorial and help functions. The Kansas Hydrocarbon Association Navigator (KHAN) utilizes petrophysical databases to estimate hydrocarbon pay or other constituent at a play- or field-scale. Databases analyzed and displayed include digital logs, core analysis and photos, DST, and production data. GEMINI accommodates distant collaborations using secure password protection and authorized access. Assembled data, analyses, charts, and maps can readily be moved to other applications. GEMINI's target audience includes small independents and consultants seeking to find, quantitatively characterize, and develop subtle and bypassed pays by leveraging the growing base of digital data resources. Participating companies involved in the testing and evaluation of GEMINI included Anadarko, BP, Conoco-Phillips, Lario, Mull, Murfin, and Pioneer Resources.
VizieR Online Data Catalog: The Gemini Observation Log (CADC, 2001-)
Association of Universities For Research in Astronomy
2018-01-01
This database contains a log of the Gemini Telescope observations since 2001, managed by the Canadian Astronomical Data Center (CADC). The data are regularly updated (see the date of the last version at the end of this file). The Gemini Observatory consists of twin 8.1-meter diameter optical/infrared telescopes located on two of the best observing sites on the planet. From their locations on mountains in Hawai'i and Chile, Gemini Observatory's telescopes can collectively access the entire sky. Gemini is operated by a partnership of five countries including the United States, Canada, Brazil, Argentina and Chile. Any astronomer in these countries can apply for time on Gemini, which is allocated in proportion to each partner's financial stake. (1 data file).
Gemini flies! unmanned flights and the first manned mission
Shayler, David J
2018-01-01
In May 1961, President John F. Kennedy committed the United States to landing a man on the moon before the end of the decade. With just a handful of years to pull it off, NASA authorized the Project Gemini space program, which gathered vital knowledge needed to achieve the nation’s goal. This book introduces the crucial three-step test program employed by the Gemini system, covering: The short unmanned orbital flight of Gemini 1 that tested the compatibility of launch vehicle, spacecraft and ground systems. The unmanned suborbital flight of Gemini 2 to establish the integrity of the reentry system and protective heat shield. The three-orbit manned evaluation flight of Gemini 3, christened ‘Molly Brown’ by her crew. A mission recalled orbit by orbit, using mission transcripts, post-flight reports and the astronauts’ own account of their historic journey. The missions of Project Gemini was the pivotal steppingstone between Project Mercury and the Apollo Program. Following the success of its fi...
Impaired Muscle Regeneration in Ob/ob and Db/db Mice
Directory of Open Access Journals (Sweden)
Mai-Huong Nguyen
2011-01-01
Full Text Available In obesity and type 2 diabetes, efficient skeletal muscle repair following injury may be required, not only for restoring muscle structure and function, but also for maintaining exercise capacity and insulin sensitivity. The hypothesis of this study was that muscle regeneration would be impaired in ob/ob and db/db mice, which are common mouse models of obesity and type 2 diabetes. Muscle injury was produced by cardiotoxin injection, and regeneration was assessed by morphological and immunostaining techniques. Muscle regeneration was delayed in ob/ob and db/db mice, but not in a less severe model of insulin resistance – feeding a high-fat diet to wild-type mice. Angiogenesis, cell proliferation, and myoblast accumulation were also impaired in ob/ob and db/db mice, but not the high-fat diet mice. The impairments in muscle regeneration were associated with impaired macrophage accumulation; macrophages have been shown previously to be required for efficient muscle regeneration. Impaired regeneration in ob/ob and db/db mice could be due partly to the lack of leptin signaling, since leptin is expressed both in damaged muscle and in cultured muscle cells. In summary, impaired muscle regeneration in ob/ob and db/db mice was associated with reduced macrophage accumulation, angiogenesis, and myoblast activity, and could have implications for insulin sensitivity in the skeletal muscle of obese and type 2 diabetic patients.
The orexigenic hormone ghrelin is important in diabetes because it has an inhibitory effect on insulin secretion. Ghrelin ablation in leptin-deficient ob/ob (Ghrelin(-/-):ob/ob) mice increases insulin secretion and improves hyperglycemia. The physiologically relevant ghrelin receptor is the growth ...
HSL Attenuates the Follicular Oxidative Stress and Enhances the Hair Growth in ob/ob Mice
Directory of Open Access Journals (Sweden)
Takeo Minematsu, PhD
2013-10-01
Full Text Available Summary: We demonstrated enhanced hair regeneration following topical administration of N-(3-oxododecanoyl-L-homoserine lactone (HSL in ob/ob mice. The ob/ob mice showed delayed hair regeneration (more than 6 wk after depilation, which rapidly induced transition to anagen in the hair cycle in wild-type mice. Vehicle and HSL solutions were applied to the depilated dorsal skin of ob/ob mice. The depilated skin of the HSL-treated mice was fully covered with hair, whereas no macroscopic alteration was observed in vehicle-treated group by the fourth week after depilation. Oxidative stress was drastically decreased and the expression of the antioxidative enzymes PON1 and PON3 was increased in the HSL-treated skin with highly proliferative anagen follicles. These results suggest that HSL is a candidate therapeutic agent for alopecia in metabolic syndrome.
Genetically obese (ob/ob) mice are resistant to the lethal effects of thioacetamide hepatotoxicity
International Nuclear Information System (INIS)
Won, Young-Suk; Song, Ji-Won; Lim, Jong-Hwan; Lee, Mee-Young; Moon, Og-Sung; Kim, Hyoung-Chin; Son, Hwa-Young; Kwon, Hyo-Jung
2016-01-01
Obesity increases the risk of chronic liver diseases, including viral hepatitis, alcohol-induced liver disease, and non-alcoholic steatohepatitis. In this study, we investigated the effects of obesity in acute hepatic failure using a murine model of thioacetamide (TA)-induced liver injury. Genetically obese ob/ob mice, together with non-obese ob/+ littermates, were subjected to a single intraperitoneal injection of TA, and examined for signs of hepatic injury. ob/ob mice showed a significantly higher survival rate, lower levels of serum alanine aminotransferase and aspartate aminotransferase, and less hepatic necrosis and apoptosis, compared with ob/+ mice. In addition, ob/ob mice exhibited significantly lower levels of malondialdehyde and significantly higher levels of glutathione and antioxidant enzyme activities compared with their ob/+ counterparts. Bioactivation analyses revealed reduced plasma clearance of TA and covalent binding of [ 14 C]TA to liver macromolecules in ob/ob mice. Together, these data demonstrate that genetically obese mice are resistant to TA-induced acute liver injury through diminished bioactivation of TA and antioxidant effects. - Highlights: • ob/ob mice are resistant to lethal doses of thioacetamide, compared to ob/+ mice. • ob/ob mice show reduced oxidative stress and enhanced antioxidant enzyme activity. • ob/ob mice exhibit diminished bioactivation of thioacetamide.
Genetically obese (ob/ob) mice are resistant to the lethal effects of thioacetamide hepatotoxicity
Energy Technology Data Exchange (ETDEWEB)
Won, Young-Suk [Laboratory Animal Resource Center, Korea Research Institute of Bioscience and Biotechnology, Chungbuk (Korea, Republic of); Song, Ji-Won [Department of Veterinary Pathology, College of Veterinary Medicine, Chungnam National University, Daejeon (Korea, Republic of); Lim, Jong-Hwan [Huons Research Center, Gyonggido (Korea, Republic of); Lee, Mee-Young [Herbal Medicine Formulation Research Group, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Moon, Og-Sung; Kim, Hyoung-Chin [Laboratory Animal Resource Center, Korea Research Institute of Bioscience and Biotechnology, Chungbuk (Korea, Republic of); Son, Hwa-Young [Department of Veterinary Pathology, College of Veterinary Medicine, Chungnam National University, Daejeon (Korea, Republic of); Kwon, Hyo-Jung, E-mail: hyojung@cnu.ac.kr [Department of Veterinary Pathology, College of Veterinary Medicine, Chungnam National University, Daejeon (Korea, Republic of)
2016-01-15
Obesity increases the risk of chronic liver diseases, including viral hepatitis, alcohol-induced liver disease, and non-alcoholic steatohepatitis. In this study, we investigated the effects of obesity in acute hepatic failure using a murine model of thioacetamide (TA)-induced liver injury. Genetically obese ob/ob mice, together with non-obese ob/+ littermates, were subjected to a single intraperitoneal injection of TA, and examined for signs of hepatic injury. ob/ob mice showed a significantly higher survival rate, lower levels of serum alanine aminotransferase and aspartate aminotransferase, and less hepatic necrosis and apoptosis, compared with ob/+ mice. In addition, ob/ob mice exhibited significantly lower levels of malondialdehyde and significantly higher levels of glutathione and antioxidant enzyme activities compared with their ob/+ counterparts. Bioactivation analyses revealed reduced plasma clearance of TA and covalent binding of [{sup 14}C]TA to liver macromolecules in ob/ob mice. Together, these data demonstrate that genetically obese mice are resistant to TA-induced acute liver injury through diminished bioactivation of TA and antioxidant effects. - Highlights: • ob/ob mice are resistant to lethal doses of thioacetamide, compared to ob/+ mice. • ob/ob mice show reduced oxidative stress and enhanced antioxidant enzyme activity. • ob/ob mice exhibit diminished bioactivation of thioacetamide.
Directory of Open Access Journals (Sweden)
Michael J J Chu
Full Text Available BACKGROUND: Hepatic steatosis is a major risk factor for graft failure in liver transplantation. Hepatic steatosis shows a greater negative influence on graft function following prolonged cold ischaemia. As the impact of steatosis on hepatocyte metabolism during extended cold ischaemia is not well-described, we compared markers of metabolic capacity and mitochondrial function in steatotic and lean livers following clinically relevant durations of cold preservation. METHODS: Livers from 10-week old leptin-deficient obese (ob/ob, n = 9 and lean C57 mice (n = 9 were preserved in ice-cold University of Wisconsin solution. Liver mitochondrial function was then assessed using high resolution respirometry after 1.5, 3, 5, 8, 12, 16 and 24 hours of storage. Metabolic marker enzymes for anaerobiosis and mitochondrial mass were also measured in conjunction with non-bicarbonate tissue pH buffering capacity. RESULTS: Ob/ob and lean mice livers showed severe (>60% macrovesicular and mild (<30% microvesicular steatosis on Oil Red O staining, respectively. Ob/ob livers had lower baseline enzymatic complex I activity but similar adenosine triphosphate (ATP levels compared to lean livers. During cold storage, the respiratory control ratio and complex I-fueled phosphorylation deteriorated approximately twice as fast in ob/ob livers compared to lean livers. Ob/ob livers also demonstrated decreased ATP production capacities at all time-points analyzed compared to lean livers. Ob/ob liver baseline lactate dehydrogenase activities and intrinsic non-bicarbonate buffering capacities were depressed by 60% and 40%, respectively compared to lean livers. CONCLUSIONS: Steatotic livers have impaired baseline aerobic and anaerobic capacities compared to lean livers, and mitochondrial function indices decrease particularly from after 5 hours of cold preservation. These data provide a mechanistic basis for the clinical recommendation of shorter cold storage durations in
Remote monitoring: An implementation on the Gemini System
International Nuclear Information System (INIS)
Sheridan, R.; Ondrik, M.; Kadner, S.; Resnik, W.; Chitumbo, K.; Corbell, B.
1996-01-01
The Gemini System consists of a sophisticated, digital surveillance unit and a high performance review system. Due to the open architectural design of the Gemini System, it provides an excellent hardware and software platform to support remote monitoring. The present Gemini System provides the user with the following Remote Monitoring features, via a modem interface and powerful support software: state-of-health reporting, alarm reporting, and remote user interface. Future enhancements will contribute significantly to the Gemini''s ability to provide a broader spectrum of network interfaces and remote review
International Gemini Observatory officially launched
2002-01-01
Over 200 research, engineering, and science leaders from seven countries journeyed to the top of a remote mountain in the Chilean Andes to celebrate the inauguration the new Gemini South telescope, the complement of the Gemini North telescope already operating in Mauna Kea, Hawaii.
iNOS inhibits hair regeneration in obese diabetic (ob/ob) mice.
Sasaki, Mari; Shinozaki, Shohei; Morinaga, Hironobu; Kaneki, Masao; Nishimura, Emi; Shimokado, Kentaro
2018-07-02
Previous studies have shown that androgenic alopecia is associated with metabolic syndrome and diabetes. However, the detailed mechanism whereby diabetes causes alopecia still remains unclear. We focused on the inflammatory response that is caused by diabetes or obesity, given that inflammation is a risk factor for hair loss. Inducible nitric oxide synthase (iNOS) is known to be upregulated under conditions of acute or chronic inflammation. To clarify the potential role of iNOS in diabetes-related alopecia, we generated obese diabetic iNOS-deficient (ob/ob; iNOS-KO mice). We observed that ob/ob; iNOS-KO mice were potentiated for the transition from telogen (rest phase) to anagen (growth phase) in the hair cycle compared with iNOS-proficient ob/ob mice. To determine the effect of nitric oxide (NO) on the hair cycle, we administered an iNOS inhibitor intraperitoneally (compound 1400 W, 10 mg/kg) or topically (10% aminoguanidine) in ob/ob mice. We observed that iNOS inhibitors promoted anagen transition in ob/ob mice. Next, we administered an NO donor (S-nitrosoglutathione, GSNO), to test whether NO has the telogen elongation effects. The NO donor was sufficient to induce telogen elongation in wild-type mice. Together, our data indicate that iNOS-derived NO plays a role in telogen elongation under the inflammatory conditions associated with diabetes in mice. Copyright © 2018 The Authors. Published by Elsevier Inc. All rights reserved.
Helpdesk Gemini Research Staff Instruments Current Configurations North ALTAIR GMOS-N NIRI GNIRS NIFS GRACES South GeMS GMOS-S GPI GSAOI FLAMINGOS-2 Current Instrument Suites Visiting Instrument Policy
Far-infrared and CO observations of Cep F: Implications for star formation in Cepheus OB3
International Nuclear Information System (INIS)
Sargent, A.I.; van Duinen, R.J.; Nordh, H.L.; Fridlund, C.V.M.; Aalders, J.W.G.; Beintema, D.
1983-01-01
Observations at 80-μm and 130-μm have revealed a source of far-infrared emission in the Cep F portion of the Cepheus OB3 molecular cloud. Molecular line measurements of this region, at the CO J = 1-0 line frequency, have led to the discovery of two CO maxima. One of these coincides with the new far-infrared source. The other is at least as intense as Cep B, until now considered to be the hottest part of the cloud. There is some evidence to suggest that a second far-infrared source is associated with this hotspot. If the far-infrared emission results from the presence of embedded protostars, their location, relative to the OB association stars and to the other active region, Cep A, requires a reexamination of how stars form in the Cepheus OB3 association
Cordyceps militaris alleviates non-alcoholic fatty liver disease in ob/ob mice
Choi, Ha-Neul; Jang, Yang-Hee; Kim, Min-Joo; Seo, Min Jeong; Kang, Byoung Won; Jeong, Yong Kee; Kim, Jung-In
2014-01-01
BACKGROUND/OBJECTIVES Non-alcoholic fatty liver disease (NAFLD) is becoming an important public health problem as metabolic syndrome and type 2 diabetes have become epidemic. In this study we investigated the protective effect of Cordyceps militaris (C. militaris) against NAFLD in an obese mouse model. MATERIALS/METHODS Four-week-old male ob/ob mice were fed an AIN-93G diet or a diet containing 1% C. militaris water extract for 10 weeks after 1 week of adaptation. Serum glucose, insulin, free...
International Nuclear Information System (INIS)
Akram, Mohd; Bhat, Imtiyaz Ahmad; Kabir-ud-Din
2016-01-01
Binding interaction of a synthesized biodegradable gemini surfactant, ethane-1, 2-diyl bis(N, N-dimethyl-N-dodecylammoniumacetoxy) dichloride (12-E2-12), with bovine milk xanthine oxidase (XO) was studied using tensiometry, fluorescence spectroscopy, UV, CD, FT-IR, TEM and molecular docking. Tensiometry revealed lowering in surface tension (γ) and critical micelle concentration (CMC) of 12-E2-12 upon XO combination, suggesting a significant interaction between XO and 12-E2-12 (both in the bulk as well as at interface). Intrinsic fluorescence studies depict that 12-E2-12 quenches XO fluorescence intensity through static mechanism. The magnitude of binding parameters infers substantial and effective binding of 12-E2-12 to (XO). ANS and pyrene fluorescence demonstrate the exposure of aromatic residues (tyrosine/tryptophan) to a non-polar environment. UV, circular dichroism (CD) and FT-IR results delineate change in the secondary structure of the enzyme XO. Microscopic TEM micrographs confirm the disrupture of enzyme structure at higher concentrations of 12-E2-12. Molecular docking results show that 12-E2-12 binds to XO in the vicinity of both hydrophobic and hydrophilic residues, inferring that binding is governed by both hydrophilic and hydrophobic forces. This study may be of significance in biomedical world to further interpret mechanistic treatment modes of diseases like gout and hyperuricemia. Moreover, this study provides deeper biophysical insight into surfactant–protein interactions. - Highlights: • Binding of biodegradable gemini surfactant 12-E2-12 with xanthine oxidase. • Binding induces conformational changes in the latter. • Conformational change can be useful for biomedical and industrial purposes.
Energy Technology Data Exchange (ETDEWEB)
Akram, Mohd, E-mail: drmohdakram@rediffmail.com; Bhat, Imtiyaz Ahmad; Kabir-ud-Din
2016-02-15
Binding interaction of a synthesized biodegradable gemini surfactant, ethane-1, 2-diyl bis(N, N-dimethyl-N-dodecylammoniumacetoxy) dichloride (12-E2-12), with bovine milk xanthine oxidase (XO) was studied using tensiometry, fluorescence spectroscopy, UV, CD, FT-IR, TEM and molecular docking. Tensiometry revealed lowering in surface tension (γ) and critical micelle concentration (CMC) of 12-E2-12 upon XO combination, suggesting a significant interaction between XO and 12-E2-12 (both in the bulk as well as at interface). Intrinsic fluorescence studies depict that 12-E2-12 quenches XO fluorescence intensity through static mechanism. The magnitude of binding parameters infers substantial and effective binding of 12-E2-12 to (XO). ANS and pyrene fluorescence demonstrate the exposure of aromatic residues (tyrosine/tryptophan) to a non-polar environment. UV, circular dichroism (CD) and FT-IR results delineate change in the secondary structure of the enzyme XO. Microscopic TEM micrographs confirm the disrupture of enzyme structure at higher concentrations of 12-E2-12. Molecular docking results show that 12-E2-12 binds to XO in the vicinity of both hydrophobic and hydrophilic residues, inferring that binding is governed by both hydrophilic and hydrophobic forces. This study may be of significance in biomedical world to further interpret mechanistic treatment modes of diseases like gout and hyperuricemia. Moreover, this study provides deeper biophysical insight into surfactant–protein interactions. - Highlights: • Binding of biodegradable gemini surfactant 12-E2-12 with xanthine oxidase. • Binding induces conformational changes in the latter. • Conformational change can be useful for biomedical and industrial purposes.
GEMINI/GeMS Observations Unveil the Structure of the Heavily Obscured Globular Cluster Liller 1.
Saracino, S.; Dalessandro, E.; Ferraro, F. R.; Lanzoni, B.; Geisler, D.; Mauro, F.; Villanova, S.; Moni Bidin, C.; Miocchi, P.; Massari, D.
2015-06-01
By exploiting the exceptional high-resolution capabilities of the near-IR camera GSAOI combined with the Gemini Multi-Conjugate Adaptive System at the GEMINI South Telescope, we investigated the structural and physical properties of the heavily obscured globular cluster Liller 1 in the Galactic bulge. We have obtained the deepest and most accurate color-magnitude diagram published so far for this cluster, reaching {{K}s}˜ 19 (below the main-sequence turnoff level). We used these data to redetermine the center of gravity of the system, finding that it is located about 2.″2 southeast from the literature value. We also built new star density and surface brightness profiles for the cluster and rederived its main structural and physical parameters (scale radii, concentration parameter, central mass density, total mass). We find that Liller 1 is significantly less concentrated (concentration parameter c=1.74) and less extended (tidal radius {{r}t}=298\\prime\\prime and core radius {{r}c}=5\\buildrel{\\prime\\prime}\\over{.} 39) than previously thought. By using these newly determined structural parameters, we estimated the mass of Liller 1 to be {{M}tot}=2.3+0.3-0.1× {{10}6} {{M}⊙ } ({{M}tot}=1.5+0.2-0.1× {{10}6} {{M}⊙ } for a Kroupa initial mass function), which is comparable to that of the most massive clusters in the Galaxy (ω Centari and Terzan 5). Also, Liller 1 has the second-highest collision rate (after Terzan 5) among all star clusters in the Galaxy, thus confirming that it is an ideal environment for the formation of collisional objects (such as millisecond pulsars). Based on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da
Sartori, Michelle; Conti, Filipe F.; Dias, Danielle da Silva; dos Santos, Fernando; Machi, Jacqueline F.; Palomino, Zaira; Casarini, Dulce E.; Rodrigues, Bruno; De Angelis, Kátia; Irigoyen, Maria-Claudia
2017-01-01
Objective: To evaluate autonomic and cardiovascular function, as well as inflammatory and oxidative stress markers in ob/ob female mice. Methods: Metabolic parameters, cardiac function, arterial pressure (AP), autonomic, hormonal, inflammatory, and oxidative stress markers were evaluated in 12-weeks female wild-type (WT group) and ob/ob mice (OB group). Results: OB animals showed increased body weight, blood glucose, and triglyceride levels, along with glucose intolerance, when compared to WT animals. Ejection fraction (EF) and AP were similar between groups; however, the OB group presented diastolic dysfunction, as well as an impairment on myocardial performance index. Moreover, the OB group exhibited important autonomic dysfunction and baroreflex sensitivity impairment, when compared to WT group. OB group showed increased Angiotensin II levels in heart and renal tissues; decreased adiponectin and increased inflammatory markers in adipose tissue and spleen. Additionally, OB mice presented a higher damage to proteins and lipoperoxidation and lower activity of antioxidant enzymes in kidney and heart. Correlations were found between autonomic dysfunction with angiotensin II and inflammatory mediators, as well as between inflammation and oxidative stress. Conclusions: Our results showed that female adult ob/ob mice presented discrete diastolic dysfunction accompanied by autonomic disorder, which is associated with inflammation and oxidative stress in these animals. PMID:28878683
Directory of Open Access Journals (Sweden)
Michelle Sartori
2017-08-01
Full Text Available Objective: To evaluate autonomic and cardiovascular function, as well as inflammatory and oxidative stress markers in ob/ob female mice.Methods: Metabolic parameters, cardiac function, arterial pressure (AP, autonomic, hormonal, inflammatory, and oxidative stress markers were evaluated in 12-weeks female wild-type (WT group and ob/ob mice (OB group.Results: OB animals showed increased body weight, blood glucose, and triglyceride levels, along with glucose intolerance, when compared to WT animals. Ejection fraction (EF and AP were similar between groups; however, the OB group presented diastolic dysfunction, as well as an impairment on myocardial performance index. Moreover, the OB group exhibited important autonomic dysfunction and baroreflex sensitivity impairment, when compared to WT group. OB group showed increased Angiotensin II levels in heart and renal tissues; decreased adiponectin and increased inflammatory markers in adipose tissue and spleen. Additionally, OB mice presented a higher damage to proteins and lipoperoxidation and lower activity of antioxidant enzymes in kidney and heart. Correlations were found between autonomic dysfunction with angiotensin II and inflammatory mediators, as well as between inflammation and oxidative stress.Conclusions: Our results showed that female adult ob/ob mice presented discrete diastolic dysfunction accompanied by autonomic disorder, which is associated with inflammation and oxidative stress in these animals.
COSMIC ORIGINS SPECTROGRAPH OBSERVATIONS OF TRANSLUCENT CLOUDS: Cyg OB2 8A
International Nuclear Information System (INIS)
Snow, Theodore P.; Destree, Joshua D.; Burgh, Eric B.; Ferguson, Ryan M.; Danforth, Charles W.; Cordiner, Martin
2010-01-01
Data from the Cosmic Origins Spectrograph (COS) are presented for the first highly reddened target (Cyg OB2 8A) under the COS Science Team's guaranteed time allocation. Column densities of ionic, atomic, and molecular species are reported and implications are discussed. Data from Cyg OB2 8A demonstrate the ability to analyze highly reddened interstellar sight lines with the COS that were unavailable to previous UV instruments. Measured column densities indicate that the Cyg OB2 8A line of sight contains multiple diffuse clouds rather than a dominant translucent cloud.
Chen, H-L; Tung, Y-T; Tsai, C-L; Lai, C-W; Lai, Z-L; Tsai, H-C; Lin, Y-L; Wang, C-H; Chen, C-M
2014-09-01
Fatty liver disease is commonly associated with obesity, insulin resistance and diabetes. Severe fatty liver is sometimes accompanied by steatohepatitis and may lead to the development of hepatocellular carcinoma. At present, there is no effective treatment for non-alcoholic fatty liver disease (NAFLD); thus, recent investigations have focused on developing effective therapeutics to treat this condition. This study aimed to evaluate the effects of kefir on the hepatic lipid metabolism of ob/ob mice, which are commonly used to model fatty liver disease. In this study, we used leptin receptor-deficient ob/ob mice as an animal disease model of NAFLD. Six-week-old ob/ob mice were orally administered the dairy product kefir (140 mg kg(-1) of body weight (BW) per day) for 4 weeks. The data demonstrated that kefir improved fatty liver syndrome on BW, energy expenditure and basal metabolic rate by inhibiting serum glutamate oxaloacetate transaminase (GOT) and glutamate pyruvate transaminase (GPT) activities (Pkefir administration also significantly reduced the macrovesicular fat quantity in liver tissue. In addition, kefir markedly decreased the expression of the genes sterol regulatory element-binding protein 1 (SREBP1), fatty acid synthase (FAS) and acetyl-CoA carboxylase (ACC) (Pkefir improves NAFLD on BW, energy expenditure and basal metabolic rate by inhibiting the lipogenesis pathway and that kefir may have the potential for clinical application to the prevention or treatment of NAFLD.
Hydrogen sulfide improves diabetic wound healing in ob/ob mice via attenuating inflammation.
Zhao, Huichen; Lu, Shengxia; Chai, Jiachao; Zhang, Yuchao; Ma, Xiaoli; Chen, Jicui; Guan, Qingbo; Wan, Meiyan; Liu, Yuantao
2017-09-01
The proposed mechanisms of impaired wound healing in diabetes involve sustained inflammation, excess oxidative stress and compromised agiogenesis. Hydrogen sulfide (H 2 S) has been reported to have multiple biological activities. We aim to investigate the role of H 2 S in impaired wound healing in ob/ob mice and explore the possible mechanisms involved. Full-thickness skin dorsal wounds were created on ob/ob mice and C57BL/6 mice. Cystathionine-γ-lyase (CSE) expression and H 2 S production were determined in granulation tissues of the wounds. Effects of NaHS on wound healing were evaluated. Inflammation and angiogenesis in granulation tissues of the wounds were examined. CSE expression, and H 2 S content were significantly reduced in granulation tissues of wounds in ob/ob mice compared with control mice. NaHS treatment significantly improved wound healing in ob/ob mice, which was associated with reduced neutrophil and macrophage infiltration, decreased production of tumor necrosis factor (TNF)-α, interleukin (IL)-6. NaHS treatment decreased metalloproteinase (MMP)-9, whereas increased collagen deposition and vascular-like structures in granulation tissues of wounds in ob/ob mice. CSE down-regulation may play a role in the pathogenesis of diabetic impaired wound healing. Exogenous H 2 S could be a potential agent to improve diabetic impaired wound healing by attenuating inflammation and increasing angiogenesis. Copyright © 2017 Elsevier Inc. All rights reserved.
Magnetic field of massive chemically peculiar stars in the Orion OB1 association
Romanyuk, I. I.; Semenko, E. A.; Kudryavtsev, D. O.; Yakunin, I. A.
2018-01-01
Spectropolarimetric observations of 55 chemically peculiar stars in the Orion OB1 association were obtained at the 6 m telescope of the Russian Academy of Sciences with the aim of searching for the presence of stellar magnetic fields. We found 8 new magnetic stars in addition to 20 previously known objects. The frequency of chemically peculiar A and B-type stars among normal A and B-type stars and the frequency of magnetic stars among all chemically peculiar stars decreases with age in the Orion OB1 association.
Women Astronomers at Gemini: A Success Story
Rodgers, Bernadette; Jorgensen, I.; Barker, N.; Edwards, M.; Trancho, G.
2010-01-01
Gemini Observatory has been very successful at attracting, hiring and retaining female Scientists. We present data on the growth of the scientific staff since the start of the Observatory, and science fellow recruiting from 2006-2008. At Gemini 31% of the Science Staff holding PhDs are female compared with 13.9% within the United States. The Science Management is 75% female, as is 50% of the Gemini Directorate. This critical mass of female representation within the science staff and management appears to have had a positive effect on female recruitment and hiring. The science fellow recruitment during the past 3 years has attracted 21-38% female applicants and 57% of new hires during this period have been female scientists. Perhaps even more significant, the retention rate of female science staff at Gemini is 88%, compared to 64% for male science staff. There are likely many factors that contribute to this success, but the conclusion is that Gemini has earned a reputation in the scientific community as a place where female scientists are valued and can be successful.
Serotonin transporter (SERT and translocator protein (TSPO expression in the obese ob/ob mouse
Directory of Open Access Journals (Sweden)
Santini Ferruccio
2011-02-01
Full Text Available Abstract Background An ever growing body of evidences is emerging concerning metabolism hormones, neurotransmitters or stress-related biomarkers as effective modulators of eating behavior and body weight in mammals. The present study sought at examining the density and affinity of two proteins related to neurotransmission and cell metabolism, the serotonin transporter SERT and the cholesterol import-benzodiazepine site TSPO (translocator protein, in a rodent leptin-lacking mutant, the obese ob/ob mouse. Binding studies were thus carried out in brain or peripheral tissues, blood platelets (SERT and kidneys (TSPO, of ob/ob and WT mice supplied with a standard diet, using the selective radiochemical ligands [3H]-paroxetine and [3H]-PK11195. Results We observed comparable SERT number or affinity in brain and platelets of ob/ob and WT mice, whilst a significantly higher [3H]-PK11195 density was reported in the brain of ob/ob animals. TSPO binding parameters were similar in the kidneys of all tested mice. By [3H]-PK11195 autoradiography of coronal hypothalamic-hippocampal sections, an increased TSPO signal was detected in the dentate gyrus (hippocampus and choroids plexus of ob/ob mice, without appreciable changes in the cortex or hypothalamic-thalamic regions. Conclusions These findings show that TSPO expression is up-regulated in cerebral regions of ob/ob leptin-deficient mice, suggesting a role of the translocator protein in leptin-dependent CNS trophism and metabolism. Unchanged SERT in mutant mice is discussed herein in the context of previous literature as the forerunner to a deeper biochemical investigation.
Confirmation of 5 SN in the Kepler/K2 C16 Field with Gemini
Margheim, S.; Tucker, B. E.; Garnavich, P. M.; Rest, A.; Narayan, G.; Smith, K. W.; Smartt, S.; Kasen, D.; Shaya, E.; Mushotzky, R.; Olling, R.; Villar, A.; Forster, F.; Zenteno, A.; James, D.; Smith, R. Chris
2018-01-01
We report new spectroscopic classifications by KEGS of supernova discovered by Pan-STARRS1 during a targeted search of the Kepler/K2 Campaign 16 field using the Gemini Multi-Object Spectrograph (GMOS) on both the Gemini North Observatory on Mauna Kea, and the Gemini South Observatory on Cerro Pachon.
... Management Education & Events Advocacy For Patients About ACOG Find an Ob-Gyn Home About ACOG Find an Ob-Gyn Page Navigation ▼ About Us ACOG ... Districts ACOG Sections Careers at ACOG Contact Us Find an Ob-Gyn Search by State Search by ...
Directory of Open Access Journals (Sweden)
Straižys V.
2010-12-01
Full Text Available The possibility of applying photometry from the 2MASS J, H, Ks, MegaCam u, g and IPHAS r, i, Hα surveys for determining the distance to the dark cloud LDN1525 (TGU 1192 in the direction of the Aur OB1 association is investigated using the red clump giants. The main dust cloud, probably related to the emission nebulae Sh 2-232, Sh 2-233, Sh 2-235, the molecular cloud and the association Aur OB2, is found to be located at a distance of 1.3 kpc from the Sun. The nebula Sh 2-231 can be an object of the Perseus arm. The maximum extinction AV found in the cloud is close to 6 mag.
A model for the infrared emission from an OB star cluster environment
International Nuclear Information System (INIS)
Leisawitz, D.
1990-01-01
Researchers developed an interactive radiative transfer code that predicts the infrared emission from an HII region containing diffuse ionized and atomic gas and dense molecular clouds. This model complements the investigation of the redistribution of OB star luminosity in the interstellar medium (Leisawitz and Hauser 1988, Ap. J., 332, 954). The model can be used as a diagnostic tool to probe the radiation field and matter density in an HII region, place constraints on the proximity and orientation of an illuminated molecular cloud with respect to the ionizing stars, test for the presence of small, transiently heated dust grains, and determine whether the dust-to-gas ratio is normal. Predictions of the model agree qualitatively and quantitatively with observations of blister-type HII regions ionized by well-studied OB clusters in which the distribution of dense neutral material is known. This is illustrated by a model for Infrared Astronomy Satellite (IRAS) observations of the region around NGC 7380 (S142). Researchers plan to use the model in a survey of regions of massive star formation in the outer Galaxy to study OB stars embedded to various degrees in their parental molecular clouds
Adsorption of dissymmetric cationic gemini surfactants at silica/water interface
Sun, Yuhai; Feng, Yujun; Dong, Hongwei; Chen, Zhi
2007-05-01
Adsorption of a series of cationic gemini surfactants 12-2- m ( m = 8, 12, 16) on the surface of silica was investigated. The critical micelle concentrations, cmcs, of cationic gemini surfactants in the initial solutions and in the supernatants were measured by conductometry and tensiometer. The changes in cmc values indicate that the ion exchanges take place between polar groups of gemini surfactants adsorbed and ions bound on the surface of silica. The adsorption isotherms of cationic gemini surfactants were obtained by a solution depletion method. Based on the driving force, the adsorption includes two steps, one of which is ion exchange, and the other is hydrophobic interaction. In each step, the tendency of surfactant molecules in the solution to form aggregates or to be adsorbed on the silica varies with their structures. The maximum adsorption amount of gemini surfactants on the silica, τmax, decreases as increasing in the length of one alkyl chain, m, from 8, 12 to 16. So the results show that the adsorption behaviors of gemini surfactants are closely related to the dissymmetry of gemini molecules.
Catanionic mixtures forming gemini-like amphiphiles.
Sakai, Hideki; Okabe, Yuji; Tsuchiya, Koji; Sakai, Kenichi; Abe, Masahiko
2011-01-01
The properties of aqueous mixtures of cationic species with alkyl dicarboxylic acid compounds have been studied. The cationic compounds used in this study were tertiary amine-type N-methyl-N-(2,3-dioxypropyl)hexadecylamine (C16amine) and quaternary ammonium-type N,N-dimethyl-N-(2,3-dioxypropyl)hexadecylammonium chloride (C16Q). The alkyl dicarboxylic acid compounds used were HOOC(CH(2))(10)COOH (C12H) and its sodium salt (C12Na). Three aqueous mixtures were examined in this study: (System I) C16amine + C12H, (System II) C16Q + C12Na, and (System III) C16Q + C12H. The solution pH was set at 12 for System III. The combination of (1)H-NMR and mass spectroscopy data has suggested that a stoichiometric complex is formed in the aqueous solutions at a mole fraction of C12H (or C12Na) = 0.33. Here, the C12H (or C12Na) molecule added to the system bridges two cationic molecules, like a spacer of gemini surfactants. In fact, the static surface tensiometry has demonstrated that the stoichiometric complex behaves as gemini-like amphiphiles in aqueous solutions. Our current study offers a possible way for easily preparing gemini surfactant systems.
Leptin Increases Striatal Dopamine D2 Receptor Binding in Leptin-Deficient Obese (ob/ob) Mice
Energy Technology Data Exchange (ETDEWEB)
Pfaffly, J.; Michaelides, M.; Wang, G-J.; Pessin, J.E.; Volkow, N.D.; Thanos, P.K.
2010-06-01
Peripheral and central leptin administration have been shown to mediate central dopamine (DA) signaling. Leptin-receptor deficient rodents show decreased DA D2 receptor (D2R) binding in striatum and unique DA profiles compared to controls. Leptin-deficient mice show increased DA activity in reward-related brain regions. The objective of this study was to examine whether basal D2R-binding differences contribute to the phenotypic behaviors of leptin-deficient ob/ob mice, and whether D2R binding is altered in response to peripheral leptin treatment in these mice. Leptin decreased body weight, food intake, and plasma insulin concentration in ob/ob mice but not in wild-type mice. Basal striatal D2R binding (measured with autoradiography [{sup 3}H] spiperone) did not differ between ob/ob and wild-type mice but the response to leptin did. In wild-type mice, leptin decreased striatal D2R binding, whereas, in ob/ob mice, leptin increased D2R binding. Our findings provide further evidence that leptin modulates D2R expression in striatum and that these effects are genotype/phenotype dependent.
DIRECT IMAGING AND SPECTROSCOPY OF A YOUNG EXTRASOLAR KUIPER BELT IN THE NEAREST OB ASSOCIATION
International Nuclear Information System (INIS)
Currie, Thayne; Lisse, Carey M.; Kuchner, Marc; Madhusudhan, Nikku; Kenyon, Scott J.; Thalmann, Christian; Carson, Joseph; Debes, John
2015-01-01
We describe the discovery of a bright, young Kuiper belt–like debris disk around HD 115600, a ∼1.4–1.5 M ⊙ , ∼15 Myr old member of the Sco–Cen OB Association. Our H-band coronagraphy/integral field spectroscopy from the Gemini Planet Imager shows the ring has a (luminosity-scaled) semimajor axis of (∼22 AU) ∼ 48 AU, similar to the current Kuiper belt. The disk appears to have neutral-scattering dust, is eccentric (e ∼ 0.1–0.2), and could be sculpted by analogs to the outer solar system planets. Spectroscopy of the disk ansae reveal a slightly blue to gray disk color, consistent with major Kuiper belt chemical constituents, where water ice is a very plausible dominant constituent. Besides being the first object discovered with the next generation of extreme adaptive optics systems (i.e., SCExAO, GPI, SPHERE), HD 115600's debris ring and planetary system provide a key reference point for the early evolution of the solar system, the structure, and composition of the Kuiper belt and the interaction between debris disks and planets
DIRECT IMAGING AND SPECTROSCOPY OF A YOUNG EXTRASOLAR KUIPER BELT IN THE NEAREST OB ASSOCIATION
Energy Technology Data Exchange (ETDEWEB)
Currie, Thayne [National Astronomical Observatory of Japan, Subaru Telescope, Hilo, HI (United States); Lisse, Carey M. [Applied Physics Laboratory, The Johns Hopkins University, Laurel, MD (United States); Kuchner, Marc [NASA Goddard Space Flight Center, Greenbelt, MD (United States); Madhusudhan, Nikku [Institute for Astronomy, University of Cambridge, Cambridge (United Kingdom); Kenyon, Scott J. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Thalmann, Christian [ETH-Zurich, Zurich (Switzerland); Carson, Joseph [Department of Physics and Astronomy, The College of Charleston, Charleston, SC (United States); Debes, John [Space Telescope Science Institute, Baltimore, MD (United States)
2015-07-01
We describe the discovery of a bright, young Kuiper belt–like debris disk around HD 115600, a ∼1.4–1.5 M{sub ⊙}, ∼15 Myr old member of the Sco–Cen OB Association. Our H-band coronagraphy/integral field spectroscopy from the Gemini Planet Imager shows the ring has a (luminosity-scaled) semimajor axis of (∼22 AU) ∼ 48 AU, similar to the current Kuiper belt. The disk appears to have neutral-scattering dust, is eccentric (e ∼ 0.1–0.2), and could be sculpted by analogs to the outer solar system planets. Spectroscopy of the disk ansae reveal a slightly blue to gray disk color, consistent with major Kuiper belt chemical constituents, where water ice is a very plausible dominant constituent. Besides being the first object discovered with the next generation of extreme adaptive optics systems (i.e., SCExAO, GPI, SPHERE), HD 115600's debris ring and planetary system provide a key reference point for the early evolution of the solar system, the structure, and composition of the Kuiper belt and the interaction between debris disks and planets.
Photometric Calibration of the Gemini South Adaptive Optics Imager
Stevenson, Sarah Anne; Rodrigo Carrasco Damele, Eleazar; Thomas-Osip, Joanna
2017-01-01
The Gemini South Adaptive Optics Imager (GSAOI) is an instrument available on the Gemini South telescope at Cerro Pachon, Chile, utilizing the Gemini Multi-Conjugate Adaptive Optics System (GeMS). In order to allow users to easily perform photometry with this instrument and to monitor any changes in the instrument in the future, we seek to set up a process for performing photometric calibration with standard star observations taken across the time of the instrument’s operation. We construct a Python-based pipeline that includes IRAF wrappers for reduction and combines the AstroPy photutils package and original Python scripts with the IRAF apphot and photcal packages to carry out photometry and linear regression fitting. Using the pipeline, we examine standard star observations made with GSAOI on 68 nights between 2013 and 2015 in order to determine the nightly photometric zero points in the J, H, Kshort, and K bands. This work is based on observations obtained at the Gemini Observatory, processed using the Gemini IRAF and gemini_python packages, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina), and Ministério da Ciência, Tecnologia e Inovação (Brazil).
FIRST SCATTERED-LIGHT IMAGE OF THE DEBRIS DISK AROUND HD 131835 WITH THE GEMINI PLANET IMAGER
Energy Technology Data Exchange (ETDEWEB)
Hung, Li-Wei; Arriaga, Pauline; Fitzgerald, Michael P.; Esposito, Thomas M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Duchêne, Gaspard; Kalas, Paul G.; De Rosa, Robert J.; Graham, James R. [Astronomy Department, University of California, Berkeley CA 94720-3411 (United States); Maire, Jérôme; Chilcote, Jeffrey K. [Dunlap Institute for Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H4 (Canada); Marois, Christian [National Research Council of Canada Herzberg, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Millar-Blanchaer, Maxwell A. [Department of Astronomy and Astrophysics, University of Toronto, Toronto ON M5S 3H4 (Canada); Bruzzone, Sebastian [Department of Physics and Astronomy, Centre for Planetary and Space Exploration, University of Western Ontario, London, ON N6A 3K7 (Canada); Rajan, Abhijith [School of Earth and Space Exploration, Arizona State University, P.O. Box 871404, Tempe, AZ 85287 (United States); Pueyo, Laurent; Wolff, Schuyler G.; Chen, Christine H. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Konopacky, Quinn [Center for Astrophysics and Space Sciences, University of California, San Diego, 9500 Gilman Drive, La Jolla, CA 92093 (United States); Ammons, S. Mark [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94040 (United States); Draper, Zachary H. [University of Victoria, 3800 Finnerty Road, Victoria, BC V8P 5C2 (Canada); and others
2015-12-10
We present the first scattered-light image of the debris disk around HD 131835 in the H band using the Gemini Planet Imager. HD 131835 is a ∼15 Myr old A2IV star at a distance of ∼120 pc in the Sco-Cen OB association. We detect the disk only in polarized light and place an upper limit on the peak total intensity. No point sources resembling exoplanets were identified. Compared to its mid-infrared thermal emission, in scattered light the disk shows similar orientation but different morphology. The scattered-light disk extends from ∼75 to ∼210 AU in the disk plane with roughly flat surface density. Our Monte Carlo radiative transfer model can describe the observations with a model disk composed of a mixture of silicates and amorphous carbon. In addition to the obvious brightness asymmetry due to stronger forward scattering, we discover a weak brightness asymmetry along the major axis, with the northeast side being 1.3 times brighter than the southwest side at a 3σ level.
Briceño, C; Vivas, A K; Calvet, N; Hartmann, L; Pacheco, R; Herrera, D; Romero, L; Berlind, P; Sánchez, G; Snyder, J A; Andrews, P
2001-01-05
We are conducting a large-scale, multiepoch, optical photometric survey [Centro de Investigaciones de Astronomia-Quasar Equatorial Survey Team (CIDA-QUEST)] covering about 120 square degrees to identify the young low-mass stars in the Orion OB1 association. We present results for an area of 34 square degrees. Using photometric variability as our main selection criterion, as well as follow-up spectroscopy, we confirmed 168 previously unidentified pre-main sequence stars that are about 0.6 to 0.9 times the mass of the sun (Mo), with ages of about 1 million to 3 million years (Ori OB1b) and about 3 million to 10 million years (Ori OB1a). The low-mass stars are spatially coincident with the high-mass (at least 3 Mo) members of the associations. Indicators of disk accretion such as Halpha emission and near-infrared emission from dusty disks fall sharply from Ori OB1b to Ori OB1a, indicating that the time scale for disk dissipation and possibly the onset of planet formation is a few million years.
Directory of Open Access Journals (Sweden)
Laurence B Lindenmaier
2016-08-01
Full Text Available Low bone mass is often associated with increased bone marrow adiposity. Since osteoblasts and adipocytes are derived from the same mesenchymal stem cell progenitor, adipocyte formation may increase at the expense of osteoblast formation. Leptin is an adipocyte-derived hormone known to regulate energy and bone metabolism. Genetic (e.g., leptin deficiency and high fat diet-induced (e.g., leptin resistance obesity are associated with increased marrow adipose tissue (MAT and reduced bone formation. Short-duration studies suggest that leptin treatment reduces MAT and increases bone formation in leptin-deficient ob/ob mice fed a regular diet. Here, we determined the long-duration impact of increased hypothalamic leptin on marrow adipocytes and osteoblasts in ob/ob mice using recombinant adeno-associated virus (rAAV gene therapy. In a first study, eight- to ten-week-old male ob/ob mice were randomized into 4 groups: (1 untreated, (2 rAAV-Lep, (3 rAAV-green fluorescent protein (rAAV-GFP, or (4 pair-fed to rAAV-Lep. For vector administration, mice were placed in a Kopf stereotaxic apparatus, and injected intracerebroventricularly with either rAAV-Lep or rAAV-GFP (9 × 107 particles in 1.5 µl. The mice were maintained for 30 weeks following vector administration. In a second study, the impact of increased hypothalamic leptin levels on MAT was determined in mice fed high fat diets. Eight- to ten-week-old male ob/ob mice were randomized into 2 groups and treated with either rAAV-Lep or rAAV-GFP. At 7 weeks post-vector administration, half the mice in each group were switched to a high fat diet for 8 weeks. Wild type (WT controls included age-matched mice fed regular or high fat diet. Hypothalamic leptin gene therapy increased osteoblast perimeter and osteoclast perimeter with minor change in cancellous bone architecture. The gene therapy decreased MAT levels in ob/ob mice fed regular or high fat diet to values similar to WT mice fed regular diet. These
Gemini News Service Re-launch | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Gemini closed in 2002 after three decades of operation due, in part, to the high ... and, if appropriate, a business plan for re-launching Gemini News Service at the ... IWRA/IDRC webinar on climate change and adaptive water management.
SCUBA and HIRES Results for Protostellar Cores in the MON OB1 Dark Cloud
Wolf-Chase, G.; Moriarty-Schieven, G.; Fich, M.; Barsony, M.
1999-05-01
We have used HIRES-processing of IRAS data and point-source modelling techniques (Hurt & Barsony 1996; O'Linger 1997; Barsony et al. 1998), together with submillimeter continuum imaging using the Submillimeter Common-User Bolometer Array (SCUBA) on the 15-meter James Clerk Maxwell Telescope (JCMT), to search CS cores in the Mon OB1 dark cloud (Wolf-Chase, Walker, & Lada 1995; Wolf-Chase & Walker 1995) for deeply embedded sources. These observations, as well as follow-up millimeter photometry at the National Radio Astronomy Observatory (NRAO) 12-meter telescope on Kitt Peak, have lead to the identification of two Class 0 protostellar candidates, which were previously unresolved from two brighter IRAS point sources (IRAS 06382+0939 & IRAS 06381+1039) in this cloud. Until now, only one Class 0 object had been confirmed in Mon OB1; the driving source of the highly-collimated outflow NGC 2264 G (Ward-Thompson, Eiroa, & Casali 1995; Margulis et al. 1990; Lada & Fich 1996), which lies well outside the extended CS cores. One of the new Class 0 candidates may be an intermediate-mass source associated with an H_2O maser, and the other object is a low-mass source which may be associated with a near-infrared jet, and possibly with a molecular outflow. We report accurate positions for the new Class 0 candidates, based on the SCUBA images, and present new SEDs for these sources, as well as for the brighter IRAS point sources. A portion of this work was performed while GWC held a President's Fellowship from the University of California. MB and GWC gratefully acknowledge financial support from MB's NSF CAREER Grant, AST97-9753229.
Pavani, R S; Fernandes, C; Perez, A M; Vasconcelos, E J R; Siqueira-Neto, J L; Fontes, M R; Cano, M I N
2014-12-20
Replication protein A-1 (RPA-1) is a single-stranded DNA-binding protein involved in DNA metabolism. We previously demonstrated the interaction between LaRPA-1 and telomeric DNA. Here, we expressed and purified truncated mutants of LaRPA-1 and used circular dichroism measurements and molecular dynamics simulations to demonstrate that the tertiary structure of LaRPA-1 differs from human and yeast RPA-1. LaRPA-1 interacts with telomeric ssDNA via its N-terminal OB-fold domain, whereas RPA from higher eukaryotes show different binding modes to ssDNA. Our results show that LaRPA-1 is evolutionary distinct from other RPA-1 proteins and can potentially be used for targeting trypanosomatid telomeres. Copyright © 2014 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.
Gemini Near-infrared Spectroscopy of Luminous z~6 Quasars
DEFF Research Database (Denmark)
Jiang, Linhua; Fan, Xiaohui; Vestergaard, Marianne
2007-01-01
We present Gemini near-infrared spectroscopic observations of six luminous quasars at z=5.8$\\sim$6.3. Five of them were observed using Gemini-South/GNIRS, which provides a simultaneous wavelength coverage of 0.9--2.5 $\\mu$m in cross dispersion mode. The other source was observed in K band...... with Gemini-North/NIRI. We calculate line strengths for all detected emission lines and use their ratios to estimate gas metallicity in the broad-line regions of the quasars. The metallicity is found to be supersolar with a typical value of $\\sim$4 Z_{\\sun}, and a comparison with low-redshift observations...... shows no strong evolution in metallicity up to z$\\sim$6. The FeII/MgII ratio of the quasars is 4.9+/-1.4, consistent with low-redshift measurements. We estimate central BH masses of 10^9 to 10^{10} M_{\\sun} and Eddington luminosity ratios of order unity. We identify two MgII $\\lambda\\lambda$2796...
The Gemini 8-Meter Telescopes Project
Boroson, Todd A.
1995-05-01
The Gemini 8-Meter Telescopes Project is an international partnership to build and operate two 8-meter telescopes, one on Mauna Kea, Hawaii, and one on Cerro Pachon, Chile. The telescopes will be international facilities, open to the scientific communities of the six member countries, the United States (50%), the United Kingdom (25%), Canada (15%), Chile (5%), Argentina (2.5%), and Brazil (2.5%). The telescopes are designed to exploit the best atmospheric conditions at these excellent sites. Near diffraction limited performance will be delivered at 2.2 microns and longward, with minimal degradation of the best seeing conditions at shorter wavelengths. The telescopes and facilities are designed to achieve emissivity opportunity. First light for the Mauna Kea telescope is expected in late 1998, and for the Cerro Pachon telescope in mid-2000. This talk will report on construction progress, the instrumental capabilities, and operations strategies being considered. The Gemini 8-meter Telescopes Project is managed by the Association of Universities for Research in Astronomy (AURA), Inc. under a cooperative agreement with the National Science Foundation which serves as executive agency for the Gemini partner countries. U.S. participation in the project is through the U.S. Gemini Program, a division of the National Optical Astronomy Observatories. NOAO is operated by AURA, Inc. under cooperative agreement with the National Science Foundation.
Directory of Open Access Journals (Sweden)
Garris David R
2006-02-01
Full Text Available Abstract Background Both diabetes and obesity syndromes are recognized to promote lumbar vertebral instability, premature osteodegeneration, exacerbate progressive osteoporosis and increase the propensity towards vertebral degeneration, instability and deformation in humans. Methods The influences of single-gene missense mutations, expressing either diabetes (db/db or obese (ob/ob metabolic syndromes on vertebral maturation and development in C57BL/KsJ mice were evaluated by radiological and macro-morphometric analysis of the resulting variances in osteodevelopment indices relative to control parameters between 8 and 16 weeks of age (syndrome onset @ 4 weeks, and the influences of low-dose 17-B-estradiol therapy on vertebral growth expression evaluated. Results Associated with the indicative genotypic obesity and hyper-glycemic/-insulinemic states, both db/db and ob/ob mutants demonstrated a significant (P ≤ 0.05 elongation of total lumbar vertebrae column (VC regional length, and individual lumbar vertebrae (LV1-5 lengths, relative to control VC and LV parameters. In contrast, LV1-5 width indices were suppressed in db/db and ob/ob mutants relative to control LV growth rates. Between 8 and 16 weeks of age, the suppressed LV1-5 width indices were sustained in both genotype mutant groups relative to control osteomaturation rates. The severity of LV1-5 width osteosuppression correlated with the severe systemic hyperglycemic and hypertriglyceridemic conditions sustained in ob/ob and db/db mutants. Low-dose 17-B-estradiol therapy (E2-HRx: 1.0 ug/ 0.1 ml oil s.c/3.5 days, initiated at 4 weeks of age (i.e., initial onset phase of db/db and ob/ob expressions re-established control LV 1–5 width indices without influencing VC or LV lengths in db/db groups. Conclusion These data demonstrate that the abnormal systemic endometabolic states associated with the expression of db/db and ob/ob genomutation syndromes suppress LV 1–5 width osteomaturation
Switching performance of OBS network model under prefetched real traffic
Huang, Zhenhua; Xu, Du; Lei, Wen
2005-11-01
Optical Burst Switching (OBS) [1] is now widely considered as an efficient switching technique in building the next generation optical Internet .So it's very important to precisely evaluate the performance of the OBS network model. The performance of the OBS network model is variable in different condition, but the most important thing is that how it works under real traffic load. In the traditional simulation models, uniform traffics are usually generated by simulation software to imitate the data source of the edge node in the OBS network model, and through which the performance of the OBS network is evaluated. Unfortunately, without being simulated by real traffic, the traditional simulation models have several problems and their results are doubtable. To deal with this problem, we present a new simulation model for analysis and performance evaluation of the OBS network, which uses prefetched IP traffic to be data source of the OBS network model. The prefetched IP traffic can be considered as real IP source of the OBS edge node and the OBS network model has the same clock rate with a real OBS system. So it's easy to conclude that this model is closer to the real OBS system than the traditional ones. The simulation results also indicate that this model is more accurate to evaluate the performance of the OBS network system and the results of this model are closer to the actual situation.
Summary analysis of the Gemini entry aerodynamics
Whitnah, A. M.; Howes, D. B.
1972-01-01
The aerodynamic data that were derived in 1967 from the analysis of flight-generated data for the Gemini entry module are presented. These data represent the aerodynamic characteristics exhibited by the vehicle during the entry portion of Gemini 2, 3, 5, 8, 10, 11, and 12 missions. For the Gemini, 5, 8, 10, 11, and 12 missions, the flight-generated lift-to-drag ratios and corresponding angles of attack are compared with the wind tunnel data. These comparisons show that the flight generated lift-to-drag ratios are consistently lower than were anticipated from the tunnel data. Numerous data uncertainties are cited that provide an insight into the problems that are related to an analysis of flight data developed from instrumentation systems, the primary functions of which are other than the evaluation of flight aerodynamic performance.
Recent Seismic Experiments of OBS in the South China Sea
Ruan, A.; Li, J.; Wu, Z.
2012-12-01
Since 2006 some research institutions of China have carried out some important seismic experiments by using ocean bottom seismometer(OBS) in the South China Sea (SCS) and obtained many concrete progresses in modeling the crustal structure of SCS and also in understanding of its formation and evolution as well. In 2006 three wide-angle profiles were completed in the northern margin, named OBS2006-1 across the northwestern sub-basin, OBS2006-2 parallel to the sea basin boundary and OBS2006-3 across the Dongsha Rise and Chaoshan Depression respectively. In 2010 two wide- angle profiles were completed, named OBS2010-1 and OBS 2010-2 both perpendicular to the northern off-shore faulting system. During 2009-2011 four wide-angle profiles were completed in the southern margin, named OBS973-1 from southern margin to the southwestern sub-basin, OBS973-2 from Liyue Bank to the southwestern sub-basin and OBS973-3 from Xisha to the southwestern sub-basin, OBS2011-2 from Xisha to Hainan Island respectively. In 2011 two 3D seismic array of OBS were completed in the Zhongnan-Changlong sea mount chain and Huangyan-Zhenbei sea mount chain respectively. Here we present some primary but important results as follows. (1) The velocity model of OBS2006-1 indicates that the crust under the continental slope decreases from 21km to 11km, and to 7.7km in the northwestern sub-basin with Moho depth ascends from 21km to 11km. The tectonic geometry and velocity structure of the northwestern sub-basin and its margins on both sides shows symmetrical and conjugate and indicates pure shear mode of continental margin rifting mechanism. (2) The velocity model of OBS2006-3 reveals remarkable thickness with maximum 8 km of the Mesozoic sediment in Chaoshan Depression in which velocity increases downward from 4.4 km/s at top to 5.3 km/s at the bottom. The buried depth of Moho decreases from 24-25 km under Dongsha Rise to 17 km in the lower slope and an obviously velocity abnormal is detected in the upper
Searching for self-enrichment in Cygnus OB2
Berlanas, Sara R.; Herrero, Artemio; Comerón, Fernando; Pasquali, Anna; Simón-Díaz, Sergio
2017-11-01
Cygnus OB2 is a rich and relatively close (d~1.4 kpc) OB association in our Galaxy. It represents an ideal testbed for our theories about self-enrichment processes produced by pollution of the interstellar medium by successive generations of massive stars. Comerón & Pasquali (2012, A&A, 543, A101) found a correlation between the age of young stellar groups in Cygnus OB2 and their Galactic longitude. If is associated with a chemical composition gradient, it could support these self-enrichment processes.
Arduino adventures escape from Gemini station
Kelly, James Floyd
2013-01-01
Arduino Adventures: Escape from Gemini Station provides a fun introduction to the Arduino microcontroller by putting you (the reader) into the action of a science fiction adventure story. You'll find yourself following along as Cade and Elle explore Gemini Station-an orbiting museum dedicated to preserving and sharing technology throughout the centuries. Trouble ensues. The station is evacuated, including Cade and Elle's class that was visiting the station on a field trip. Cade and Elle don't make it aboard their shuttle and are trapped on the station along with a friendly artificial intellig
Yoshimura, Tomokazu; Bong, Miri; Matsuoka, Keisuke; Honda, Chikako; Endo, Kazutoyo
2009-11-01
Three anionic homologues of a novel partially fluorinated carboxylate-type anionic gemini surfactant, N,N'-di(3-perfluoroalkyl-2-hydroxypropyl)-N,N'-diacetic acid ethylenediamine (2C(n)(F) edda, where n represents the number of carbon atoms in the fluorocarbon chain (4, 6, and 8)) were synthesized. In these present gemini surfactants, the relatively small carboxylic acid moieties form hydrophilic head groups. The surface properties or structures of the aggregates of these surfactants are strongly influenced by the nonflexible fluorocarbons and small head groups; this is because these surfactants have a closely packed molecular structure. The equilibrium surface tension properties of these surfactants were measured at 298.2K for various fluorocarbon chain lengths. The plot of the logarithm of the critical micelle concentration (cmc) against the fluorocarbon chain lengths for 2C(n)(F) edda (n=4, 6, and 8) showed a minimum for n=6. Furthermore, the lowest surface tension of 2C(6)(F) edda at the cmc was 16.4mNm(-1). Such unique behavior has not been observed even in the other fluorinated surfactants. Changes in the shapes and sizes of these surfactant aggregate with concentration were investigated by dynamic light scattering and transmission electron microscopy (TEM). The TEM micrographs showed that in an aqueous alkali solution, 2C(n)(F) edda mainly formed aggregates with stringlike (n=4), cagelike (n=6), and distorted bilayer structures (n=8). The morphological changes in the aggregates were affected by the molecular structure composed of nonflexible fluorocarbon chains and flexible hydrocarbon chains.
The lick-index calibration of the Gemini multi-object spectrographs
International Nuclear Information System (INIS)
Puzia, Thomas H.; Miller, Bryan W.; Trancho, Gelys; Basarab, Brett; Mirocha, Jordan T.; Butler, Karen
2013-01-01
We present the calibration of the spectroscopic Lick/IDS standard line-index system for measurements obtained with the Gemini Multi-Object Spectrographs known as GMOS-North and GMOS-South. We provide linear correction functions for each of the 25 standard Lick line indices for the B600 grism and two instrumental setups, one with 0.''5 slit width and 1 × 1 CCD pixel binning (corresponding to ∼2.5 Å spectral resolution) and the other with 0.''75 slit width and 2 × 2 binning (∼4 Å). We find small and well-defined correction terms for the set of Balmer indices Hβ, Hγ A , and Hδ A along with the metallicity sensitive indices Fe5015, Fe5270, Fe5335, Fe5406, Mg 2 , and Mgb that are widely used for stellar population diagnostics of distant stellar systems. We find other indices that sample molecular absorption bands, such as TiO 1 and TiO 2 , with very wide wavelength coverage or indices that sample very weak molecular and atomic absorption features, such as Mg 1 , as well as indices with particularly narrow passband definitions, such as Fe4384, Ca4455, Fe4531, Ca4227, and Fe5782, which are less robustly calibrated. These indices should be used with caution.
EVIDENCE FOR DELAYED MASSIVE STAR FORMATION IN THE M17 PROTO-OB ASSOCIATION
International Nuclear Information System (INIS)
Povich, Matthew S.; Whitney, Barbara A.
2010-01-01
Through analysis of archival images and photometry from the Spitzer GLIMPSE and MIPSGAL surveys combined with Two Micron All Sky Survey and MSX data, we have identified 488 candidate young stellar objects (YSOs) in the giant molecular cloud M17 SWex, which extends ∼50 pc southwest from the prominent Galactic H II region M17. Our sample includes >200 YSOs with masses >3 M sun that will become B-type stars on the main sequence. Extrapolating over the stellar initial mass function (IMF), we find that M17 SWex contains >1.3 x 10 4 young stars, representing a proto-OB association. The YSO mass function is significantly steeper than the Salpeter IMF, and early O stars are conspicuously absent from M17 SWex. Assuming M17 SWex will form an OB association with a Salpeter IMF, these results reveal the combined effects of (1) more rapid circumstellar disk evolution in more massive YSOs and (2) delayed onset of massive star formation.
Gemini News Service Re-launch | CRDI - Centre de recherches ...
International Development Research Centre (IDRC) Digital Library (Canada)
Gemini closed in 2002 after three decades of operation due, in part, to the high cost of operating in London, a poor business plan and failure to adapt to new information and communications technologies (ICTs). Nevertheless, the Gemini brand still retains considerable value and Carleton University has secured the right to ...
Design and analysis of the Gemini chain system in dual clutch transmission of automobile
Cheng, Yabing; Guo, Haitao; Fu, Zhenming; Wan, Nen; Li, Lei; Wang, Yang
2015-01-01
Chain drive system is widely used in the conditions of high-speed, overload, variable speed and load. Many studies are focused on the meshing theory and wear characteristics of chain drive system, but system design, analysis, and noise characteristics of the chain drive system are weak. System design and noise characteristic are studied for a new type Gemini chain of dual-clutch automatic transmission. Based on the meshing theory of silent chain, the design parameters of the Gemini chain system are calculated and the mathematical models and dynamic analysis models of the Gemini chain system are established. Dynamic characteristics of the Gemini chain system is simulated and the contact force of plate and pin, plate and sprockets, the chain tension forces, the transmission error and the stress of plates and pins are analyzed. According to the simulation results of the Gemini chain system, the noise experiment about system is carried out. The noise values are tested at different speed and load and spectral characteristics are analyzed. The results of simulation and experimental show that the contact forces of plate and pin, plate and sprockets are smaller than the allowable stress values, the chain tension force is less than ultimate tension and transmission error is limited in 1.2%. The noise values can meet the requirements of industrial design, and it is proved that the design and analysis method of the Gemini chain system is scientific and feasible. The design and test system is built from analysis to test of Gemini chain system. This research presented will provide a corresponding theoretical guidance for the design and dynamic characteristics and noise characteristics of chain drive system.
International Nuclear Information System (INIS)
Allen, Thomas S.; Prchlik, Jakub J.; Megeath, S. Thomas; Gutermuth, Robert A.; Pipher, Judith L.; Naylor, Tim; Jeffries, R. D.
2014-01-01
We determine the extinction law through Cep OB3b, a young cluster of 3000 stars undergoing gas dispersal. The extinction is measured toward 76 background K giants identified with MMT/Hectospec spectra. Color excess ratios were determined toward each of the giants using V and R photometry from the literature, g, r, i, and z photometry from the Sloan Digital Sky Survey and J, H, and K s photometry from the Two Micron All Sky Survey. These color excess ratios were then used to construct the extinction law through the dusty material associated with Cep OB3b. The extinction law through Cep OB3b is intermediate between the R V = 3.1 and R V = 5 laws commonly used for the diffuse atomic interstellar medium and dense molecular clouds, respectively. The dependence of the extinction law on line-of-sight A V is investigated and we find the extinction law becomes shallower for regions with A V > 2.5 mag. We speculate that the intermediate dust law results from dust processing during the dispersal of the molecular cloud by the cluster.
Energy Technology Data Exchange (ETDEWEB)
Allen, Thomas S.; Prchlik, Jakub J.; Megeath, S. Thomas [University of Toledo, Ritter Astrophysical Observatory, Department of Physics and Astronomy, Toledo, OH 43606 (United States); Gutermuth, Robert A. [Five College Astronomy Department, Smith College, Northampton, MA 01063 (United States); Pipher, Judith L. [Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627 (United States); Naylor, Tim [School of Physics, University of Exeter, Exeter, UK EX4 4QL (United Kingdom); Jeffries, R. D. [Astrophysics Group, School of Physical and Geographical Sciences, Keele University, Keele, Staffordshire, UK ST5 5BG (United Kingdom)
2014-05-10
We determine the extinction law through Cep OB3b, a young cluster of 3000 stars undergoing gas dispersal. The extinction is measured toward 76 background K giants identified with MMT/Hectospec spectra. Color excess ratios were determined toward each of the giants using V and R photometry from the literature, g, r, i, and z photometry from the Sloan Digital Sky Survey and J, H, and K{sub s} photometry from the Two Micron All Sky Survey. These color excess ratios were then used to construct the extinction law through the dusty material associated with Cep OB3b. The extinction law through Cep OB3b is intermediate between the R{sub V} = 3.1 and R{sub V} = 5 laws commonly used for the diffuse atomic interstellar medium and dense molecular clouds, respectively. The dependence of the extinction law on line-of-sight A{sub V} is investigated and we find the extinction law becomes shallower for regions with A{sub V} > 2.5 mag. We speculate that the intermediate dust law results from dust processing during the dispersal of the molecular cloud by the cluster.
International Nuclear Information System (INIS)
Hajy Alimohammadi, Marjan; Javadian, Soheila; Gharibi, Hussein; Tehrani-Bagha, Ali reza; Alavijeh, Mohammad Rashidi; Kakaei, Karim
2012-01-01
Graphical abstract: Highlights: → Enthalpy-entropy compensation relation was found between and for gemini surfactants. → The intermicellar interaction parameters are influenced with increasing the lengths of the tail and the spacer of gemini surfactants. → Increasing temperature decreases the intermicellar interaction parameters. → The changes in micellar surface charge density, and phase transition between spherical and rod geometries explain the data. - Abstract: The aggregation behavior of the cationic Gemini surfactants C m H 2m+1 N(CH 3 ) 2 (CH 2 ) S (CH 3 ) 2 N C m H 2m+1 ,2Br - with m = 12, 14 and s = 2, 4 were studied by performing surface tension, electrical conductivity, pulsed field gradient nuclear magnetic resonance (PFG-NMR), and cyclic voltammetry (CV) measurements over the temperature range 298 K to 323 K. The critical micelle concentration (CMC), surface excess (Γ max ), mean molecular surface area (A min ), degree of counter ion dissociation (α), and the thermodynamic parameters of micellization were determined from the surface tension and conductance data. An enthalpy-entropy compensation effect was observed and all the plots of enthalpy-entropy compensation exhibit excellent linearity. The micellar self-diffusion coefficients (D m ) and intermicellar interaction parameters (k d ) were obtained from the PFG-NMR and CV measurements. These results are discussed in terms of the intermicellar interactions, the effects of the chain and spacer lengths on the micellar surface charge density, and the phase transition between spherical and rod geometries. The intermicellar interaction parameters were found to decrease slightly with increasing temperature for 14-4-14, which suggests that the micellar surface charge density decreases with increasing temperature. The mean values of the hydrodynamic radius, R h , and the aggregation number, N agg , of the Gemini surfactants'm-4-m micelles were calculated from the micellar self-diffusion coefficient
Deng, Xiuling; Wang, Jiliang; Jiao, Li; Utaipan, Tanyarath; Tuma-Kellner, Sabine; Schmitz, Gerd; Liebisch, Gerhard; Stremmel, Wolfgang; Chamulitrat, Walee
2016-05-01
PLA2G6 or GVIA calcium-independent PLA2 (iPLA2β) is identified as one of the NAFLD modifier genes in humans, and thought to be a target for NAFLD therapy. iPLA2β is known to play a house-keeping role in phospholipid metabolism and remodeling. However, its role in NAFLD pathogenesis has not been supported by results obtained from high-fat feeding of iPLA2β-null (PKO) mice. Unlike livers of human NAFLD and genetically obese rodents, fatty liver induced by high-fat diet is not associated with depletion of hepatic phospholipids. We therefore tested whether iPLA2β could regulate obesity and hepatic steatosis in leptin-deficient mice by cross-breeding PKO with ob/ob mice to generate ob/ob-PKO mice. Here we observed an improvement in ob/ob-PKO mice with significant reduction in serum enzymes, lipids, glucose, insulin as well as improved glucose tolerance, and reduction in islet hyperplasia. The improvement in hepatic steatosis measured by liver triglycerides, fatty acids and cholesterol esters was associated with decreased expression of PPARγ and de novo lipogenesis genes, and the reversal of β-oxidation gene expression. Notably, ob/ob livers contained depleted levels of lysophospholipids and phospholipids, and iPLA2β deficiency in ob/ob-PKO livers lowers the former, but replenished the latter particularly phosphatidylethanolamine (PE) and phosphatidylcholine (PC) that contained arachidonic (AA) and docosahexaenoic (DHA) acids. Compared with WT livers, PKO livers also contained increased PE and PC containing AA and DHA. Thus, iPLA2β deficiency protected against obesity and ob/ob fatty liver which was associated with hepatic fatty-acyl phospholipid remodeling. Our results support the deleterious role of iPLA2β in severe obesity associated NAFLD. Copyright © 2016 Elsevier B.V. All rights reserved.
Gemini Spectroscopic Survey of Young Intermediate-Mass Star-Forming Regions
Lundquist, Michael; Kobulnicky, Henry
2018-01-01
The majority of stars form in embedded clusters. Current research into star formation has focused on either high-mass star-forming regions or low-mass star-forming regions. We present the results from a Gemini spectroscopic survey of young intermediate-mass star-forming regions. These are star forming regions selected to produce stars up to but not exceeding 8 solar masses. We obtained spectra of these regions with GNIRS on Gemini North and Flamingos-2 on Gemini South. We also combine this with near-infrared imaging from 2MASS, UKIDSS, and VVV to study the stellar content.
Energy Technology Data Exchange (ETDEWEB)
Fischer, Travis C.; Straughn, A. N. [Astrophysics Science Division, Goddard Space Flight Center, Code 665, Greenbelt, MD 20771 (United States); Machuca, C.; Crenshaw, D. M.; Baron, F.; Revalski, M.; Pope, C. L. [Department of Physics and Astronomy, Georgia State University, Astronomy Offices, 25 Park Place, Suite 605, Atlanta, GA 30303 (United States); Diniz, M. R.; Riffel, R. A. [Departamento de Física, Centro de Ciências Naturais e Exatas, Universidade Federal de Santa Maria, 97105-900 Santa Maria, RS (Brazil); Kraemer, S. B. [Institute for Astrophysics and Computational Sciences, Department of Physics, The Catholic University of America, Washington, DC 20064 (United States); Schmitt, H. R. [Naval Research Laboratory, Washington, DC 20375 (United States); Storchi-Bergmann, T., E-mail: travis.c.fischer@nasa.gov [Departamento de Astronomia, Universidade Federal do Rio Grande do Sul, IF, CP 15051, 91501-970 Porto Alegre, RS (Brazil)
2017-01-01
We present near-infrared and optical emission-line and stellar kinematics of the Seyfert 2 galaxy Mrk 573 using the Near-Infrared Field Spectrograph (NIFS) at Gemini North and Dual Imaging Spectrograph at Apache Point Observatory, respectively. By obtaining full kinematic maps of the infrared ionized and molecular gas and stellar kinematics in a ∼700 × 2100 pc{sup 2} circumnuclear region of Mrk 573, we find that kinematics within the Narrow-Line Region are largely due to a combination of both rotation and in situ acceleration of material originating in the host disk. Combining these observations with large-scale, optical long-slit spectroscopy that traces ionized gas emission out to several kpcs, we find that rotation kinematics dominate the majority of the gas. We find that outflowing gas extends to distances less than 1 kpc, suggesting that outflows in Seyfert galaxies may not be powerful enough to evacuate their entire bulges.
Fischer, Travis C.; Machuca, C.; Diniz, M. R.; Crenshaw, D. M.; Kraemer, S. B.; Riffel, R. A.; Schmitt, H. R.; Baron, F.; Storchi-Bergmann, T.; Straughn, A. N.;
2016-01-01
We present near-infrared and optical emission-line and stellar kinematics of the Seyfert 2 galaxy Mrk 573 using the Near-Infrared Field Spectrograph (NIFS) at Gemini North and Dual Imaging Spectrograph at Apache Point Observatory, respectively. By obtaining full kinematic maps of the infrared ionized and molecular gas and stellar kinematics in approximately 700 x 2100 pc(exp 2) circumnuclear region of Mrk 573, we find that kinematics within the Narrow-Line Region are largely due to a combination of both rotation and in situ acceleration of material originating in the host disk. Combining these observations with large-scale, optical long-slit spectroscopy that traces ionized gas emission out to several kpcs, we find that rotation kinematics dominate the majority of the gas. We find that outflowing gas extends to distances less than 1 kpc, suggesting that outflows in Seyfert galaxies may not be powerful enough to evacuate their entire bulges.
Leptin differentially regulates STAT3 activation in the ob/ob mice adipose mesenchymal stem cells
Leptin-deficient genetically obese ob/ob mice exhibit adipocyte hypertrophy and hyperplasia as well as elevated adipose tissue and systemic inflammation. Studies have shown that multipotent stem cells isolated from adult adipose tissue can differentiate into adipocytes ex vivo and thereby contribute...
uvby and JHKL photometry of OB stars in the association Cygnus OB2
International Nuclear Information System (INIS)
Torres-Dodgen, A.V.; Carroll, M.; Tapia, M.
1991-01-01
We have obtained uvby and JHK photometry of about 80 stars in the association Cygnus OB2 (VI Cygni), including some foreground stars and three infrared sources. We present colour-colour and colour-magnitude diagrams from which we derive the interstellar extinction and approximate spectral types. We confirm that the interstellar extinction law in the direction of Cyg OB2 is similar to the galactic mean. (author)
Dual-beam operation of the Astra Gemini laser facility
International Nuclear Information System (INIS)
Bryan Parry; Nicola Booth; Oleg Chekhlov; John Collier; Edwin Divall; Klaus Ertel; Peta Foster; Steve Hawkes; Chris Hooker; Victoria Marshall
2010-01-01
Complete text of publication follows. Gemini is a Petawatt class Ti:Sapphire laser system at the Rutherford Appleton Laboratory, UK. It was designed as a dual beam laser, with two independently configurable 800 nm beams delivering 15 J to target in 30 fs pulse duration, giving 0.5 PW peak power per beam. It is capable of reaching intensities over 10 22 W/cm 2 . Gemini can achieve a maximum repetition rate of one shot every 20 seconds, allowing it to deliver hundreds of shots per day; a feature which makes it unique among PW lasers. Already this has proved valuable in experiments involving electron acceleration in gas jets. The first Gemini beamline became operational in 2008. Commissioning of the second beam was deferred to allow earlier access to the facility by experimental scientists, and to develop operational experience. In this mode, Gemini has already produced significant results from a number of advanced plasma physics experiments. The second beam of Gemini is now coming online, with the first dual beam experiment starting in June 2010. The flexibility offered by two short pulse, ultra high intensity beams is another aspect that makes this laser system unique. The dual beams enable versatile configurations and illumination geometries, facilitating a wider range of experiments than is possible with only a single beam. Operationally however, it introduces additional factors which must be monitored and controlled in order to achieve experimental success. The beams must be timed with respect to each other with accuracy less than the pulse duration. The beam foci must also be overlapped spatially, and the stability of both these factors maintained over extended periods. We report on the second beam commissioning process, including the latest results on the characteristics, stability and spatio-temporal overlap of the two beams. We present details of amplifier performance, along with measurements of beam quality, focal spot, pulse duration and contrast, to give a
Action of Monomeric/Gemini Surfactants on Free Cells and Biofilm of Asaia lannensis
Directory of Open Access Journals (Sweden)
Anna Koziróg
2017-11-01
Full Text Available We investigated the biological activity of surfactants based on quaternary ammonium compounds: gemini surfactant hexamethylene-1,6-bis-(N,N-dimethyl-N-dodecylammonium bromide (C6, synthesized by the reaction of N,N-dimethyl-N-dodecylamine with 1,6-dibromohexane, and its monomeric analogue dodecyltrimethylammonium bromide (DTAB. The experiments were performed with bacteria Asaia lannensis, a common spoilage in the beverage industry. The minimal inhibitory concentration (MIC values were determined using the tube standard two-fold dilution method. The growth and adhesive properties of bacterial cells were studied in different culture media, and the cell viability was evaluated using plate count method. Both of the surfactants were effective against the bacterial strain, but the MIC of gemini compound was significantly lower. Both C6 and DTAB exhibited anti-adhesive abilities. Treatment with surfactants at or below MIC value decreased the number of bacterial cells that were able to form biofilm, however, the gemini surfactant was more effective. The used surfactants were also found to be able to eradicate mature biofilms. After 4 h of treatment with C6 surfactant at concentration 10 MIC, the number of bacterial cells was reduced by 91.8%. The results of this study suggest that the antibacterial activity of the gemini compound could make it an effective microbiocide against the spoilage bacteria Asaia sp. in both planktonic and biofilm stages.
Action of Monomeric/Gemini Surfactants on Free Cells and Biofilm of Asaia lannensis.
Koziróg, Anna; Kręgiel, Dorota; Brycki, Bogumił
2017-11-22
We investigated the biological activity of surfactants based on quaternary ammonium compounds: gemini surfactant hexamethylene-1,6-bis-( N,N -dimethyl- N -dodecylammonium bromide) (C6), synthesized by the reaction of N,N -dimethyl- N- dodecylamine with 1,6-dibromohexane, and its monomeric analogue dodecyltrimethylammonium bromide (DTAB). The experiments were performed with bacteria Asaia lannensis , a common spoilage in the beverage industry. The minimal inhibitory concentration (MIC) values were determined using the tube standard two-fold dilution method. The growth and adhesive properties of bacterial cells were studied in different culture media, and the cell viability was evaluated using plate count method. Both of the surfactants were effective against the bacterial strain, but the MIC of gemini compound was significantly lower. Both C6 and DTAB exhibited anti-adhesive abilities. Treatment with surfactants at or below MIC value decreased the number of bacterial cells that were able to form biofilm, however, the gemini surfactant was more effective. The used surfactants were also found to be able to eradicate mature biofilms. After 4 h of treatment with C6 surfactant at concentration 10 MIC, the number of bacterial cells was reduced by 91.8%. The results of this study suggest that the antibacterial activity of the gemini compound could make it an effective microbiocide against the spoilage bacteria Asaia sp. in both planktonic and biofilm stages.
On the Shoulders of Titans: A History of Project Gemini
Hacker, B. C.
1977-01-01
Gemini was the intermediate manned space flight program between America's first steps into space with Mercury and the manned lunar expeditions of Apollo. Because of its position between these two other efforts, Gemini is probably less remembered. Still, it more than had its place in man's progress into this new frontier. Gemini accomplishments were manyfold. They included many firsts: first astronaut-controlled maneuvering in space; first rendezvous in space of one spacecraft with another; first docking of one spacecraft with a propulsive stage and use of that stage to transfer man to high altitude; first traverse of man into the earth's radiation belts; first extended manned flights of a week or more in duration; first extended stays of man outside his spacecraft; first controlled reentry and precision landing; and many more. These achievements were significant in ways one cannot truly evaluate even today, but two things stand out: (1) it was the time when America caught up and surpassed the Soviet Union in manned space flight, and (2) these demonstrations of capability were an absolute prerequisite to the phenomenal Apollo accomplishments then yet to come.
Krisko, Tibor I; LeClair, Katherine B; Cohen, David E
2017-03-01
Phosphatidylcholine transfer protein (PC-TP; synonym StarD2) is highly expressed in liver and oxidative tissues. PC-TP promotes hepatic glucose production during fasting and aggravates glucose intolerance in high fat fed mice. However, because PC-TP also suppresses thermogenesis in brown adipose tissue (BAT), its direct contribution to obesity-associated diabetes in mice remains unclear. Here we examined the effects of genetic PC-TP ablation on glucose homeostasis in leptin-deficient ob/ob mice, which exhibit both diabetes and altered thermoregulation. Mice lacking both PC-TP and leptin (Pctp -/- ;ob/ob) were prepared by crossing Pctp -/- with ob/+ mice. Glucose homeostasis was assessed by standard assays, and energy expenditure was determined by indirect calorimetry using a comprehensive laboratory animal monitoring system, which also recorded physical activity and food intake. Body composition was determined by NMR and hepatic lipids by enzymatic assays. Core body temperature was measured using a rectal thermocouple probe. Pctp -/- ;ob/ob mice demonstrated improved glucose homeostasis, as evidenced by markedly improved glucose and pyruvate tolerance tests, without changes in insulin tolerance. However, there were no differences in EE at any ambient temperature. There were also no effects of PC-TP expression on physical activity, food intake or core body temperature. Improved glucose tolerance in Pctp -/- ;ob/ob mice in the absence of increases in energy expenditure or core body temperature indicates a direct pathogenic role for PC-TP in diabetes in leptin deficient mice. Copyright © 2016 Elsevier Inc. All rights reserved.
Donkuru, McDonald; Michel, Deborah; Awad, Hanan; Katselis, George; El-Aneed, Anas
2016-05-13
Diquaternary gemini surfactants have successfully been used to form lipid-based nanoparticles that are able to compact, protect, and deliver genetic materials into cells. However, what happens to the gemini surfactants after they have released their therapeutic cargo is unknown. Such knowledge is critical to assess the quality, safety, and efficacy of gemini surfactant nanoparticles. We have developed a simple and rapid liquid chromatography electrospray ionization-tandem mass spectrometry (LC-ESI-MS/MS) method for the quantitative determination of various structures of gemini surfactants in cells. Hydrophilic interaction liquid chromatography (HILIC) was employed allowing for a short simple isocratic run of only 4min. The lower limit of detection (LLOD) was 3ng/mL. The method was valid to 18 structures of gemini surfactants belonging to two different structural families. A full method validation was performed for two lead compounds according to USFDA guidelines. The HILIC-MS/MS method was compatible with the physicochemical properties of gemini surfactants that bear a permanent positive charge with both hydrophilic and hydrophobic elements within their molecular structure. In addition, an effective liquid-liquid extraction method (98% recovery) was employed surpassing previously used extraction methods. The analysis of nanoparticle-treated cells showed an initial rise in the analyte intracellular concentration followed by a maximum and a somewhat more gradual decrease of the intracellular concentration. The observed intracellular depletion of the gemini surfactants may be attributable to their bio-transformation into metabolites and exocytosis from the host cells. Obtained cellular data showed a pattern that grants additional investigations, evaluating metabolite formation and assessing the subcellular distribution of tested compounds. Copyright © 2016 Elsevier B.V. All rights reserved.
Hello, Y.; Yegikyan, M.; Charvis, P.; Philippe, O.
2017-12-01
Manta is a new BroadBand OBS developed at Geoazur and commercialized by Osean. The design is inspired by 3-years autonomy MUG-OBS a Multiparameter Ocean Bottom System which carry a lot of sort of sensor types. As Mug-OBS, Manta-OBS rated 6000m is designed to resist a trawling. All the components are non corrosive such polyethylene, titanium and buoyancy is ensured by syntactic foam. Equipped in standard version with a Trillium compact OBS Manta has an autonomy of 18 months, but can accept on its 4 input channels any kind of signal as low as from an hydrophone or larger from other type of a seismometer or accelerometer. Tri-axial geophones unit (2 Hz or 4.5 Hz ) can replace the seismometer and will expend the lifespan for the instrument. The seismometer is encapsulated in a central well established by four panels of the main structure to protect it from sea current convection and is decoupled from main chassis. An health bulletin is recoverable by acoustic any time to facilitate the installation and during a visit when instrument is deployed. Main parameters for acquisition can be changed by acoustics command from surface at any time. Once at the bottom, release for the main sensor installation is programmed on a timer but controlled by the tilt of the OBS. If the tilt is too important based on programmed limits, sensor will not released automatically, but this can be forced by acoustic command after returning the tilt informations to the boat operator. Manta is equipped with flash light and AIS system for easy location at recovery, and can also send it's position by Iridium satellite in case of an unexpected ascent such caused by a possible trawling if deployed in shallow water. Clock drift calculation is automatically made against GPS time signal once the OBS return at the surface. The recovery of the OBS is initiated by an acoustic command. These new features made Manta a very versatile instrument for monitoring earthquakes.
Gemini Surfactant-Modified Activated Carbon for Remediation of Hexavalent Chromium from Water
Directory of Open Access Journals (Sweden)
Yingying Zhou
2018-01-01
Full Text Available Gemini surfactants, with double hydrophilic and hydrophobic groups, offer potentially orders of magnitude greater surface activity compared to similar single unit molecules. A cationic Gemini surfactant (Propyl didodecyldimethylammonium Bromide, PDDDAB and a conventional cationic surfactant (Dodecyltrimethylammonium Bromide, DTAB were used to pre-treat and generate activated carbon. The removal efficiency of the surfactant-modified activated carbon through adsorption of chromium(VI was investigated under controlled laboratory conditions. Fourier-transform infrared spectroscopy (FT-IR and scanning electron microscopy (SEM were used to investigate the surface changes of surfactant-modified activated carbon. The effect of important parameters such as adsorbent dosage, pH, ionic strength and contact time were also investigated. The chromium(VI was adsorbed more significantly on the Gemini surfactant-modified activated carbon than on the conventional surfactant-modified activated carbon. The correlation coefficients show the data best fit the Freundlich model, which confirms the monolayer adsorption of chromium(VI onto Gemini surfactant-modified activated carbon. From this assessment, the surfactant-modified (especially Gemini surfactant-modified activated carbon in this study showed promise for practical applications to treat water pollution.
Cellular and molecular cues of glucose sensing in the rat olfactory bulb
Directory of Open Access Journals (Sweden)
Dolly eAl Koborssy
2014-10-01
Full Text Available In the brain, glucose homeostasis of extracellular fluid is crucial to the point that systems specifically dedicated to glucose sensing are found in areas involved in energy regulation and feeding behavior. Olfaction is a major sensory modality regulating food consumption. Nutritional status in turn modulates olfactory detection. Recently it has been proposed that some olfactory bulb (OB neurons respond to glucose similarly to hypothalamic neurons. However, the precise molecular cues governing glucose sensing in the OB are largely unknown. To decrypt these molecular mechanisms, we first used immunostaining to demonstrate a strong expression of two neuronal markers of glucose-sensitivity, insulin-dependent glucose transporter type 4 (GLUT4, and sodium glucose co-transporter type 1 (SGLT1 in specific OB layers. We showed that expression and mapping of GLUT4 but not SGLT1 were feeding state-dependent. In order to investigate the impact of metabolic status on the delivery of blood-borne glucose to the OB, we measured extracellular fluid glucose concentration using glucose biosensors simultaneously in the OB and cortex of anesthetized rats. We showed that glucose concentration in the OB is higher than in the cortex, that metabolic steady-state glucose concentration is independent of feeding state in the two brain areas, and that acute changes in glycemic conditions affect bulbar glucose concentration alone. These data provide new evidence of a direct relationship between the OB and peripheral metabolism, and emphasize the importance of glucose for the OB network, providing strong arguments toward establishing the OB as a glucose-sensing organ.
Zhang, Shaohua; Yan, Han; Zhao, Mingwei; Zheng, Liqiang
2012-04-15
Three gemini pyrrolidine-based ionic liquids, 1,1'-(butane-1,4-diyl)bis(1-alkylpyrrolidinium) bromide ([C(n)py-4-C(n)py][Br(2)], n=10, 12, 14), were synthesized. Their aggregation behavior in aqueous solution was systematically investigated by surface tension, electrical conductivity, and steady-state fluorescence. Compared with their corresponding monomers, N-alkyl-N-methylpyrrolidinium bromide (C(n)MPB), [C(n)py-4-C(n)py][Br(2)], have higher surface activity. The special structure of [C(n)py-4-C(n)py][Br(2)] that has a spacer in their hydrophilic head groups results in a lower surface excess concentration (Γ(max)) and a larger molecular cross-sectional area (A(min)). Electrical conductivity studies show a lower degree of counter-ion binding to the aggregates. A smaller aggregation number (N(agg)) is observed by the pyrene fluorescence quenching method. A series of thermodynamic parameters (ΔG(agg)(0),ΔH(agg)(0),-TΔS(agg)(0)) of aggregation derived from electrical conductivity indicate that the aggregation of [C(n)py-4-C(n)py][Br(2)] is enthalpy-driven, while aggregation of C(n)MPB is entropy-driven at low temperatures but enthalpy-driven at high temperatures. Copyright © 2012 Elsevier Inc. All rights reserved.
Zinc metabolism in genetically obese (ob/ob) mice
International Nuclear Information System (INIS)
Kennedy, M.L.; Failla, M.L.
1987-01-01
Recent reports indicate that the concentrations and total amounts of several essential trace metals in various tissues of genetically obese rodents differ markedly from those in lean controls. In the present studies the absorption, retention and tissue distribution of zinc and constitutive levels of zinc-metallothionein (Zn-MT) in selected tissues were compared in obese (ob/ob) and lean (+/?) C57BL/6J mice. When 5-, 10- and 22-wk-old mice were administered 1.2 mumol 65 Zn by stomach tube the apparent absorption of 65 Zn by obese mice was 1.5, 2.2 and 3.9 times higher, respectively, than that in age-matched lean mice. Retention of orally administered 65 Zn after 96 h was also substantially higher in obese mice than in lean mice. To assess the possible influences of hyperphagia and intestinal hypertrophy on the enhanced apparent absorption of 65 Zn by obese mice food intake by an additional group of obese mice was restricted to that of age-matched lean controls. When actual absorption of zinc was determined according to the method of Heth and Hoekstra, groups of ad libitum--fed obese, pair-fed obese and lean mice absorbed 38, 32 and 18% of administered 65 Zn, respectively. In contrast, the rate of 65 Zn excretion 2-6 d after oral or subcutaneous administration of the metal was similar for obese and lean mice. Unrestricted and pair-fed obese mice had significantly lower percentages of carcass 65 Zn present in skin, muscle plus bone, spleen and testes and higher percentages present in liver, small intestine and adipose tissue than lean mice
Deflection routing scheme for GMPLS-based OBS networks
DEFF Research Database (Denmark)
Eid, Arafat; Mahmood, Waqar; Alomar, Anwar
2010-01-01
Integrating the Generalized Multi-Protocol Label Switching (GMPLS) framework into an Optical Burst Switching (OBS) Control Plane is a promising solution to alleviating most of OBS performance and design issues. However, implementing the already proposed OBS deflection routing schemes is not appli...
Meeting the challenges of bringing a new base facility operation model to Gemini Observatory
Nitta, Atsuko; Arriagada, Gustavo; Adamson, A. J.; Cordova, Martin; Nunez, Arturo; Serio, Andrew; Kleinman, Scot
2016-08-01
The aim of the Gemini Observatory's Base Facilities Project is to provide the capabilities to perform routine night time operations with both telescopes and their instruments from their respective base facilities without anyone present at the summit. Tightening budget constraints prompted this project as both a means to save money and an opportunity to move toward increasing remote operations in the future. We successfully moved Gemini North nighttime operation to our base facility in Hawaii in Nov., 2015. This is the first 8mclass telescope to completely move night time operations to base facility. We are currently working on implementing BFO to Gemini South. Key challenges for this project include: (1) This is a schedule driven project. We have to implement the new capabilities by the end of 2015 for Gemini North and end of 2016 for Gemini South. (2) The resources are limited and shared with operations which has the higher priority than our project. (3) Managing parallel work within the project. (4) Testing, commissioning and introducing new tools to operational systems without adding significant disruptions to nightly operations. (5) Staff buying to the new operational model. (6) The staff involved in the project are spread on two locations separated by 10,000km, seven time zones away from each other. To overcome these challenges, we applied two principles: "Bare Minimum" and "Gradual Descent". As a result, we successfully completed the project ahead of schedule at Gemini North Telescope. I will discuss how we managed the cultural and human aspects of the project through these concepts. The other management aspects will be presented by Gustavo Arriagada [2], the Project Manager of this project. For technical details, please see presentations from Andrew Serio [3] and Martin Cordova [4].
The complex jet- and bar-perturbed kinematics in NGC 3393 as revealed with ALMA and GEMINI-GMOS/IFU
Finlez, Carolina; Nagar, Neil M.; Storchi-Bergmann, Thaisa; Schnorr-Müller, Allan; Riffel, Rogemar A.; Lena, Davide; Mundell, C. G.; Elvis, Martin S.
2018-06-01
NGC 3393, a nearby Seyfert 2 galaxy with nuclear radio jets, large-scale and nuclear bars, and a posited secondary super massive black hole, provides an interesting laboratory to test the physics of inflows and outflows. Here we present and analyse the molecular gas (ALMA observations of CO J:2-1 emission over a field of view (FOV) of 45" × 45", at 0."56 (143 pc) spatial and 5 km/s spectral resolution), ionised gas and stars (GEMINI-GMOS/IFU; over a FOV of 4" × 5", at 0."62 (159 pc) spatial and 23 km/s spectral resolution) in NGC 3393. The ionised gas emission, detected over the complete GEMINI-GMOS FOV, has three identifiable kinematic components. A narrow (σ 115 km/s) redshifted component, detected near the NE and SW radio lobes; which we interpret as a radio jet driven outflow. And a broad (σ > 115 km/s) blueshifted component that shows high velocities in a region perpendicular to the radio jet axis; we interpret this as an equatorial outflow. The CO J:2-1 emission is detected in spiral arms on 5" - 20" scales, and in two disturbed circumnuclear regions. The molecular kinematics in the spiral arms can be explained by rotation. The highly disturbed kinematics of the inner region can be explained by perturbations induced by the nuclear bar and interactions with the large scale bar. We find no evidence for, but cannot strongly rule out, the presence of the posited secondary black hole.
A Multi-Fiber Spectroscopic Search for Low-mass Young Stars in Orion OB1
Loerincs, Jacqueline; Briceno, Cesar; Calvet, Nuria; Mateo, Mario L.; Hernandez, Jesus
2017-01-01
We present here results of a low resolution spectroscopic followup of candidate low-mass pre-main sequence stars in the Orion OB1 association. Our targets were selected from the CIDA Variability Survey of Orion (CVSO), and we used the Michigan/Magellan Fiber Spectrograph (M2FS) on the Magellan Clay 6.5m telescope to obtain spectra of 500 candidate T Tauri stars distributed in seven 0.5 deg diameter fields, adding to a total area of ~5.5 deg2. We identify young stars by looking at the distinctive Hα 6563 Å emission and Lithium Li I 6707 Å absorption features characteristic of young low mass pre-main sequence stars. Furthermore, by measuring the strength of their Hα emission lines, confirmed T Tauri stars can be classified as either Classical T Tauris (CTTS) or Weak-line T Tauris (WTTS), which give indication of whether the star is actively accreting material from a gas and dust disk surrounding the star, which may be the precursor of a planetary system. We confirm a total of 90 T Tauri stars, of which 50% are newly identified young members of Orion; out of the 49 new detections,15 are accreting CTTS, and of these all but one are found in the OB1b sub-region. This result is in line with our previous findings that this region is much younger than the more extended Orion OB1a sub-association. The M2FS results add to our growing census of young stars in Orion, that is allowing us to characterize in a systematic and consistent way the distribution of stellar ages across the entire complex, in order to building a complete picture of star formation in this, one of nearest most active sites of star birth.
Automated identification of OB associations in M31
Magnier, Eugene A.; Battinelli, Paolo; Lewin, Walter H. G.; Haiman, Zoltan; Paradijs, Jan Van; Hasinger, Guenther; Pietsch, Wolfgang; Supper, Rodrigo; Truemper, Joachim
1993-01-01
A new identification of OB associations in M31 has been performed using the Path Linkage Criterion (PLC) technique of Battinelli (1991). We found 174 associations with a very small contamination (less than 5%) by random clumps of stars. The expected total number and average size of OB associations in the region of M 31 covered by our data set (Magnier et al. 1992) are approximately 280 and approximately 90 pc, respectively. M31 associations therefore have sizes similar to those of OB associations observed in nearby galaxies, so that we can consider them to be classical OB associations. This list of OB associations will be used for the study of the spatial distribution of OB associations and their correlation with other objects. Taking into account the fact that we do not cover the entire disk of M31, we extrapolate a total number of association in M31 of approximately 420.
Observations of mass loss from OB and Wolf-Rayet stars
International Nuclear Information System (INIS)
Barlow, M.J.
1982-01-01
In this review, three observationally accessible parameters of the winds of OB and Wolf-Rayet stars are discussed: (1) Terminal velocities, (2) Velocity laws, (3) Mass loss rates. In addition, some discussion of the ionisation structure of the winds is included. In general, only the most recent results for OB stars are mentioned. (Auth.)
Bandsma, RHJ; Grefhorst, A; van Dijk, TH; van der Sluijs, FH; Hammer, A; Reijngoud, DJ; Kuipers, F
2004-01-01
Aims/hypothesis. Leptin-deficient ob/ob mice are hyperinsulinaemic and hyperglycaemic; however, the cause of hyperglycaemia remains largely unknown. Methods. Glucose metabolism in vivo in 9-h fasted ob/ob mice and lean littermates was studied by infusing [U-C-13]-glucose, [2-C-13]-glycerol,
Globules and pillars in Cygnus X. I. Herschel far-infrared imaging of the Cygnus OB2 environment
Schneider, N.; Bontemps, S.; Motte, F.; Blazere, A.; André, Ph.; Anderson, L. D.; Arzoumanian, D.; Comerón, F.; Didelon, P.; Di Francesco, J.; Duarte-Cabral, A.; Guarcello, M. G.; Hennemann, M.; Hill, T.; Könyves, V.; Marston, A.; Minier, V.; Rygl, K. L. J.; Röllig, M.; Roy, A.; Spinoglio, L.; Tremblin, P.; White, G. J.; Wright, N. J.
2016-06-01
The radiative feedback of massive stars on molecular clouds creates pillars, globules and other features at the interface between the H II region and molecular cloud. Optical and near-infrared observations from the ground as well as with the Hubble or Spitzer satellites have revealed numerous examples of such cloud structures. We present here Herschel far-infrared observations between 70 μm and 500 μm of the immediate environment of the rich Cygnus OB2 association, performed within the Herschel imaging survey of OB Young Stellar objects (HOBYS) program. All of the observed irradiated structures were detected based on their appearance at 70 μm, and have been classified as pillars, globules, evaporating gasous globules (EGGs), proplyd-like objects, and condensations. From the 70 μm and 160 μm flux maps, we derive the local far-ultraviolet (FUV) field on the photon dominated surfaces. In parallel, we use a census of the O-stars to estimate the overall FUV-field, that is 103-104 G0 (Habing field) close to the central OB cluster (within 10 pc) and decreases down to a few tens G0, in a distance of 50 pc. From a spectral energy distribution (SED) fit to the four longest Herschel wavelengths, we determine column density and temperature maps and derive masses, volume densities and surface densities for these structures. We find that the morphological classification corresponds to distinct physical properties. Pillars and globules are massive (~500 M⊙) and large (equivalent radius r ~ 0.6 pc) structures, corresponding to what is defined as "clumps" for molecular clouds. EGGs and proplyd-likeobjects are smaller (r ~ 0.1 and 0.2 pc) and less massive (~10 and ~30 M⊙). Cloud condensations are small (~0.1 pc), have an average mass of 35 M⊙, are dense (~6 × 104 cm-3), and can thus be described as molecular cloud "cores". All pillars and globules are oriented toward the Cyg OB2 association center and have the longest estimated photoevaporation lifetimes, a few million
Removal of phenol from synthetic waste water using Gemini micellar-enhanced ultrafiltration (GMEUF)
Energy Technology Data Exchange (ETDEWEB)
Zhang, Wenxiang [MOE Key Laboratory of Regional Energy and Environmental Systems Optimization, Resources and Environmental Research Academy, North China Electric Power University, Beijing 102206 (China); Huang, Guohe, E-mail: huang@iseis.org [MOE Key Laboratory of Regional Energy and Environmental Systems Optimization, Resources and Environmental Research Academy, North China Electric Power University, Beijing 102206 (China); Wei, Jia [Faculty of Engineering and Applied Science, University of Regina, Regina, Saskatchewan, Canada S4S 0A2 (Canada); Li, Huiqin; Zheng, Rubing; Zhou, Ya [MOE Key Laboratory of Regional Energy and Environmental Systems Optimization, Resources and Environmental Research Academy, North China Electric Power University, Beijing 102206 (China)
2012-10-15
Highlights: Black-Right-Pointing-Pointer Gemini surfactant micellar enhanced ultrafiltration was used to remove phenol. Black-Right-Pointing-Pointer The effect of different hydrophilic head groups of surfactant was analyzed. Black-Right-Pointing-Pointer SEM, ATR-FTIR and mercury porosimeter were applied to elucidate membrane fouling. Black-Right-Pointing-Pointer Gemini surfactant had superior performance in comparing with conventional surfactant. - Abstract: Comprehensive studies were conducted on the phenol wastewater ultrafiltration (UF) with the help of various concentrations of cationic Gemini surfactant (N1-dodecyl-N1,N1,N2,N2-tetramethyl-N2-octylethane-1,2-diaminium bromide, CG), conventional cationic surfactant (dodecyl trimethyl ammonium bromide, DTAB), anionic surfactant (sodium dodecyl sulfate, SDS) and nonionic surfactant ((dodecyloxy)polyethoxyethanol, Brij35). A flat sheet module with polyethersulfone (PES) membrane was employed in this investigation. The effects of feed concentration (phenol and surfactant) on the retention of phenol and surfactant, permeate flux and membrane fouling by micelles were evaluated. The distribution coefficient (D), the loading of the micelles (L{sub m}) and the equilibrium distribution constant (K) were also utilized to estimate the micellar-enhanced ultrafiltration ability for phenol. Scanning electron microscope (SEM), Fourier transform infrared spectrometer with attenuated total reflectance accessory (ATR-FTIR) and mercury porosimeter were applied to analyze membrane surface morphology, membrane material characteristics and membrane fouling for the original and fouled membranes. Based on the above analysis, the performance of the selected Gemini surfactant was proved superior in the following aspects: retention of phenol/surfactant (peak value is 95.8% for phenol retention), permeate flux and membrane fouling with respect to other conventional surfactants possessing equal alkyl chain length. These results demonstrated
Wang, Anke; Anderson, Brian M; Novakovic, Zachary M; Grasso, Patricia
2018-03-01
We have previously shown that following oral delivery in dodecyl maltoside (DDM), [D-Leu-4]-OB3 and its myristic acid conjugate, MA-[D-Leu-4]-OB3, improved energy balance and glucose homeostasis in genetically obese/diabetic mouse models. More recently, we have provided immunohistochemical evidence indicating that these synthetic peptide leptin mimetics cross the blood-brain barrier and concentrate in the area of the arcuate nucleus of the hypothalamus in normal C57BL/6J and Swiss Webster mice, in genetically obese ob/ob mice, and in diet-induced obese (DIO) mice. In the present study, we describe the effects of oral delivery of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on glycemic control in diet-induced (DIO) mice, a non-genetic rodent model of obesity and its associated insulin resistance, which more closely recapitulates common obesity and diabetes in humans. Male C57BL/6J and DIO mice, 17, 20, and 28 weeks of age, were maintained on a low-fat or high-fat diet and given vehicle (DDM) alone or [D-Leu-4]-OB3 or MA-[D-Leu-4]-OB3 in DDM by oral gavage for 12 or 14 days. Body weight gain, food and water intake, fasting blood glucose, oral glucose tolerance, and serum insulin levels were measured. Our data indicate that (1) [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 restore glucose tolerance in male DIO mice maintained on a high-fat diet to levels comparable to those of non-obese C57BL/6J wild-type mice of the same age and sex maintained on a low-fat diet; and (2) the influence of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on glycemic control appears to be independent of their effects on energy balance. These results suggest that [D-Leu-4]-OB3 and/or MA-[D-Leu-4]-OB3 may have application to the management of the majority of cases of common obesity in humans, a state characterized at least in part, by leptin resistance resulting from a defect in leptin transport across the blood-brain barrier. They further suggest that these small molecule synthetic peptide leptin mimetics, through their
GEMINI: a computationally-efficient search engine for large gene expression datasets.
DeFreitas, Timothy; Saddiki, Hachem; Flaherty, Patrick
2016-02-24
Low-cost DNA sequencing allows organizations to accumulate massive amounts of genomic data and use that data to answer a diverse range of research questions. Presently, users must search for relevant genomic data using a keyword, accession number of meta-data tag. However, in this search paradigm the form of the query - a text-based string - is mismatched with the form of the target - a genomic profile. To improve access to massive genomic data resources, we have developed a fast search engine, GEMINI, that uses a genomic profile as a query to search for similar genomic profiles. GEMINI implements a nearest-neighbor search algorithm using a vantage-point tree to store a database of n profiles and in certain circumstances achieves an [Formula: see text] expected query time in the limit. We tested GEMINI on breast and ovarian cancer gene expression data from The Cancer Genome Atlas project and show that it achieves a query time that scales as the logarithm of the number of records in practice on genomic data. In a database with 10(5) samples, GEMINI identifies the nearest neighbor in 0.05 sec compared to a brute force search time of 0.6 sec. GEMINI is a fast search engine that uses a query genomic profile to search for similar profiles in a very large genomic database. It enables users to identify similar profiles independent of sample label, data origin or other meta-data information.
I Jornada Internacional GEMInIS (JIG/2014
Directory of Open Access Journals (Sweden)
GEMInIS Grupo de Estudos sobre Mídias Interativas em Imagem e Som
2013-12-01
Full Text Available A I Jornada Internacional GEMInIS (JIG/2014 terá como tema central os processos da convergência midiática que transformam o “entretenimento transmídia” na base da economia criativa. O ‘entretenimento transmídia’ ocupa um lugar central na esfera da produção e consumo, porém, é uma noção que permanece relativamente inédita no campo acadêmico. Historicamente, entretenimento é um conceito que aparece associado ao que é ‘alegre, divertido, emocionante e prazeroso’. Na I Jornada Internacional GEMInIS, pretende-se debater os processos de compartilhamento da propriedade intelectual e comercial das marcas, visando um maior entendimento sobre o modo como o conteúdo audiovisual é concebido e distribuído nas redes culturais e comunicacionais.
Huang, S-L; Yu, R-T; Gong, J; Feng, Y; Dai, Y-L; Hu, F; Hu, Y-H; Tao, Y-D; Leng, Y
2012-05-01
Arctigenin is a natural compound that had never been previously demonstrated to have a glucose-lowering effect. Here it was found to activate AMP-activated protein kinase (AMPK), and the mechanism by which this occurred, as well as the effects on glucose and lipid metabolism were investigated. 2-Deoxyglucose uptake and AMPK phosphorylation were examined in L6 myotubes and isolated skeletal muscle. Gluconeogenesis and lipid synthesis were evaluated in rat primary hepatocytes. The acute and chronic effects of arctigenin on metabolic abnormalities were observed in C57BL/6J and ob/ob mice. Changes in mitochondrial membrane potential were measured using the J-aggregate-forming dye, JC-1. Analysis of respiration of L6 myotubes or isolated mitochondria was conducted in a channel oxygen system. Arctigenin increased AMPK phosphorylation and stimulated glucose uptake in L6 myotubes and isolated skeletal muscles. In primary hepatocytes, it decreased gluconeogenesis and lipid synthesis. The enhancement of glucose uptake and suppression of hepatic gluconeogenesis and lipid synthesis by arctigenin were prevented by blockade of AMPK activation. The respiration of L6 myotubes or isolated mitochondria was inhibited by arctigenin with a specific effect on respiratory complex I. A single oral dose of arctigenin reduced gluconeogenesis in C57BL/6J mice. Chronic oral administration of arctigenin lowered blood glucose and improved lipid metabolism in ob/ob mice. This study demonstrates a new role for arctigenin as a potent indirect activator of AMPK via inhibition of respiratory complex I, with beneficial effects on metabolic disorders in ob/ob mice. This highlights the potential value of arctigenin as a possible treatment of type 2 diabetes.
ADDITIONAL MASSIVE BINARIES IN THE CYGNUS OB2 ASSOCIATION
International Nuclear Information System (INIS)
Kiminki, Daniel C.; Kobulnicky, Henry A.; Ewing, Ian; Lundquist, Michael; Alexander, Michael; Vargas-Alvarez, Carlos; Choi, Heather; Bagley Kiminki, Megan M.; Henderson, C. B.
2012-01-01
We report the discovery and orbital solutions for two new OB binaries in the Cygnus OB2 Association, MT311 (B2V + B3V) and MT605 (B0.5V + B2.5:V). We also identify the system MT429 as a probable triple system consisting of a tight eclipsing 2.97 day B3V+B6V pair and a B0V at a projected separation of 138 AU. We further provide the first spectroscopic orbital solutions to the eclipsing, double-lined, O-star binary MT696 (O9.5V + B1:V), the double-lined, early B binary MT720 (B0-1V + B1-2V), and the double-lined, O-star binary MT771 (O7V + O9V). These systems exhibit orbital periods between 1.5 days and 12.3 days, with the majority having P <6 days. The two new binary discoveries and six spectroscopic solutions bring the total number of known massive binaries in the central region of the Cygnus OB2 Association to 20, with all but two having full orbital solutions.
ADDITIONAL MASSIVE BINARIES IN THE CYGNUS OB2 ASSOCIATION
Energy Technology Data Exchange (ETDEWEB)
Kiminki, Daniel C.; Kobulnicky, Henry A.; Ewing, Ian; Lundquist, Michael; Alexander, Michael; Vargas-Alvarez, Carlos; Choi, Heather [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82070 (United States); Bagley Kiminki, Megan M. [Department of Astronomy, University of Arizona, Tucson, AZ 85721 (United States); Henderson, C. B. [Department of Astronomy, Ohio State University, Columbus, OH 43210 (United States)
2012-03-01
We report the discovery and orbital solutions for two new OB binaries in the Cygnus OB2 Association, MT311 (B2V + B3V) and MT605 (B0.5V + B2.5:V). We also identify the system MT429 as a probable triple system consisting of a tight eclipsing 2.97 day B3V+B6V pair and a B0V at a projected separation of 138 AU. We further provide the first spectroscopic orbital solutions to the eclipsing, double-lined, O-star binary MT696 (O9.5V + B1:V), the double-lined, early B binary MT720 (B0-1V + B1-2V), and the double-lined, O-star binary MT771 (O7V + O9V). These systems exhibit orbital periods between 1.5 days and 12.3 days, with the majority having P <6 days. The two new binary discoveries and six spectroscopic solutions bring the total number of known massive binaries in the central region of the Cygnus OB2 Association to 20, with all but two having full orbital solutions.
Star formation history of Canis Major OB1. II. A bimodal X-ray population revealed by XMM-Newton
Santos-Silva, T.; Gregorio-Hetem, J.; Montmerle, T.; Fernandes, B.; Stelzer, B.
2018-02-01
Aims: The Canis Major OB1 Association has an intriguing scenario of star formation, especially in the region called Canis Major R1 (CMa R1) traditionally assigned to a reflection nebula, but in reality an ionized region. This work is focussed on the young stellar population associated with CMa R1, for which our previous results from ROSAT, optical, and near-infrared data had revealed two stellar groups with different ages, suggesting a possible mixing of populations originated from distinct star formation episodes. Methods: The X-ray data allow the detected sources to be characterized according to hardness ratios, light curves, and spectra. Estimates of mass and age were obtained from the 2MASS catalogue and used to define a complete subsample of stellar counterparts for statistical purposes. Results: A catalogue of 387 XMM-Newton sources is provided, of which 78% are confirmed as members or probable members of the CMa R1 association. Flares (or similar events) were observed for 13 sources and the spectra of 21 bright sources could be fitted by a thermal plasma model. Mean values of fits parameters were used to estimate X-ray luminosities. We found a minimum value of log(LX [erg/s] ) = 29.43, indicating that our sample of low-mass stars (M⋆ ≤ 0.5 M⊙), which are faint X-ray emitters, is incomplete. Among the 250 objects selected as our complete subsample (defining our "best sample"), 171 are found to the east of the cloud, near Z CMa and dense molecular gas, of which 50% of them are young (10 Myr). The opposite happens to the west, near GU CMa, in areas lacking molecular gas: among 79 objects, 30% are young and 50% are older. These findings confirm that a first episode of distributed star formation occurred in the whole studied region 10 Myr ago and dispersed the molecular gas, while a second, localized episode (<5 Myr) took place in the regions where molecular gas is still present.
Synthesis, surface properties and oil solubilisation capacity of cationic gemini surfactants
Dam, Th.; Engberts, J.B.F.N.; Karthäuser, J.; Karaborni, S.; Os, N.M. van
1996-01-01
The critical micelle concentration (CMC) and the surface tension at the CMC have been determined for the gemini surfactants alkanediyl-u,w-bis(dimethyla1kylammoniubmr omide) by means of dynamic surface tension measurements. For the same number of carbon atoms in the hydrophobic chain per hydrophilic
Binding behaviors of p-sulfonatocalix[4]arene with gemini guests.
Zhao, Hong-Xia; Guo, Dong-Sheng; Liu, Yu
2013-02-14
A dozen of homoditopic cations, possessing different spacer lengths and rigidities, as well as sizes, shapes, and charges of terminal groups, were synthesized as candidate gemini guests for the complexation of p-sulfonatocalix[4]arenes (SC4A). The 12 gemini guests are divided into five species according to the different terminal groups: imidazolium (G1-G3), pyridinium (G4-G6), quinolinium (G7), viologen (G8-G11), and 1,4-diazabicyclo[2.2.2]octane (DBO, G12). Their binding structures and stoichiometries with SC4A were examined by NMR spectroscopy, which is helpful to construct diverse highly ordered assemblies. The obtained results show that the length of the linkers, as well as the charge numbers on the end groups have a pronounced effect on the binding stoichiometry, whereas the size and shape of the terminal groups have no significant influence. Furthermore, both the stability constants and thermodynamic parameters of SC4A with the terminal subunits were determined by the isothermal titration calorimetry experiments, which are valuable to understand the binding behavior, giving quantitatively deep insight.
Thermal emissivity analysis of a GEMINI 8-meter telescopes design
St. Clair Dinger, Ann
1993-01-01
The GEMINI 8-meter Telescopes Project is designing twin 8-meter telescopes to be located in Hawaii and Chile. The GEMINI telescopes will have interchangeable secondary mirrors for use in the visible and IR. The APART/PADE program is being used to evaluate the effective IR emissivity of the IR configuration plus enclosure as a function of mirror contamination at three IR wavelengths. The goal is to design a telescope whose effective IR emissivity is no more than 2 percent when the mirrors are clean.
Tripathy, Divya Bajpai; Mishra, Anuradha
Gemini surfactants are presently gaining attention due to their unusual self-assembling characteristics and incomparable interfacial activity. Current research work involves the cost-effective microwave (MW) synthesis of waste soybean oil-based gemini imidazolinium surfactants (GIS) having a carbonate linkage in its spacer moiety. Structural characterizations of the materials have been done using FT-IR, 1H-NMR and 13C-NMR. Using indigenous and natural material as base and MW as energy source for synthesizing the GIS with easily degradable chemical moiety make them to be labeled as green surfactants.
NEAR INFRARED DIFFUSE INTERSTELLAR BANDS TOWARD THE CYGNUS OB2 ASSOCIATION
Energy Technology Data Exchange (ETDEWEB)
Hamano, Satoshi; Kondo, Sohei; Sameshima, Hiroaki; Nakanishi, Kenshi; Kawakita, Hideyo [Laboratory of Infrared High-resolution Spectroscopy, Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Kobayashi, Naoto [Institute of Astronomy, School of Science, University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Ikeda, Yuji [Photocoding, 460-102 Iwakura-Nakamachi, Sakyo-ku, Kyoto, 606-0025 (Japan); Yasui, Chikako; Mizumoto, Misaki; Matsunaga, Noriyuki; Fukue, Kei; Yamamoto, Ryo; Izumi, Natsuko [Department of Astronomy, Graduate School of Science, University of Tokyo, Bunkyo-ku, Tokyo 113-0033 (Japan); Mito, Hiroyuki [Kiso Observatory, Institute of Astronomy, School of Science, The University of Tokyo, 10762-30 Mitake, Kiso-machi, Kiso-gun, Nagano, 397-0101 (Japan); Nakaoka, Tetsuya; Kawanishi, Takafumi; Kitano, Ayaka; Otsubo, Shogo [Department of Physics, Faculty of Sciences, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Kinoshita, Masaomi, E-mail: hamano@cc.kyoto-su.ac.jp [Solar-Terrestrial Environment Laboratory, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi, 464-8601 (Japan)
2016-04-10
We obtained the near-infrared (NIR) high-resolution (R ≡ λ/Δλ ∼ 20,000) spectra of the seven brightest early-type stars in the Cygnus OB2 association for investigating the environmental dependence of diffuse interstellar bands (DIBs). The WINERED spectrograph mounted on the Araki 1.3 m telescope in Japan was used to collect data. All 20 of the known DIBs within the wavelength coverage of WINERED (0.91 < λ < 1.36 μm) were clearly detected along all lines of sight because of their high flux density in the NIR wavelength range and the large extinction. The equivalent widths (EWs) of DIBs were not correlated with the column densities of C{sub 2} molecules, which trace the patchy dense component, suggesting that the NIR DIB carriers are distributed mainly in the diffuse component. On the basis of the correlations among the NIR DIBs both for stars in Cyg OB2 and stars observed previously, λλ10780, 10792, 11797, 12623, and 13175 are found to constitute a “family,” in which the DIBs are correlated well over the wide EW range. In contrast, the EW of λ10504 is found to remain almost constant over the stars in Cyg OB2. The extinction estimated from the average EW of λ10504 (A{sub V} ∼ 3.6 mag) roughly corresponds to the lower limit of the extinction distribution of OB stars in Cyg OB2. This suggests that λ10504 is absorbed only by the foreground clouds, implying that the carrier of λ10504 is completely destroyed in Cyg OB2, probably by the strong UV radiation field. The different behaviors of the DIBs may be caused by different properties of the DIB carriers.
Anderson, Brian M; Jacobson, Lauren; Novakovic, Zachary M; Grasso, Patricia
2017-06-01
This study describes the localization of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3, synthetic peptide leptin mimetics, in the hypothalamus of Swiss Webster and C57BL/6J wild-type mice, leptin-deficient ob/ob mice, and leptin-resistant diet-induced obese (DIO) mice. The mice were given [D-Leu-4]-OB3 or MA-[D-Leu-4]-OB3 in 0.3% dodecyl maltoside by oral gavage. Once peak serum concentrations were reached, the mice received a lethal dose of pentobarbital and were subjected to intracardiac perfusion fixation. The brains were excised, post-fixed in paraformaldehyde, and cryo-protected in sucrose. Free-floating frozen coronal sections were cut at 25-µm and processed for imaging by immunofluorescence microscopy. In all four strains of mice, dense staining was concentrated in the area of the median eminence, at the base and/or along the inner wall of the third ventricle, and in the brain parenchyma at the level of the arcuate nucleus. These results indicate that [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 cross the blood-brain barrier and concentrate in an area of the hypothalamus known to regulate energy balance and glucose homeostasis. Most noteworthy is the localization of [D-Leu-4]-OB3 immunoreactivity within the hypothalamus of DIO mice via a conduit that is closed to leptin in this rodent model, and in most cases of human obesity. Together with our previous studies describing the effects of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on energy balance, glucose regulation, and signal transduction pathway activation, these findings are consistent with a central mechanism of action for these synthetic peptide leptin mimetics, and suggest their potential usefulness in the management of leptin-resistant obesity and type 2 diabetes in humans. Copyright © 2017 Elsevier B.V. All rights reserved.
Mizuno, Márcia Sanae; Crisma, Amanda Rabello; Borelli, Primavera; Castelucci, Patricia
2012-01-01
AIM: To examine whether the ob/ob mouse model of obesity is accompanied by enteric nervous system abnormalities such as altered motility. METHODS: The study examined the distribution of the P2X2 receptor (P2X2R) in myenteric neurons of female ob/ob mice. Specifically, we used immunohistochemistry to analyze the co-expression of the P2X2R with neuronal nitric oxide synthase (nNOS), choline acetyltransferase (ChAT), and calretinin (CalR) in neurons of the small intestine myenteric plexus in ob/ob and control female mice. In these sections, we used scanning confocal microscopy to analyze the co-localization of these markers as well as the neuronal density (cm2) and area profile (μm²) of P2X2R-positive neurons. In addition, enteric neurons were labeled using the nicotinamide adenine dinucleotide (NADH) diaphorase method and analyzed with light microscopy as an alternate means by which to analyze neuronal density and area. RESULTS: In the present study, we observed a 29.6% increase in the body weight of the ob/ob animals (OG) compared to the control group (CG). In addition, the average small intestine area was increased by approximately 29.6% in the OG compared to the CG. Immunoreactivity (IR) for the P2X2R, nNOS, ChAT and CalR was detectable in the myenteric plexus, as well as in the smooth muscle, in both groups. This IR appeared to be mainly cytoplasmic and was also associated with the cell membrane of the myenteric plexus neurons, where it outlined the neuronal cell bodies and their processes. P2X2R-IR was observed to co-localize 100% with that for nNOS, ChAT and CalR in neurons of both groups. In the ob/ob group, however, we observed that the neuronal density (neuron/cm2) of P2X2R-IR cells was increased by 62% compared to CG, while that of NOS-IR and ChAT-IR neurons was reduced by 49% and 57%, respectively, compared to control mice. The neuronal density of CalR-IR neurons was not different between the groups. Morphometric studies further demonstrated that the
Reverse time migration of multiples for OBS data
Zhang, Dongliang
2014-01-01
Reverse time migration of multiples (RTMM) is applied to OBS data with sparse receiver spacing. RTMM for OBS data unlike a marine streamer acquisition is implemented in the common receiver gathers (CRG) and provides a wider and denser illumination for each CRG than the conventional RTM of primaries. Hence, while the the conventional RTM image contains strong aliasing artifacts due to a sparser receiver interval, the RTMM image suffers from this artifacts less. This benefit of RTMM is demonstrated with numerical test on the Marmousi model for sparsely sampled OBS data.
Reverse time migration of multiples for OBS data
Zhang, Dongliang
2014-08-05
Reverse time migration of multiples (RTMM) is applied to OBS data with sparse receiver spacing. RTMM for OBS data unlike a marine streamer acquisition is implemented in the common receiver gathers (CRG) and provides a wider and denser illumination for each CRG than the conventional RTM of primaries. Hence, while the the conventional RTM image contains strong aliasing artifacts due to a sparser receiver interval, the RTMM image suffers from this artifacts less. This benefit of RTMM is demonstrated with numerical test on the Marmousi model for sparsely sampled OBS data.
Gemini surfactant for fluorescent and stable quantum dots in aqueous solution
Energy Technology Data Exchange (ETDEWEB)
Li Haibing [Key Laboratory of Pesticide and Chemical Biology (CCNU), Ministry of Education, College of Chemistry, Central China Normal University, Wuhan 430079 (China); Wang Xiaoqiong [Key Laboratory of Pesticide and Chemical Biology (CCNU), Ministry of Education, College of Chemistry, Central China Normal University, Wuhan 430079 (China); Gao Zhinong [Department of Chemistry, Wuhan University, Wuhan 430072 (China); He Zhike [Department of Chemistry, Wuhan University, Wuhan 430072 (China)
2007-05-23
Highly fluorescent and stable CdSe/ZnS core/shell quantum dots (QDs) coated with gemini surfactant are successfully synthesized in aqueous media. Analyses of luminescence spectrometry, ultraviolet-visible (UV-vis) spectrophotometry, and transmission electron micrographs (TEMs) indicate that the water-soluble QDs are monodisperse and have a luminescence enhancement compared with the original hydrophobic QDs. The water-soluble QDs coated with gemini surfactant are shown to be biocompatible, photostable, and have been proven to be suitable for live cell imaging.
Gemini surfactant for fluorescent and stable quantum dots in aqueous solution
International Nuclear Information System (INIS)
Li Haibing; Wang Xiaoqiong; Gao Zhinong; He Zhike
2007-01-01
Highly fluorescent and stable CdSe/ZnS core/shell quantum dots (QDs) coated with gemini surfactant are successfully synthesized in aqueous media. Analyses of luminescence spectrometry, ultraviolet-visible (UV-vis) spectrophotometry, and transmission electron micrographs (TEMs) indicate that the water-soluble QDs are monodisperse and have a luminescence enhancement compared with the original hydrophobic QDs. The water-soluble QDs coated with gemini surfactant are shown to be biocompatible, photostable, and have been proven to be suitable for live cell imaging
bHROS: A New High-Resolution Spectrograph Available on Gemini South
Margheim, S. J.; Gemini bHROS Team
2005-12-01
The Gemini bench-mounted High-Resolution Spectrograph (bHROS) is available for science programs beginning in 2006A. bHROS is the highest resolution (R=150,000) optical echelle spectrograph optimized for use on an 8-meter telescope. bHROS is fiber-fed via GMOS-S from the Gemini South focal plane and is available in both a dual-fiber Object/Sky mode and a single (larger) Object-only mode. Instrument characteristics and sample data taken during commissioning will be presented.
2MASS Identifications for Galactic OB Stars
Reed, B. Cameron
2007-01-01
Cross-identifications for 14,574 intrinsically luminous galactic stars (mostly OB stars) to objects in the 2MASS survey have been determined using a search box of +/-0.0015 degrees (+/- 5.4 arcsec) in both RA and Dec. Instructions on obtaining the relevant files can be obtained at othello.alma.edu/~reed/OB-2MASS.doc.
Vishvakarma, Vijay K; Kumari, Kamlesh; Patel, Rajan; Dixit, V S; Singh, Prashant; Mehrotra, Gopal K; Chandra, Ramesh; Chakrawarty, Anand Kumar
2015-05-15
Surfactants are used to prevent the irreversible aggregation of partially refolded proteins and they also assist in protein refolding. We have reported the design and screening of gemini surfactant to stabilize bovine serum albumin (BSA) with the help of computational tool (iGEMDOCK). A series of gemini surfactant has been designed based on bis-N-alkyl nicotinate dianion via varying the alkyl group and anion. On changing the alkyl group and anion of the surfactant, the value of Log P changes means polarity of surfactant can be tuned. Further, the virtual screening of the gemini surfactant has been carried out based on generic evolutionary method. Herein, thermodynamic data was studied to determine the potential of gemini surfactant as BSA stabilizer. Computational tools help to find out the efficient gemini surfactant to stabilize the BSA rather than to use the surfactant randomly and directionless for the stabilization. It can be confirmed through the experimental techniques. Previously, researcher synthesized one of the designed and used gemini surfactant to stabilize the BSA and their interactions were confirmed through various techniques and computational docking. But herein, the authors find the most competent gemini surfactant to stabilize BSA using computational tools on the basis of energy score. Different from the single chain surfactant, the gemini surfactants exhibit much stronger electrostatic and hydrophobic interactions with the protein and are thus effective at much lower concentrations. Based on the present study, it is expected that gemini surfactants may prove useful in the protein stabilization operations and may thus be effectively employed to circumvent the problem of misfolding and aggregation. Copyright © 2015 Elsevier B.V. All rights reserved.
The Gemini Planet Imager: From Science to Design to Construction
Energy Technology Data Exchange (ETDEWEB)
Macintosh, B; Graham, J R; Palmer, D; Doyon, R; Dunn, J; Gavel, D; Larkin, J; Oppenheimer, B; Saddlemyer, L; Sivaramakrishnan, A; Wallace, J K; Bauman, B; Erickson, D; Marois, C; Poyneer, L; Soummer, R
2008-07-01
The Gemini Planet Imager (GPI) is a facility instrument under construction for the 8-m Gemini South telescope. It combines a 1500 subaperture AO system using a MEMS deformable mirror, an apodized-pupil Lyot coronagraph, a high-accuracy IR interferometer calibration system, and a near-infrared integral field spectrograph to allow detection and characterization of self-luminous extrasolar planets at planet/star contrast ratios of 10{sup -7}. I will discuss the evolution from science requirements through modeling to the final detailed design, provide an overview of the subsystems and show models of the instrument's predicted performance.
2010-03-26
... SMALL BUSINESS ADMINISTRATION [License No. 01/01-0410] Gemini Investors IV, L.P., Notice Seeking... given that Gemini Investors IV, L.P., 20 William Street, Wellesley, MA 02481, a Federal Licensee under... Regulations (13 CFR 107.730). Gemini Investors IV, L.P. proposes to provide equity and debt financing to...
Directory of Open Access Journals (Sweden)
Jun-Xian Song
2017-08-01
Full Text Available Background: The effects of capsaicin on obesity and glucose homeostasis are still controversial and the mechanisms underlying these effects remain largely unknown. This study aimed to investigate the potential relationship between the regulation of obesity and glucose homeostasis by dietary capsaicin and the alterations of gut microbiota in obese diabetic ob/ob mice.Methods: The ob/ob mice were subjected to a normal, low-capsaicin (0.01%, or high-capsaicin (0.02% diet for 6 weeks, respectively. Obesity phenotypes, glucose homeostasis, the gut microbiota structure and composition, short-chain fatty acids, gastrointestinal hormones, and pro-inflammatory cytokines were measured.Results: Both the low- and high-capsaicin diets failed to prevent the increase in body weight, adiposity index, and Lee's obesity index. However, dietary capsaicin at both the low and high doses significantly inhibited the increase of fasting blood glucose and insulin levels. These inhibitory effects were comparable between the two groups. Similarly, dietary capsaicin resulted in remarkable improvement in glucose and insulin tolerance. In addition, neither the low- nor high-capsaicin diet could alter the α-diversity and β-diversity of the gut microbiota. Taxonomy-based analysis showed that both the low- and high-capsaicin diets, acting in similar ways, significantly increased the Firmicutes/Bacteroidetes ratio at the phylum level as well as increased the Roseburia abundance and decreased the Bacteroides and Parabacteroides abundances at the genus level. Spearman's correlation analysis revealed that the Roseburia abundance was negatively while the Bacteroides and Parabacteroides abundances were positively correlated to the fasting blood glucose level and area under the curve by the oral glucose tolerance test. Finally, the low- and high-capsaicin diets significantly increased the fecal butyrate and plasma total GLP-1 levels, but decreased plasma total ghrelin, TNF-α, IL-1
The OB run-away stars from Sco-Cen and Orion reviewed
International Nuclear Information System (INIS)
Blaauw, A.
1989-01-01
The author studies the past paths of the run-away star Zeta Oph from the OB association Sco-Cen, and of the run-away stars AE Aur, Mu Col and 53 Ari from the OB association Ori OB1, in connection with the question of the origin of these high velocities. Should the binary-hypothesis be adhered to (supernova explosion of one of the components) or, perhaps, dynamical evolution in young, dense clusters offer a clue to this phenomenon? It is shown that the latter hypothesis is very unlikely to apply to Zeta Oph. For the run-away stars from Orion conclusive evidence may well be obtained in the course of the next decade, from improved accuracy of the proper motions
Obs4MIPS: Satellite Observations for Model Evaluation
Ferraro, R.; Waliser, D. E.; Gleckler, P. J.
2017-12-01
This poster will review the current status of the obs4MIPs project, whose purpose is to provide a limited collection of well-established and documented datasets for comparison with Earth system models (https://www.earthsystemcog.org/projects/obs4mips/). These datasets have been reformatted to correspond with the CMIP5 model output requirements, and include technical documentation specifically targeted for their use in model output evaluation. The project holdings now exceed 120 datasets with observations that directly correspond to CMIP5 model output variables, with new additions in response to the CMIP6 experiments. With the growth in climate model output data volume, it is increasing more difficult to bring the model output and the observations together to do evaluations. The positioning of the obs4MIPs datasets within the Earth System Grid Federation (ESGF) allows for the use of currently available and planned online tools within the ESGF to perform analysis using model output and observational datasets without necessarily downloading everything to a local workstation. This past year, obs4MIPs has updated its submission guidelines to closely align with changes in the CMIP6 experiments, and is implementing additional indicators and ancillary data to allow users to more easily determine the efficacy of an obs4MIPs dataset for specific evaluation purposes. This poster will present the new guidelines and indicators, and update the list of current obs4MIPs holdings and their connection to the ESGF evaluation and analysis tools currently available, and being developed for the CMIP6 experiments.
Mining the Obscured OB Star Population in Carina
Smith, Michael
2016-04-01
Massive OB stars are very influential objects in the ecology of galaxies like our own. Current catalogues of Galactic OB stars are heavily biased towards bright (g selected OB stars across the entire Southern Galactic plane, both within clusters and in the field, down to ∼20th magnitude in g. For the first time, a complete accounting of the OB star runaway phenomenon becomes possible. Along with making the primary selection using VPHAS+ colours, I have performed Markov-Chain Monte Carlo fitting of the spectral energy distributions of the selected stars by combining VPHAS+ u, g, r, i with published J, H, K photometry. This gives rough constraints on effective temperature and distance, whilst delivering much more precise reddening parameters A0 and RV - allowing us to build a much richer picture of how extinction and extinction laws vary across the Galactic Plane. My thesis begins with a description of the method of photometric selection of OB star candidates and its validation across a 2 square degree field including the well-known young massive star cluster Westerlund 2 (Mohr-Smith et al., 2015). Following on from this I present spectroscopy with AAOmega of 283 candidates identified by our method, which confirms that ∼94% of the sample are the expected O and early B stars. I then develop this method further and apply it to a Galactic Plane strip of 42 square-degrees that runs from the Carina Arm tangent region to the much studied massive cluster in NGC 3603. A new aspect I attend to in this expansion of method is tightening up the uniform photometric calibration of the data, paying particular attention to the always-challenging u band. This leads to a new and reliable catalogue of 5915 OB stars. As well as increasing the numbers of identified massive stars in this large region of the sky by nearly an order of magnitude, a more complete picture of massive star formation in the Carina Arm has emerged. I have found a broad over-density of O stars around the highly
Pazos, Antonio; Davila, Jose Martin; Buforn, Elisa; Bezzeghoud, Mourad; Harnafi, Mimoun; Mattesini, Mauricio; Caldeira, Bento; Hanka, Winfried; El Moudnib, Lahcen; Strollo, Angelo; Roca, Antoni; Lopez de Mesa, Mireya; Dahm, Torsten; Cabieces, Roberto
2016-04-01
The Western Mediterranean (WM) seismic network started in 1996 as an initiative of the Royal Spanish Navy Observatory (ROA) and the Universidad Complutense de Madrid (UCM), with the collaboration of the GeoForschungsZentrum (GFZ) of Potsdam. A first broad band seismic station (SFUC) was installed close to Cádiz (South Spain). Since then, additional stations have been installed in the Ibero-Moghrebian region. In 2005, the "WM" code was assigned by the FDSN and new partners were jointed: Evora University (UEVO, Portugal), the Scientifique Institute of Rabat (ISRABAT, Morocco), and GFZ. Now days, the WM network is composed by 15 BB stations, all of them with Streckaisen STS-2 or STS-2.5 sensors, Quanterra or Earthdata digitizers and SeiscomP. Most them have co-installed a permanent geodetic GPS stations, and some them also have an accelerometer. There are 10 stations deployed in Spanish territory (5 in the Iberian peninsula, 1 in Balearic islands and 4 in North Africa Spanish places) with VSAT or Internet communications, 2 in Portugal (one of them without real time), and 3 in Morocco (2 VSAT and 1 ADSL). Additionally, 2 more stations (one in South Spain and one in Morocco) will be installed along this year. Additionally ROA has deployed a permanent real time VBB (CMG-3T: 360s) station at the Alboran Island. Due to the fact that part of the seismic activity is located at marine areas, and also because of the poor geographic azimuthal coverage at some zones provided by the land stations (specially in the SW of the San Vicente Cape area), ROA and UCM have acquired six broad band "LOBSTERN" OBS, manufactured by KUM (Kiel, Germany), conforming the OBS FOMAR pool. Three of them with CMG-40T sensor and the other with Trillium 120. These OBS were deployed along the Gibraltar strait since January to November 2014 to study the microseismicity in the Gibraltar strait area. In September 2015 FOMAR network has been deployed in SW of the San Vicente Cape for 8 months as a part of
The Gemini NICI planet-finding campaign: The companion detection pipeline
Energy Technology Data Exchange (ETDEWEB)
Wahhaj, Zahed [European Southern Observatory, Alonso de Cordova 3107, Vitacura, Casilla 19001, Santiago (Chile); Liu, Michael C.; Nielsen, Eric L.; Chun, Mark; Ftaclas, Christ [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Biller, Beth A. [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Close, Laird M. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Hayward, Thomas L.; Hartung, Markus [Gemini Observatory, Southern Operations Center, c/o AURA, Casilla 603, La Serena (Chile); Toomey, Douglas W. [Mauna Kea Infrared, LLC, 21 Pookela St., Hilo, HI 96720 (United States)
2013-12-10
We present high-contrast image processing techniques used by the Gemini NICI Planet-Finding Campaign to detect faint companions to bright stars. The Near-Infrared Coronographic Imager (NICI) is an adaptive optics instrument installed on the 8 m Gemini South telescope, capable of angular and spectral difference imaging and specifically designed to image exoplanets. The Campaign data pipeline achieves median contrasts of 12.6 mag at 0.''5 and 14.4 mag at 1'' separation, for a sample of 45 stars (V = 4.3-13.9 mag) from the early phase of the campaign. We also present a novel approach to calculating contrast curves for companion detection based on 95% completeness in the recovery of artificial companions injected into the raw data, while accounting for the false-positive rate. We use this technique to select the image processing algorithms that are more successful at recovering faint simulated point sources. We compare our pipeline to the performance of the Locally Optimized Combination of Images (LOCI) algorithm for NICI data and do not find significant improvement with LOCI.
Characterizing Dusty Debris Disks with the Gemini Planet Imager
Chen, Christine; Arriaga, Pauline; Bruzzone, Sebastian; Choquet, Elodie; Debes, John H.; Donaldson, Jessica; Draper, Zachary; Duchene, Gaspard; Esposito, Thomas; Fitzgerald, Michael P.; Golimowski, David A.; Hines, Dean C.; Hinkley, Sasha; Hughes, A. Meredith; Kalas, Paul; Kolokolova, Ludmilla; Lawler, Samantha; Matthews, Brenda C.; Mazoyer, Johan; Metchev, Stanimir A.; Millar-Blanchaer, Max; Moro-Martin, Amaya; Nesvold, Erika; Padgett, Deborah; Patience, Jenny; Perrin, Marshall D.; Pueyo, Laurent; Rantakyro, Fredrik; Rodigas, Timothy; Schneider, Glenn; Soummer, Remi; Song, Inseok; Stark, Chris; Weinberger, Alycia J.; Wilner, David J.
2017-01-01
We have been awarded 87 hours of Gemini Observatory time to obtain multi-wavelength observations of HST resolved debris disks using the Gemini Planet Imager. We have executed ~51 hours of telescope time during the 2015B-2016B semesters observing 12 nearby, young debris disks. We have been using the GPI Spec and Pol modes to better constrain the properties of the circumstellar dust, specifically, measuring the near-infrared total intensity and polarization fraction colors, and searching for solid-state spectral features of nearby beta Pic-like disks. We expect that our observations will allow us to break the degeneracy among the particle properties such as composition, size, porosity, and shape. We present some early results from our observations.
International Nuclear Information System (INIS)
Sekiya, Motohiro; Yahagi, Naoya; Tamura, Yoshiaki; Okazaki, Hiroaki; Igarashi, Masaki; Ohta, Keisuke; Takanashi, Mikio; Kumagai, Masayoshi; Takase, Satoru; Nishi, Makiko; Takeuchi, Yoshinori; Izumida, Yoshihiko; Kubota, Midori; Ohashi, Ken; Iizuka, Yoko; Yagyu, Hiroaki; Gotoda, Takanari; Nagai, Ryozo; Shimano, Hitoshi; Yamada, Nobuhiro
2009-01-01
It has long been a matter of debate whether the hormone-sensitive lipase (HSL)-mediated lipolysis in pancreatic β-cells can affect insulin secretion through the alteration of lipotoxicity. We generated mice lacking both leptin and HSL (Lep ob/ob /HSL -/- ) and explored the role of HSL in pancreatic β-cells in the setting of obesity. Lep ob/ob /HSL -/- developed elevated blood glucose levels and reduced plasma insulin levels compared with Lep ob/ob /HSL +/+ in a fed state, while the deficiency of HSL did not affect glucose homeostasis in Lep +/+ background. The deficiency of HSL exacerbated the accumulation of triglycerides in Lep ob/ob islets, leading to reduced glucose-stimulated insulin secretion. The deficiency of HSL also diminished the islet mass in Lep ob/ob mice due to decreased cell proliferation. In conclusion, HSL affects insulin secretary capacity especially in the setting of obesity.
The opto-mechanical design for GMOX: a next-generation instrument concept for Gemini
Smee, Stephen A.; Barkhouser, Robert; Robberto, Massimo; Ninkov, Zoran; Gennaro, Mario; Heckman, Timothy M.
2016-08-01
We present the opto-mechanical design of GMOX, the Gemini Multi-Object eXtra-wide-band spectrograph, a potential next-generation (Gen-4 #3) facility-class instrument for Gemini. GMOX is a wide-band, multi-object, spectrograph with spectral coverage spanning 350 nm to 2.4 um with a nominal resolving power of R 5000. Through the use of Digital Micromirror Device (DMD) technology, GMOX will be able to acquire spectra from hundreds of sources simultaneously, offering unparalleled flexibility in target selection. Utilizing this technology, GMOX can rapidly adapt individual slits to either seeing-limited or diffraction-limited conditions. The optical design splits the bandpass into three arms, blue, red, and near infrared, with the near-infrared arm being split into three channels covering the Y+J band, H band, and K band. A slit viewing camera in each arm provides imaging capability for target acquisition and fast-feedback for adaptive optics control with either ALTAIR (Gemini North) or GeMS (Gemini South). Mounted at the Cassegrain focus, GMOX is a large (1.3 m x 2.8 m x 2.0 m) complex instrument, with six dichroics, three DMDs (one per arm), five science cameras, and three acquisition cameras. Roughly half of these optics, including one DMD, operate at cryogenic temperature. To maximize stiffness and simplify assembly and alignment, the opto-mechanics are divided into three main sub-assemblies, including a near-infrared cryostat, each having sub-benches to facilitate ease of alignment and testing of the optics. In this paper we present the conceptual opto-mechanical design of GMOX, with an emphasis on the mounting strategy for the optics and the thermal design details related to the near-infrared cryostat.
Suárez, Genaro; Downes, Juan José; Román-Zúñiga, Carlos; Covey, Kevin R.; Tapia, Mauricio; Hernández, Jesús; Petr-Gotzens, Monika G.; Stassun, Keivan G.; Briceño, César
2017-07-01
The Orion OB1a sub-association is a rich low-mass star (LMS) region. Previous spectroscopic studies have confirmed 160 LMSs in the 25 Orionis stellar group (25 Ori), which is the most prominent overdensity of Orion OB1a. Nonetheless, the current census of the 25 Ori members is estimated to be lower than 50% complete, leaving a large number of members to be still confirmed. We retrieved 172 low-resolution stellar spectra in Orion OB1a observed as ancillary science in the SDSS-III/BOSS survey, for which we classified their spectral types and determined physical parameters. To determine memberships, we analyzed the {{{H}}}α emission, Li I λ6708 absorption, and Na I λλ8183, 8195 absorption as youth indicators in stars classified as M type. We report 50 new LMSs spread across the 25 Orionis, ASCC 18, and ASCC 20 stellar groups with spectral types from M0 to M6, corresponding to a mass range of 0.10≤slant m/{M}⊙ ≤slant 0.58. This represents an increase of 50% in the number of known LMSs in the area and a net increase of 20% in the number of 25 Ori members in this mass range. Using parallax values from the Gaia DR1 catalog, we estimated the distances to these three stellar groups and found that they are all co-distant, at 338 ± 66 pc. We analyzed the spectral energy distributions of these LMSs and classified their disks into evolutionary classes. Using H-R diagrams, we found a suggestion that 25 Ori could be slightly older than the other two observed groups in Orion OB1a.
Shaban, Samy M; Abd-Elaal, Ali A
2017-07-01
Three novels amide Gemini cationic surfactants with various alkyl chains and their silver nanohybrid with silver nanoparticles were synthesized and a confirmation study for surfactant and their nanoparticles formation has been established using IR, 1 HNMR, TEM and UV-Vis spectroscopy. The surface-active properties of these surfactants and their nanoform were investigated through surface tension and electrical conductivity measurements and a comparative study has been established. The thermodynamic parameters of micellization and adsorption were assessed at temperatures range from 25 to 65°C. The effect of silver particles on the surface behavior of the synthesized surfactant has been discussed. The aggregation behavior of silver nanoparticles with these synthesized Gemini surfactants in water were investigated using dynamic light scattering and transmission electron microscopy. Furthermore, the antimicrobial activities of these synthesized amide Gemini surfactants and their nanostructure with silver against both Gram positive and Gram negative bacteria were also investigated. Copyright © 2017 Elsevier B.V. All rights reserved.
The performance study of oxide by-passed(OB) lateral double diffused MOSFET
Tang, Pan-pan
2016-10-01
An SOI LDMOS device structure with Oxide By-passed(OB) was investigated and its breakdown mechanism and characteristic of structure was analyzed. Its performance was verified by 3D numerical simulation with SILVACO TCAD software. The simulated results show that the electrical field element of the device is modulated by the concept of similar Superjunction(SJ) structure. Compared with the SJ LDMOS device, OB LDMOS obtains the same breakdown voltage, simultaneously the specific on-resistance of the OB LDMOS reduces from 3.81mΩ·cm2 to 1.96mΩ·cm2, except for achieving comparable performance and overcoming the high aspect ratio of fabrication structure and the difficulty of accurate concentration match of SJ LDMOS.
Radionuclides in the Ob/Irtysh river system and their contribution to pollution of the Arctic
International Nuclear Information System (INIS)
Trapeznikov, A.; Pozolotina, V.; Trapeznikova, V.; Yushkov, P.; Polikarpov, G.; Aarkrog, A.; Nielsen, S.P.
1995-01-01
The aims of this study were: 1) to continue the investigation of distribution of radionuclides in the principal components of the Techa river, and 2) to get the first estimate of the contamination of sediments of the Iset, Tobol, Irtysh and Ob rivers. The samples from the Irtysh river were collected in 1993 nine km in front of confluence of the Irtysh with the Ob river. The mean Cs-137 concentration in the sediments did not show any clear trend. The sediments from the Ob river were collected in 1992 near Labitnangi, situated about 300 km from the outlet of the Ob into the Kara Sea. In 1994 samples were collected five km in front of and five km after confluence with the Irtysh river. All results are summarized in a table. It appears that the Cs-137 levels in the Ob sediments, before and after confluence with Irtysh, do not change significantly. It is difficult to see any systematic changes in Cs-137 concentrations with depth. In some cases the top five cm show higher concentrations than the deeper layers. 7 refs., 1 tab
Photoionization of the diffuse interstellar medium and galactic halo by OB associtations
Dove, James B.; Shull, J. Michael
1994-01-01
Assuming smoothly varying H I distributions in te Galactic disk, we have calculated the geometry of diffuse II regions due to OB associations in the Galactic plane. Near the solar circle, OB associations with a Lyman continuum (Lyc) photon luminosity Psi(sub Lyc) = 3.3 x 10(exp 7) cm(exp -2) s(exp -1), produce H II regions that are density bounded in the vertical direction (H II chimneys) allowing Lyc to escape the gaseous disk and penetrate into the Galactic halo. We provide analytic formulae for the Lyc escape fraction as functions of S(sub 0) O-star catalog of Garmany and a new Lyc stellar stellar Lyc stellar flux calibration, we find a production rate of Lyc photons by OB associations within 2.5 kpc of Psi(sub Lyc) = 3.3 x 10(exp 7) cm(exp -2) s(exp -1). Integrating the fraction of Lyc photons that escape the disk over our adopted luminosity function of OB associations, we estimate that approximately 7% of the ionizing photons, or Phi(sub Lyc) = 2.3 x 10(exp 6) cm(exp -2) s(exp -1), escape each side of the H I disk layer and penetrate the diffuse ionized medium ('Reynolds layer'). This flux is sufficient to explain the potoionization of this, although we have not constructed a model for the observed H-alpha emission and pulsar dispersion measures that is fully consistent with the absorption rate of Lyc in the H II layer. Since our quiescent model does not account for the effects of dynamic chimneys and superbubbles, which should enhance Lyc escape, we conclude the O stars are the probable source of ionizing radiation for the Reynolds layer. For a random distribution of OB associations throughout the disk, the Lyc flux is nearly uniform for heights Z is greater than approximately 0.8 kpc above the midplane.
Mantha, Sriteja; McDaniel, Jesse G; Perroni, Dominic V; Mahanthappa, Mahesh K; Yethiraj, Arun
2017-01-26
Gemini surfactants comprise two single-tailed surfactants connected by a linker at or near the hydrophilic headgroup. They display a variety of water-concentration-dependent lyotropic liquid crystal morphologies that are sensitive to surfactant molecular structure and the nature of the headgroups and counterions. Recently, an interesting dependence of the aqueous-phase behavior on the length of the linker has been discovered; odd-numbered linker length surfactants exhibit characteristically different phase diagrams than even-numbered linker surfactants. In this work, we investigate this "odd/even effect" using computer simulations, focusing on experimentally studied gemini dicarboxylates with Na + counterions, seven nonterminal carbon atoms in the tails, and either three, four, five, or six carbon atoms in the linker (denoted Na-73, Na-74, Na-75, and Na-76, respectively). We find that the relative electrostatic repulsion between headgroups in the different morphologies is correlated with the qualitative features of the experimental phase diagrams, predicting destabilization of hexagonal phases as the cylinders pack close together at low water content. Significant differences in the relative headgroup orientations of Na-74 and Na-76 compared to those of Na-73 and Na-75 surfactants lead to differences in linker-linker packing and long-range headgroup-headgroup electrostatic repulsion, which affects the delicate electrostatic balance between the hexagonal and gyroid phases. Much of the fundamental insight presented in this work is enabled by the ability to computationally construct and analyze metastable phases that are not observable in experiments.
Energy Technology Data Exchange (ETDEWEB)
Mobin, Mohammad, E-mail: drmmobin@hotmail.com; Aslam, Ruby; Aslam, Jeenat
2017-04-15
Two biodegradable, non toxic cationic gemini surfactants having ester linkage in the spacer namely, C{sub m}H{sub 2m+1}(CH{sub 3}){sub 2}N{sup +}(CH{sub 2}COOCH{sub 2}){sub 2}N{sup +}(CH{sub 3}){sub 2}C{sub m}H{sub 2m+1}.2Cl{sup -} (m-E2-m, m = 12, 14), were synthesized and characterized using elemental analysis, FT-IR and {sup 1}H-NMR. The corrosion inhibition performance of synthesized compounds separately and in combination with sodium salicylate (SS), along with the nature and stability of inhibitive film, for mild steel (MS) in 1 M HCl solution at 30–60 °C was evaluated using weight loss, potentiodynamic polarization, EIS, UV–visible spectroscopy, FTIR, SEM/EDAX, TGA and quantum chemical calculations. Results of the studies confirm m-E2-m as effective corrosion inhibitor for MS in HCl; the inhibition effect being synergistically strengthened in presence of SS. The synthesized compounds act as mixed type inhibitor and adsorb on MS surface in accordance with Langmuir adsorption isotherm. Experimentally measured inhibition efficiencies are correlated with the molecular parameters obtained using PM6 semi-empirical method. Empirical results are in good agreement with the theoretical predictions. - Graphical abstract: (a) Optimized geometry of studied inhibitors by PM6 method with (b) HOMO and (c) LUMO orbital occupation. - Highlights: • Environment friendly gemini surfactants were studied as corrosion inhibitor for MS. • Studied compounds act as good inhibitor for MS corrosion in 1 M HCl at 30–60 °C. • η of inhibitors is synergistically increased in presence of sodium salicylate. • The synthesized cationic gemini surfactants act as mixed-type inhibitor. • Experimentally obtained results are in good agreement with theoretical results.
Effect of Gemini-type surfactant on methane hydrate formation
Energy Technology Data Exchange (ETDEWEB)
Jeong, K.E.; Park, J.M.; Kim, C.U.; Chae, H.J.; Jeong, S.Y. [Korea Research Inst. of Chemical Technology, Jang-Dong, Yuseong-Gu, Daejeon (Korea, Republic of)
2008-07-01
Natural gas hydrates are formed from water and natural gas molecules at particular temperatures and pressures that become ice-like inclusion compounds. Gas hydrates offer several benefits such as energy resource potential and high storage capacity of natural gas in the form of hydrates. However, the application of natural gas hydrates has been deterred by its low formation rate and low conversion ratio of water into hydrate resulting in low actual storage capacity. This paper presented an experimental study to determine the effect of adding a novel Gemini-type surfactant on methane hydrate formation. The experimental study was described with reference to the properties of prepared diols and properties of prepared disulfonates. Gemini surfactant is the family of surfactant molecules possessing more than one hydrophobic tail and hydrophilic head group. They generally have better surface-active properties than conventional surfactants of equal chain length. The paper presented the results of the study in terms of the reactions of diols with propane sultone; storage capacity of hydrate formed with and without surfactant; and methane hydrate formation with and without disulfonate. It was concluded that the methane hydrate formation was accelerated by the addition of novel anionic Gemini-type surfactants and that hydrate formation was influenced by the surfactant concentration and alkyl chain length. For a given concentration, the surfactant with the highest chain length demonstrated the highest formation rate and storage capacity. 5 refs., 3 tabs., 4 figs.
Statistical analysis of coding for molecular properties in the olfactory bulb
Directory of Open Access Journals (Sweden)
Benjamin eAuffarth
2011-07-01
Full Text Available The relationship between molecular properties of odorants and neural activities is arguably one of the most important issues in olfaction and the rules governing this relationship are still not clear. In the olfactory bulb (OB, glomeruli relay olfactory information to second-order neurons which in turn project to cortical areas. We investigate relevance of odorant properties, spatial localization of glomerular coding sites, and size of coding zones in a dataset of 2-deoxyglucose images of glomeruli over the entire OB of the rat. We relate molecular properties to activation of glomeruli in the OB using a nonparametric statistical test and a support-vector machine classification study. Our method permits to systematically map the topographic representation of various classes of odorants in the OB. Our results suggest many localized coding sites for particular molecular properties and some molecular properties that could form the basis for a spatial map of olfactory information. We found that alkynes, alkanes, alkenes, and amines affect activation maps very strongly as compared to other properties and that amines, sulfur-containing compounds, and alkynes have small zones and high relevance to activation changes, while aromatics, alkanes, and carboxylics acid recruit very big zones in the dataset. Results suggest a local spatial encoding for molecular properties.
Observations Of The LCROSS Impact With NIFS On The Gemini North Telescope
Roth, Katherine; Stephens, A. W.; Trujillo, C. A.; McDermid, R. M.; Woodward, C. E.; Walls, B. D.; Coulson, D. M.; Matulonis, A. C.; Ball, J. G.; Wooden, D. H.
2010-01-01
The Lunar CRater Observation and Sensing Satellite (LCROSS) Centaur rocket impacted a permanently shadowed crater near the south pole of the Moon at 11:31 UTC 2009 October 09. Gemini, one of several telescopes in a coordinated network observing the impact, conducted observations using NIFS to obtain 3D K-band imaging spectroscopy to detect water ice in the ejected plume of material. The spectral slope of the NIFS data can constrain the grain size and height distribution as the plume evolves, measuring the total mass and the water ice concentration in the plume. These observations provided an engineering challenge for Gemini, including the need to track non-sidereal with constantly changing track rates and guide on small bright moon craters, in order to keep the impact site within the NIFS field-of-view. High quality images taken by GMOS-N, NIRI and the acquisition camera during engineering periods at specific lunar libration and illumination were also used by the LCROSS ground based observing team to supplement slit positioning and offset plans for other ground based observatories. LCROSS mission support and engineering has resulted in improved telescope functionality for non-sidereal targets, including the ability to upload and import target ephemerides directly into the TCS, starting in semester 2010B. In this poster we present the engineering results and observing improvements which will facilitate enhanced user capabilities of the Gemini telescopes arising from the intensive LCROSS support challenge. Gemini Observatory is operated by AURA, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the NSF (United States), the STFC (United Kingdom), the NRC (Canada), CONICYT (Chile), the ARC (Australia), Ministério da Ciência e Tecnologia (Brazil), and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina). In part this research was supported by NASA through contracts to SWRI and NSF grant AST-0706980 to the U
Search for OB stars running away from young star clusters. I. NGC 6611
Gvaramadze, V. V.; Bomans, D. J.
2008-11-01
N-body simulations have shown that the dynamical decay of the young (~1 Myr) Orion Nebula cluster could be responsible for the loss of at least half of its initial content of OB stars. This result suggests that other young stellar systems could also lose a significant fraction of their massive stars at the very beginning of their evolution. To confirm this expectation, we used the Mid-Infrared Galactic Plane Survey (completed by the Midcourse Space Experiment satellite) to search for bow shocks around a number of young (⪉several Myr) clusters and OB associations. We discovered dozens of bow shocks generated by OB stars running away from these stellar systems, supporting the idea of significant dynamical loss of OB stars. In this paper, we report the discovery of three bow shocks produced by O-type stars ejected from the open cluster NGC 6611 (M16). One of the bow shocks is associated with the O9.5Iab star HD165319, which was suggested to be one of “the best examples for isolated Galactic high-mass star formation” (de Wit et al. 2005, A&A, 437, 247). Possible implications of our results for the origin of field OB stars are discussed.
A CATALOG OF NEW SPECTROSCOPICALLY CONFIRMED MASSIVE OB STARS IN CARINA
Energy Technology Data Exchange (ETDEWEB)
Alexander, Michael J.; Hanes, Richard J.; McSwain, M. Virginia [Department of Physics, Lehigh University, 16 Memorial Drive East, Bethlehem, PA 18015 (United States); Povich, Matthew S., E-mail: alexamic@lafayette.edu, E-mail: rjh314@lehigh.edu, E-mail: mcswain@lehigh.edu, E-mail: mspovich@cpp.edu [Department of Physics and Astronomy, California State Polytechnic University, Pomona, CA 91768 (United States)
2016-12-01
The Carina star-forming region is one of the largest in the Galaxy, and its massive star population is still being unveiled. The large number of stars combined with high, and highly variable, interstellar extinction makes it inherently difficult to find OB stars in this type of young region. We present the results of a spectroscopic campaign to study the massive star population of the Carina Nebula, with the primary goal to confirm or reject previously identified Carina OB star candidates. A total of 141 known O- and B-type stars and 94 candidates were observed, of which 73 candidates had high enough signal-to-noise ratio to classify. We find 23 new OB stars within the Carina Nebula, a 32% confirmation rate. One of the new OB stars has blended spectra and is suspected to be a double-lined spectroscopic binary (SB2). We also reclassify the spectral types of the known OB stars and discover nine new SB2s among this population. Finally, we discuss the spatial distribution of these new OB stars relative to known structures in the Carina Nebula.
A Gemini snapshot survey for double degenerates
Kilic, Mukremin; Brown, Warren R.; Gianninas, A.; Curd, Brandon; Bell, Keaton J.; Allende Prieto, Carlos
2017-11-01
We present the results from a Gemini snapshot radial-velocity survey of 44 low-mass white-dwarf candidates selected from the Sloan Digital Sky Survey (SDSS) spectroscopy. To find sub-hour orbital period binary systems, our time-series spectroscopy had cadences of 2-8 min over a period of 20-30 min. Through follow-up observations at Gemini and the MMT, we identify four double-degenerate binary systems with periods ranging from 53 min to 7 h. The shortest period system, SDSS J123549.88+154319.3, was recently identified as a sub-hour period detached binary by Breedt and collaborators. Here, we refine the orbital and physical parameters of this system. High-speed and time-domain survey photometry observations do not reveal eclipses or other photometric effects in any of our targets. We compare the period distribution of these four systems with the orbital period distribution of known double white dwarfs; the median period decreases from 0.64 to 0.24 d for M = 0.3-0.5 M⊙ to M < 0.3 M⊙ white dwarfs. However, we do not find a statistically significant correlation between the orbital period and white-dwarf mass.
Jørgensen, Inger; Chiboucas, Kristin; Hibon, Pascale; Nielsen, Louise D.; Takamiya, Marianne
2018-04-01
The Gemini/HST Galaxy Cluster Project (GCP) covers 14 z = 0.2–1.0 clusters with X-ray luminosity of {L}500≥slant {10}44 {erg} {{{s}}}-1 in the 0.1–2.4 keV band. In this paper, we provide homogeneously calibrated X-ray luminosities, masses, and radii, and we present the complete catalog of the ground-based photometry for the GCP clusters. The clusters were observed with either Gemini North or South in three or four of the optical passbands g‧, r‧, i‧, and z‧. The photometric catalog includes consistently calibrated total magnitudes, colors, and geometrical parameters. The photometry reaches ≈25 mag in the passband closest to the rest-frame B band. We summarize comparisons of our photometry with data from the Sloan Digital Sky Survey. We describe the sample selection for our spectroscopic observations, and establish the calibrations to obtain rest-frame magnitudes and colors. Finally, we derive the color–magnitude relations for the clusters, and briefly discuss these in the context of evolution with redshift. Consistent with our results based on spectroscopic data, the color–magnitude relations support passive evolution of the red sequence galaxies. The absence of change in the slope with redshift constrains the allowable age variation along the red sequence to <0.05 dex between the brightest cluster galaxies and those four magnitudes fainter. This paper serves as the main reference for the GCP cluster and galaxy selection, X-ray data, and ground-based photometry.
Cationic gemini surfactant-assisted synthesis of hollow Au nanostructures by stepwise reductions.
Wang, Wentao; Han, Yuchun; Tian, Maozhang; Fan, Yaxun; Tang, Yongqiang; Gao, Mingyuan; Wang, Yilin
2013-06-26
A novel synthetic approach was developed for creating versatile hollow Au nanostructures by stepwise reductions of Au(III) upon the use of cationic gemini surfactant hexamethylene-1,6-bis(dodecyl dimethylammonium bromide) (C12C6C12Br2) as a template agent. It was observed that the Au(I) ions obtained from the reduction of Au(III) by ascorbic acid can assist the gemini surfactant to form vesicles, capsule-like, and tube-like aggregates that subsequently act as soft templates for hollow Au nanostructures upon further reduction of Au(I) to Au(0) by NaBH4. It was demonstrated that the combination of C12C6C12Br2 and Au(I) plays a key role in regulating the structure of the hollow precursors not only because C12C6C12Br2 has a stronger aggregation ability in comparison with its single chain counterpart but also because the electrostatic repulsion between head groups of C12C6C12Br2 is greatly weakened after Au(III) is converted to Au(I), which is in favor of the construction of vesicles, capsule-like, and tube-like aggregates. Compared with solid Au nanospheres, the resultant hollow nanostructures exhibit enhanced electrocatalytic activities in methanol oxidation, following the order of elongated nanocapsule > nanocapsule > nanosphere. Benefiting from balanced interactions between the gemini surfactant and Au(I), this soft-template method may present a facile and versatile approach for the controlled synthesis of Au nanostructures potentially useful for fuel cells and other Au nanodevices.
Kelly, Glenn; Simpson, Grahame K; Brown, Suzanne; Kremer, Peter; Gillett, Lauren
2017-05-23
The objectives were to test the properties, via a psychometric study, of the Overt Behaviour Scale-Self-Report (OBS-SR), a version of the OBS-Adult Scale developed to provide a client perspective on challenging behaviours after acquired brain injury. Study sample 1 consisted of 37 patients with primary brain tumour (PBT) and a family-member informant. Sample 2 consisted of 34 clients with other acquired brain injury (mixed brain injury, MBI) and a service-provider informant. Participants completed the OBS-SR (at two time points), and the Awareness Questionnaire (AQ) and Mayo Portland Adaptability Inventory-III (MPAI-III) once; informants completed the OBS-Adult and AQ once only. PBT-informant dyads displayed "good" levels of agreement (ICC 2,k = .74; OBS-SR global index). Although MBI-informant dyads displayed no agreement (ICC 2,k = .22; OBS-SR global index), the sub-group (17/29) rated by clinicians as having moderate to good levels of awareness displayed "fair" agreement (ICC 2,k = .58; OBS-SR global index). Convergent/divergent validity was demonstrated by significant correlations between OBS-SR subscales and MPAI-III subscales with behavioural content (coefficients in the range .36 -.61). Scores had good reliability across one week (ICC 2,k = .69). The OBS-SR took approximately 15 minutes to complete. It was concluded that the OBS-SR demonstrated acceptable reliability and validity, providing a useful resource in understanding clients' perspectives about their behaviour.
Relance du Gemini News Service | IDRC - International ...
International Development Research Centre (IDRC) Digital Library (Canada)
Agence de presse basée à Londres, le Gemini News Service achetait des reportages de correspondants dans des pays en développement et les distribuait aux médias d'information partout dans le monde. La fermeture de l'agence en 2002 après trente ans d'activité s'explique en partie par les frais d'exploitation élevés ...
An ultra short pulse reconstruction software applied to the GEMINI high power laser system
Energy Technology Data Exchange (ETDEWEB)
Galletti, Mario, E-mail: mario.gall22@gmail.com [INFN – LNF, Via Enrico Fermi 40, 00044 Frascati (Italy); Galimberti, Marco [Central Laser Facility, Rutherford Appleton Laboratory, Didcot (United Kingdom); Hooker, Chris [Central Laser Facility, Rutherford Appleton Laboratory, Didcot (United Kingdom); University of Oxford, Oxford (United Kingdom); Chekhlov, Oleg; Tang, Yunxin [Central Laser Facility, Rutherford Appleton Laboratory, Didcot (United Kingdom); Bisesto, Fabrizio Giuseppe [INFN – LNF, Via Enrico Fermi 40, 00044 Frascati (Italy); Curcio, Alessandro [INFN – LNF, Via Enrico Fermi 40, 00044 Frascati (Italy); Sapienza – University of Rome, P.le Aldo Moro, 2, 00185 Rome (Italy); Anania, Maria Pia [INFN – LNF, Via Enrico Fermi 40, 00044 Frascati (Italy); Giulietti, Danilo [Physics Department of the University and INFN, Pisa (Italy)
2016-09-01
The GRENOUILLE traces of Gemini pulses (15 J, 30 fs, PW, shot per 20 s) were acquired in the Gemini Target Area PetaWatt at the Central Laser Facility (CLF), Rutherford Appleton Laboratory (RAL). A comparison between the characterizations of the laser pulse parameters made using two different types of algorithms: Video Frog and GRenouille/FrOG (GROG), was made. The temporal and spectral parameters came out to be in great agreement for the two kinds of algorithms. In this experimental campaign it has been showed how GROG, the developed algorithm, works as well as VideoFrog algorithm with the PetaWatt pulse class. - Highlights: • Integration of the diagnostic tool on high power laser. • Validation of the GROG algorithm in comparison to a well-known commercial available software. • Complete characterization of the GEMINI ultra-short high power laser pulse.
Advective transport observations with MODPATH-OBS--documentation of the MODPATH observation process
Hanson, R.T.; Kauffman, L.K.; Hill, M.C.; Dickinson, J.E.; Mehl, S.W.
2013-01-01
The MODPATH-OBS computer program described in this report is designed to calculate simulated equivalents for observations related to advective groundwater transport that can be represented in a quantitative way by using simulated particle-tracking data. The simulated equivalents supported by MODPATH-OBS are (1) distance from a source location at a defined time, or proximity to an observed location; (2) time of travel from an initial location to defined locations, areas, or volumes of the simulated system; (3) concentrations used to simulate groundwater age; and (4) percentages of water derived from contributing source areas. Although particle tracking only simulates the advective component of conservative transport, effects of non-conservative processes such as retardation can be approximated through manipulation of the effective-porosity value used to calculate velocity based on the properties of selected conservative tracers. This program can also account for simple decay or production, but it cannot account for diffusion. Dispersion can be represented through direct simulation of subsurface heterogeneity and the use of many particles. MODPATH-OBS acts as a postprocessor to MODPATH, so that the sequence of model runs generally required is MODFLOW, MODPATH, and MODPATH-OBS. The version of MODFLOW and MODPATH that support the version of MODPATH-OBS presented in this report are MODFLOW-2005 or MODFLOW-LGR, and MODPATH-LGR. MODFLOW-LGR is derived from MODFLOW-2005, MODPATH 5, and MODPATH 6 and supports local grid refinement. MODPATH-LGR is derived from MODPATH 5. It supports the forward and backward tracking of particles through locally refined grids and provides the output needed for MODPATH_OBS. For a single grid and no observations, MODPATH-LGR results are equivalent to MODPATH 5. MODPATH-LGR and MODPATH-OBS simulations can use nearly all of the capabilities of MODFLOW-2005 and MODFLOW-LGR; for example, simulations may be steady-state, transient, or a combination
The TN-GEMINI: experience on a versatile alpha waste transport container
International Nuclear Information System (INIS)
Roland, V.; Chanzy, Y.
2001-01-01
The present paper discusses experience gained in moving alpha wastes and its teachings regarding transport aspects of D and D. Alpha wastes are generated in fuel cycle facilities such as those involved in reprocessing, in manufacture of mixed oxide fuel, and by research laboratories. If a significant amount of wastes has to be transported, then a Type B packaging is required. Developed by Transnucleaire and COGEMA, the TN GEMINI container enables nuclear facilities operators to optimise their alpha waste transport management, and more generally contribute to their D and D projects. After describing succinctly the design of the TN GEMINI, the paper will explain how the packaging is being operated. Teachings from experience will be shared. (orig.)
OBS Data Denoising Based on Compressed Sensing Using Fast Discrete Curvelet Transform
Nan, F.; Xu, Y.
2017-12-01
OBS (Ocean Bottom Seismometer) data denoising is an important step of OBS data processing and inversion. It is necessary to get clearer seismic phases for further velocity structure analysis. Traditional methods for OBS data denoising include band-pass filter, Wiener filter and deconvolution etc. (Liu, 2015). Most of these filtering methods are based on Fourier Transform (FT). Recently, the multi-scale transform methods such as wavelet transform (WT) and Curvelet transform (CvT) are widely used for data denoising in various applications. The FT, WT and CvT could represent signal sparsely and separate noise in transform domain. They could be used in different cases. Compared with Curvelet transform, the FT has Gibbs phenomenon and it cannot handle points discontinuities well. WT is well localized and multi scale, but it has poor orientation selectivity and could not handle curves discontinuities well. CvT is a multiscale directional transform that could represent curves with only a small number of coefficients. It provide an optimal sparse representation of objects with singularities along smooth curves, which is suitable for seismic data processing. As we know, different seismic phases in OBS data are showed as discontinuous curves in time domain. Hence, we promote to analysis the OBS data via CvT and separate the noise in CvT domain. In this paper, our sparsity-promoting inversion approach is restrained by L1 condition and we solve this L1 problem by using modified iteration thresholding. Results show that the proposed method could suppress the noise well and give sparse results in Curvelet domain. Figure 1 compares the Curvelet denoising method with Wavelet method on the same iterations and threshold through synthetic example. a)Original data. b) Add-noise data. c) Denoised data using CvT. d) Denoised data using WT. The CvT can well eliminate the noise and has better result than WT. Further we applied the CvT denoise method for the OBS data processing. Figure 2a
The Gemini Planet Imager Exoplanet Survey
Macintosh, Bruce
The Gemini Planet Imager (GPI) is a next-generation coronagraph constructed for the Gemini Observatory. GPI will see first light this fall. It will be the most advanced planet-imaging system in operation - an order of magnitude more sensitive than any current instrument, capable of detecting and spectroscopically characterizing young Jovian planets 107 times fainter than their parent star at separations of 0.2 arcseconds. GPI was built from the beginning as a facility-class survey instrument, and the observatory will employ it that way. Our team has been selected by Gemini Observatory to carry out an 890-hour program - the GPI Exoplanet Survey (GPIES) campaign from 2014-2017. We will observe 600 stars spanning spectral types A-M. We will use published young association catalogs and a proprietary list in preparation that adds several hundred new young (pc) and adolescent (pc) stars. The range of separations studied by GPI is completely inaccessible to Doppler and transit techniques (even with Kepler or TESS)— GPI offers a new window into planet formation. We will use GPI to produce the first-ever robust census of giant planet populations in the 5-50 AU range, allowing us to: 1) illuminate the formation pathways of Jovian planets; 2) reconstruct the early dynamical evolution of systems, including migration mechanisms and the interaction with disks and belts of debris; and 3) bridge the gap between Jupiter and the brown dwarfs with the first examples of cool low- gravity planetary atmospheres. Simulations predict this survey will discover approximately 50 exoplanets, increasing the number of exoplanet images by an order of magnitude, enough for statistical investigation. This Origins of Solar Systems proposal will support the execution of the GPI Exoplanet Survey campaign. We will develop tools needed to execute the survey efficiently. We will refine the existing GPI data pipeline to a final version that robustly removes residual speckle artifacts and provides
GeMS: Gemini Mcao System: current status and commissioning plans
Boccas, Maxime; Rigaut, François; Gratadour, Damien; d'Orgeville, Céline; Bec, Matthieu; Daruich, Felipe; Perez, Gabriel; Arriagada, Gustavo; Bombino, Stacy; Carter, Chris; Cavedoni, Chas; Collao, Fabian; Collins, Paul; Diaz, Pablo; Ebbers, Angelic; Galvez, Ramon; Gausachs, Gaston; Hardash, Steve; James, Eric; Karewicz, Stan; Lazo, Manuel; Maltes, Diego; Mouser, Ron; Rogers, Rolando; Rojas, Roberto; Sheehan, Michael; Trancho, Gelys; Vergara, Vicente; Vucina, Tomislav
2008-07-01
The Gemini Multi-Conjugate Adaptive Optics project was launched in April 1999 to become the Gemini South AO facility in Chile. The system includes 5 laser guide stars, 3 natural guide stars and 3 deformable mirrors optically conjugated at 0, 4.5 and 9km to achieve near-uniform atmospheric compensation over a 1 arc minute square field of view. Sub-contracted systems with vendors were started as early as October 2001 and were all delivered by July 2007, but for the 50W laser (due around September 2008). The in-house development began in January 2006, and is expected to be completed by the end of 2008 to continue with integration and testing (I&T) on the telescope. The on-sky commissioning phase is scheduled to start during the first half of 2009. In this general overview, we will first describe the status of each subsystem with their major requirements, risk areas and achieved performance. Next we will present our plan to complete the project by reviewing the remaining steps through I&T and commissioning on the telescope, both during day-time and at night-time. Finally, we will summarize some management activities like schedules, resources and conclude with some lessons learned.
Modelling of slag emulsification and slag reduction in CAS-OB process
Sulasalmi, P. (Petri)
2016-01-01
Abstract Composition Adjustment by Sealed argon bubbling – Oxygen Blowing (CAS-OB) process is a ladle treatment process that was developed for chemical heating and alloying of steel. The main stages of the process are heating, (possible) alloying and reduction of slag. The CAS-OB process aims for homogenization and control of the composition and temperature of steel. In this dissertation, a mathematical reaction model was developed for the slag reduction stage of the CAS-OB process. Sl...
Directory of Open Access Journals (Sweden)
Mohammad Mobin
2012-12-01
Full Text Available Gemini surfactants, butanediyl 1,4-bis(dimethyl cetylammonium bromide, pentanediyl 1,5 - bis (dimethyl cetylammonium bromide and hexanediyl 1,6 - bis (dimethyl cetylammonium bromide from Alkanediyl-α, ω-bis (dimethyl cetylammonium bromide series were synthesized in laboratory and were characterized by using Nuclear Magnetic Resonance (NMR spectroscopy. The surfactants were tested as corrosion inhibitors for mild steel in 20% formic acid. The influence of surfactants on mild steel corrosion inhibition was investigated by measuring the corrosion rate of mild steel in their absence and presence by weight loss measurements, solvent analysis of iron ions into the test solution and potentiodynamic polarization measurements. The surface morphology of the corroded steel samples in presence and absence of surfactants was evaluated by using Scanning Electron Microscopy (SEM. The synthesized gemini surfactants performed as excellent corrosion inhibitor, the inhibition efficiency (IE being in the range of 76.66-97.41%. The IE of surfactants is slightly affected by the spacer length. The IE increased with increase in surfactant concentration and temperature. The adsorption of gemini surfactants on the steel surface was found to obey Langmuir adsorption isotherm. The results of the potentiodynamic polarization studies are consistent with the results of weight loss studies.
International Nuclear Information System (INIS)
Luo, Zhongxin; Gao, Manglai; Ye, Yage; Yang, Senfeng
2015-01-01
Highlights: • RCMs were modified by three Gemini surfactants with different spacer length. • The adsorption kinetics and thermodynamics of MO on organoclays were investigated. • Both the spacer length and clay layer charge have significant effects on the removal of MO. • The removal efficiency of MO increased with increasing clay layer charge. • Gemini surfactants modified RCMs were low-cost and high efficient adsorbents for the uptake of MO. - Abstract: The influences that the spacer chain length of Gemini surfactants and clay layer charge have on the structures and sorption characteristics of organoclays have been investigated. Organoclays were obtained by modifying a series of reduced charge montmorillonites (RCMs) using three Gemini surfactants with different spacer length. And their structures and sorption characteristics for methyl orange (MO) were examined. It was suggested that the amount, spacer length of Gemini surfactant and clay layer charge had significant effects on the microstructure of the organoclays. The adsorption experiments results claimed that the uptake of MO onto organoclays was in the order: 16-4-16-Mt > 16-8-16-Mt > 16-6-16-Mt, while it increased with increasing clay layer charge. The adsorption isotherms of MO onto the organoclays could be best described by Langmuir equation, and the adsorption kinetic was in good agreement with the pseudo-second-order model. Thermodynamic parameters demonstrated that the sorption process was spontaneous and endothermic in nature. This work will provide a deep insight into the interaction of Gemini-modified clays and MO, which pave the way for their practical applications in anionic dye adsorption
Energy Technology Data Exchange (ETDEWEB)
Luo, Zhongxin; Gao, Manglai, E-mail: mlgao@cup.edu.cn; Ye, Yage; Yang, Senfeng
2015-01-01
Highlights: • RCMs were modified by three Gemini surfactants with different spacer length. • The adsorption kinetics and thermodynamics of MO on organoclays were investigated. • Both the spacer length and clay layer charge have significant effects on the removal of MO. • The removal efficiency of MO increased with increasing clay layer charge. • Gemini surfactants modified RCMs were low-cost and high efficient adsorbents for the uptake of MO. - Abstract: The influences that the spacer chain length of Gemini surfactants and clay layer charge have on the structures and sorption characteristics of organoclays have been investigated. Organoclays were obtained by modifying a series of reduced charge montmorillonites (RCMs) using three Gemini surfactants with different spacer length. And their structures and sorption characteristics for methyl orange (MO) were examined. It was suggested that the amount, spacer length of Gemini surfactant and clay layer charge had significant effects on the microstructure of the organoclays. The adsorption experiments results claimed that the uptake of MO onto organoclays was in the order: 16-4-16-Mt > 16-8-16-Mt > 16-6-16-Mt, while it increased with increasing clay layer charge. The adsorption isotherms of MO onto the organoclays could be best described by Langmuir equation, and the adsorption kinetic was in good agreement with the pseudo-second-order model. Thermodynamic parameters demonstrated that the sorption process was spontaneous and endothermic in nature. This work will provide a deep insight into the interaction of Gemini-modified clays and MO, which pave the way for their practical applications in anionic dye adsorption.
Variability of X-ray emission from OB stars
International Nuclear Information System (INIS)
Collura, A.; Sciortino, S.; Serio, S.; Vaiana, G. S.; Harnden, F.R. JR.; Osservatorio Astronomico, Palermo, Italy; Harvard-Smithsonian Center for Astrophysics, Cambridge, MA)
1989-01-01
The variability in soft X-ray emission of 12 OB stars is studied. Two different methods of analysis, one more suitable for detecting short-term variations, the other aimed at detecting long time-scale variations, are applied to all stars in the sample. The long-term variability analysis shows that Cyg-OB2 8A Zeta Pup and Delta Ori exhibit significant count rate variations between different data sections. Similar variations are marginally detected in 15 Mon; the count rate variations for the other eight stars are consistent with statistical fluctuations. The light curve of Cyg-OB2 8A suggests the existence of two different emission levels. The short-term variability analysis detects marginal variability in Tau Sco with an effective amplitude of about 30 percent and a time scale of about 50 s. The upper limits to the effective short-term variability amplitude for all other sample stars are in the 10-30 percent range. 30 refs
Impaired transport of thyroid hormones into livers of obese (ob/ob) mice
International Nuclear Information System (INIS)
Hillgartner, F.B.; Romsos, D.R.
1988-01-01
Obese (ob/ob) mice exhibit impaired hepatic thyroid hormone action that is mediated, at least in part, by a reduced nuclear 3,5,3'-triiodothyronine (T 3 ) receptor occupancy. The possibility that lowered occupancy in obese mice may be caused by decreased transport of T 3 across the hepatic plasma membrane was examined by measuring the unidirectional influx of [ 125 I]T 3 into livers of 8- to 10-wk-old obese and lean mice using a tissue-sampling portal vein-injection technique. Influx of [ 125 I]thyroxine (T 4 ), a substrate for T 4 5'-deiodinase, was also measured. Unidirectional clearance of T 3 and T 4 was 64 and 80% lower, respectively, in obese mice than in lean mice. Hepatic T 3 and T 4 uptake was nonsaturable in both lean and obese mice, suggesting that transport occurs by lipid-mediated free diffusion. Clearance of another lipid-soluble hormone, hydrocortisone, was also lower in obese mice than in lean mice. Decreased membrane permeability to the above hormones in obese mice may result from reported changes in membrane lipid composition. In conclusion, decreased hepatic thyroid hormone uptake may contribute to impaired thyroid hormone action and T 3 production in livers of obese mice
Nuclear triiodothyronine receptor binding characteristics and occupancy in obese (ob/ob) mice
International Nuclear Information System (INIS)
Hillgartner, F.B.; Romsos, D.R.
1987-01-01
Obese (ob/ob) mice exhibit reduced adaptive thermogenesis associated with an impairment of thyroid hormone action. The mechanism underlying the latter defect was investigated by comparing the binding characteristics and occupancy of solubilized nuclear 3,5,3'-triiodothyronine (T 3 ) receptors from livers of lean and obese mice. T 3 concentration was measured by radioimmunoassay. Scatchard analysis showed minimal differences in B/sub max/ and K/sub d/ between phenotypes at both 4 and 8-10 wk of age, indicating that reduced hepatic thyroid hormone expression in obese mice is not caused by alterations in nuclear receptor concentration or affinity. In contrast, nuclear T 3 receptor occupancy (endogenous T 3 associated with the specific receptor divided by B/sub max/) was 14 and 23% lower in 4- and 8- to 10-wk old obese mice, respectively. Together with reported changes in hepatic thyroid hormone-sensitive enzymes, these data are consistent with a diminished nuclear T 3 signal initiating thyroid hormone action in obese mice. Decreased nuclear T 3 receptor occupancy may be secondary to a low transport of plasma T 3 to the nuclear pool. In conclusion, impaired hepatic thyroid hormone action in obese mice is mediated in part at least by a reduction in nuclear T 3 receptor occupancy
The Gemini Deep Planet Survey - GDPS
Energy Technology Data Exchange (ETDEWEB)
Lafreniere, D; Doyon, R; Marois, C; Nadeau, D; Oppenheimer, B R; Roche, P F; Rigaut, F; Graham, J R; Jayawardhana, R; Johnstone, D; Kalas, P G; Macintosh, B; Racine, R
2007-06-01
We present the results of the Gemini Deep Planet Survey, a near-infrared adaptive optics search for giant planets and brown dwarfs around nearby young stars. The observations were obtained with the Altair adaptive optics system at the Gemini North telescope and angular differential imaging was used to suppress the speckle noise of the central star. Detection limits for the 85 stars observed are presented, along with a list of all faint point sources detected around them. Typically, the observations are sensitive to angular separations beyond 0.5-inch with 5{sigma} contrast sensitivities in magnitude difference at 1.6 {micro}m of 9.6 at 0.5-inch, 12.9 at 1-inch, 15 at 2-inch, and 16.6 at 5-inch. For the typical target of the survey, a 100 Myr old K0 star located 22 pc from the Sun, the observations are sensitive enough to detect planets more massive than 2 M{sub Jup} with a projected separation in the range 40-200 AU. Depending on the age, spectral type, and distance of the target stars, the minimum mass that could be detected with our observations can be {approx}1 M{sub Jup}. Second epoch observations of 48 stars with candidates (out of 54) have confirmed that all candidates are unrelated background stars. A detailed statistical analysis of the survey results, which provide upper limits on the fractions of stars with giant planet or low mass brown dwarf companions, is presented. Assuming a planet mass distribution dn/dm {proportional_to} m{sup -1.2} and a semi-major axis distribution dn/da {proportional_to} a{sup -1}, the upper limits on the fraction of stars with at least one planet of mass 0.5-13 M{sub Jup} are 0.29 for the range 10-25 AU, 0.13 for 25-50 AU, and 0.09 for 50-250 AU, with a 95% confidence level; this result is weakly dependent on the semi-major axis distribution power-law index. Without making any assumption on the mass and semi-major axis distributions, the fraction of stars with at least one brown dwarf companion having a semi-major axis in the
Small angle neutron scattering study of the gemini nonionic surfactant in heavy water solutions
International Nuclear Information System (INIS)
Rajewska, A
2012-01-01
The nonionic gemini surfactant α α'-[2,4,7,9-tetramethyl-5-decyne-4,7diyl]bis[ω hydroxyl-polyoxyethylene] (S-10) was investigated in heavy water solutions only for concentrations: 2.3%, 2.5%,3%, 3.4%, 4% and 5% at temperature 25 C with small angle neutron scattering (SANS) method. All of surfactants solutions were prepared using D 2 O (99.9% deuterated, Prikladnaia Chimia, St. Petersburg, Russia) as a solvent. The nonionic gemini surfactant S-10 was obtained from Air Products and Chemicals, Inc., and used without further purification. All SANS measurements were performed on V-4 SANS spectrometer at BENSC, Berlin (Germany). Neutrons were used in wavelength range of 0.02 - 4 nm - 1. For the measurements quartz cells of were used during experiment. Up to 14 such cells were placed in a holder. Results from experiment was calculated and evaluated with PCG 2.0 program from Graz University (Austria). In the investigated solutions two axis ellipsoidal micelles was observed.
Not all stars form in clusters - measuring the kinematics of OB associations with Gaia
Ward, Jacob L.; Kruijssen, J. M. Diederik
2018-04-01
It is often stated that star clusters are the fundamental units of star formation and that most (if not all) stars form in dense stellar clusters. In this monolithic formation scenario, low-density OB associations are formed from the expansion of gravitationally bound clusters following gas expulsion due to stellar feedback. N-body simulations of this process show that OB associations formed this way retain signs of expansion and elevated radial anisotropy over tens of Myr. However, recent theoretical and observational studies suggest that star formation is a hierarchical process, following the fractal nature of natal molecular clouds and allowing the formation of large-scale associations in situ. We distinguish between these two scenarios by characterizing the kinematics of OB associations using the Tycho-Gaia Astrometric Solution catalogue. To this end, we quantify four key kinematic diagnostics: the number ratio of stars with positive radial velocities to those with negative radial velocities, the median radial velocity, the median radial velocity normalized by the tangential velocity, and the radial anisotropy parameter. Each quantity presents a useful diagnostic of whether the association was more compact in the past. We compare these diagnostics to models representing random motion and the expanding products of monolithic cluster formation. None of these diagnostics show evidence of expansion, either from a single cluster or multiple clusters, and the observed kinematics are better represented by a random velocity distribution. This result favours the hierarchical star formation model in which a minority of stars forms in bound clusters and large-scale, hierarchically structured associations are formed in situ.
Novel Gemini vitamin D3 analogs
DEFF Research Database (Denmark)
Okamoto, Ryoko; Gery, Sigal; Kuwayama, Yoshio
2014-01-01
anticancer potency, but similar toxicity causing hypercalcemia. We focused on the effect of these compounds on the stimulation of expression of human cathelicidin antimicrobial peptide (CAMP) whose gene has a vitamin D response element in its promoter. Expression of CAMP mRNA and protein increased in a dose......-response fashion after exposure of acute myeloid leukemia (AML) cells to the Gemini analog, BXL-01-126, in vitro. A xenograft model of AML was developed using U937 AML cells injected into NSG-immunodeficient mice. Administration of vitamin D3 compounds to these mice resulted in substantial levels of CAMP...
Gemini Observatory Takes its Local Communities on an Expanding Journey
Harvey, Janice; Michaud, Peter
2012-08-01
Currently in its 7th year (2011) Hawaii's annual Journey through the Universe (JttU) program is a flagship Gemini Observatory public education/outreach initiative involving a broad cross-section of the local Hawai'i Island astronomical community, the public, educators, businesses, local government officials, and thousands of local students. This paper describes the program, its history, planning, implementation, as well as the program's objectives and philosophy. The success of this program is documented here, as measured by continuous and expanding engagement of educators, the community, and the public, along with formal evaluation feedback and selected informal verbal testimony. The program's success also serves as justification for the planned adaptation of a version of the program in Chile in 2011 (adapted for Chilean educational and cultural differences). Finally, lessons learned are shared which have refined the program for Gemini's host communities but can also apply to any institution wishing to initiate a similar program.
Singh, Jagbir; Yang, Peng; Michel, Deborah; Verrall, Ronald E; Foldvari, Marianna; Badea, Ildiko
2011-05-01
Gene based therapy represents an important advance in the treatment of diseases that heretofore have had either no treatment or cure. To capitalize on the true potential of gene therapy, there is a need to develop better delivery systems that can protect these therapeutic biomolecules and deliver them safely to the target sites. Recently, we have designed and developed a series of novel amino acid-substituted gemini surfactants with the general chemical formula C(12)H(25) (CH(3))(2)N(+)-(CH(2))(3)-N(AA)-(CH(2))(3)-N(+) (CH(3))(2)-C(12)H(25) (AA= glycine, lysine, glycyl-lysine and, lysyl-lysine). These compounds were synthesized and tested in rabbit epithelial cells using a model plasmid and a helper lipid. Plasmid/gemini/lipid (P/G/L) nanoparticles formulated using these novel compounds achieved higher gene expression than the nanoparticles containing the parent unsubstituted compound. In this study, we evaluated the cytotoxicity of P/G/L nanoparticles and explored the relationship between transfection efficiency/toxicity and their physicochemical characteristics (such as size, binding properties, etc.). An overall low toxicity is observed for all complexes with no significant difference among substituted and unsubstituted compounds. An interesting result revealed by the dye exclusion assay suggests a more balanced protection of the DNA by the glycine and glycyl-lysine substituted compounds. Thus, the higher transfection efficiency is attributed to the greater biocompatibility and flexibility of the amino acid/peptide-substituted gemini surfactants and demonstrates the feasibility of using amino acid-substituted gemini surfactants as gene carriers for the treatment of diseases affecting epithelial tissue.
Transcriptional activation of the mouse obese (ob) gene by CCAAT/enhancer binding protein alpha
DEFF Research Database (Denmark)
Hwang, C S; Mandrup, S; MacDougald, O A
1996-01-01
Like other adipocyte genes that are transcriptionally activated by CCAAT/enhancer binding protein alpha (C/EBP alpha) during preadipocyte differentiation, expression of the mouse obese (ob) gene is immediately preceded by the expression of C/EBP alpha. While the 5' flanking region of the mouse ob...... gene contains several consensus C/EBP binding sites, only one of these sites appears to be functional. DNase I cleavage inhibition patterns (footprinting) of the ob gene promoter revealed that recombinant C/EBP alpha, as well as a nuclear factor present in fully differentiated 3T3-L1 adipocytes...... to a consensus C/EBP binding site at nucleotides -55 to -47 generated a specific protein-oligonucleotide complex that was supershifted by antibody against C/EBP alpha. Probes corresponding to two upstream consensus C/EBP binding sites failed to generate protein-oligonucleotide complexes. Cotransfection of a C...
Evaluation of the energy-climate package with the help of Gemini-E3 Model
International Nuclear Information System (INIS)
Vielle, M.; Moulinier, J.M.; Bernard, A.
2009-01-01
This article presents an evaluation of the energy-climate package carried out at the request of the Ministry of Sustainable Development (MEEDDAT) by simulating several scenarios on the general calculable equilibrium model GEMINI-E3. The analysis was carried out during the European negotiations in very close collaboration with the services of the Ministry and has thus constituted a useful tool for deciding and defining the position of France, which, besides, chaired the Union in the course of the transition period of the second half of 2008 and was in charge of finding and gaining acceptance of a compromise between all the member countries, while taking into account the aspirations of the professionals most closely involved. As one might guess, the study shows that the easing of constraints through mechanisms of flexibility yields reductions in the cost of European policy on climate change, particularly for the achievement of the main objective, viz. the 20% reduction of greenhouse gas emissions by 2020. This cost is reasonable, although its distribution between countries is neither homogeneous, nor in conformity with concerns over equity. Many indirect effects of the policy on climate change, in particular the gains or losses caused by the modification of the terms of trade, may significantly upset the hierarchy of direct costs. This article also looks into the carbon leakage issue and suggests, in particular, favouring the net leakage concept, this being the discrepancy between the additional emissions in non-annex B countries and those which would have been incurred if production in response to demand from annex B countries relatively insensitive to the policy o climatic change, had not been relocated. Another feature of this study is an evaluation, after the event, of the extent to which the use of a modelling tool has effectively allowed identification of the issues raised in the course of the European negotiation, and to provide relevant answers. (authors)
VizieR Online Data Catalog: Velocity and proper motion of OB associations (Melnik+, 2009)
Melnik, A. M.; Dambis, A. K.
2009-11-01
For every OB-association from the list by Blaha and Humphreys (1989AJ.....98.1598B) we give the mean galactic coordinates l and b, the mean heliocentric distance r, median line-of-sight velocity Vr, the dispersion of line-of-sight velocities dvr, and number of stars with known line-of-sight velocity nvr. The line-of-sight velocities were taken from the catalog by Barbier-Brossat and Figon (1999, Cat. ). We used only the velocities measured with errors of less than 10km/s which corresponds to the quality estimations A, B, and C. We also present median proper motions of OB-associations along l- and b- coordinates, mul and mub. The data obtained for the old reduction (1997, Cat. ) are denoted by the subscript 1, whereas those based on the reduction by van Leewen (2008, Cat. ) are marked by the subscript 2. For each OB association we represent the dispersions of proper motions, dml and dmb, as well as a number of stars nmu with known proper motion. The last column shows the total number of stars with known photometric measurements, Nt, used for determination of the distances for OB-associations. The distances r correspond to the short distance scale for classical Cepheids. They are equal to the distances from the catalog by Blaha and Humphreys (1989AJ.....98.1598B), rBH, multiplied by a factor of 0.8, r=0.8*rBH. (1 data file).
ObsPy: A Python Toolbox for Seismology
Krischer, Lion; Megies, Tobias; Sales de Andrade, Elliott; Barsch, Robert; MacCarthy, Jonathan
2017-04-01
In recent years the Python ecosystem evolved into one of the most powerful and productive scientific environments across disciplines. ObsPy (https://www.obspy.org) is a fully community-driven, open-source project dedicated to providing a bridge for seismology into that ecosystem. It does so by offering Read and write support for essentially every commonly used data format in seismology with a unified interface and automatic format detection. This includes waveform data (MiniSEED, SAC, SEG-Y, Reftek, …) as well as station (SEED, StationXML, …) and event meta information (QuakeML, ZMAP, …). Integrated access to the largest data centers, web services, and real-time data streams (FDSNWS, ArcLink, SeedLink, ...). A powerful signal processing toolbox tuned to the specific needs of seismologists. Utility functionality like travel time calculations with the TauP method, geodetic functions, and data visualizations. ObsPy has been in constant development for more than seven years and is developed and used by scientists around the world with successful applications in all branches of seismology. Additionally it nowadays serves as the foundation for a large number of more specialized packages. This presentation will give a short overview of the capabilities of ObsPy and point out several representative or new use cases. Additionally we will discuss the road ahead as well as the long-term sustainability of open-source scientific software.
GeMini: The Next-Generation Mechanically-Cooled Germanium Spectrometer
Energy Technology Data Exchange (ETDEWEB)
Burks, M
2008-11-12
The next-generation mechanically-cooled germanium spectrometer has been developed. GeMini (MINIature GErmanium spectrometer) has been designed to bring high-resolution gamma-ray spectroscopy to a range of demanding field environments. Intended applications include short-notice inspections, border patrol, port monitoring and emergency response, where positive nuclide identification of radioactive materials is required but power and liquid cryogen are not easily available. GeMini weighs 2.75 kg for the basic instrument and 4.5 kg for the full instrument including user interface and ruggedized hermetic packaging. It is very low power allowing it to operate for 10 hours on a single set of rechargeable batteries. This instrument employs technology adapted from the gamma-ray spectrometer currently flying on NASA's Mercury MESSENGER spacecraft. Specifically, infrared shielding techniques allow for a vast reduction of thermal load. This in turn allows for a smaller, lighter-weight design, well-suited for a hand-held instrument. Three working prototypes have been built and tested in the lab. The measured energy resolution is 3 keV fwhm at 662 keV gamma-rays. This paper will focus on the design and performance of the instrument.
An unidentified TeV source in the vicinity of Cygnus OB2
Aharonian, F.; Akhperjanian, A.; Beilicke, M.; Bernlöhr, K.; Börst, H.; Bojahr, H.; Bolz, O.; Coarasa, T.; Contreras, J.; Cortina, J.; Denninghoff, S.; Fonseca, V.; Girma, M.; Götting, N.; Heinzelmann, G.; Hermann, G.; Heusler, A.; Hofmann, W.; Horns, D.; Jung, I.; Kankanyan, R.; Kestel, M.; Kettler, J.; Kohnle, A.; Konopelko, A.; Kornmeyer, H.; Kranich, D.; Krawczynski, H.; Lampeitl, H.; Lopez, M.; Lorenz, E.; Lucarelli, F.; Magnussen, N.; Mang, O.; Meyer, H.; Milite, M.; Mirzoyan, R.; Moralejo, A.; Ona, E.; Panter, M.; Plyasheshnikov, A.; Prahl, J.; Pühlhofer, G.; Rauterberg, G.; Reyes, R.; Rhode, W.; Ripken, J.; Röhring, A.; Rowell, G. P.; Sahakian, V.; Samorski, M.; Schilling, M.; Schröder, F.; Siems, M.; Sobzynska, D.; Stamm, W.; Tluczykont, M.; Völk, H. J.; Wiedner, C. A.; Wittek, W.; Uchiyama, Y.; Takahashi, T.; HEGRA Collaboration
2002-10-01
Deep observation ( ~ 113 hrs) of the Cygnus region at TeV energies using the HEGRA stereoscopic system of air Čerenkov telescopes has serendipitously revealed a signal positionally inside the core of the OB association Cygnus OB2, at the edge of the 95% error circle of the EGRET source 3EG J2033+4118, and ~ 0.5o north of Cyg X-3. The source centre of gravity is RA alphaJ2000: 20h 32m 07s+/- 9.2sstat +/-2.2ssys, Dec deltaJ2000: +41o 30' 30''+/- 2.0'stat +/- 0.4'sys. The source is steady, has a post-trial significance of +4.6sigma , indication for extension with radius 5.6' at the ~ 3sigma level, and has a differential power-law flux with hard photon index of -1.9 +/-0.3stat +/-0.3sys. The integral flux above 1 TeV amounts ~ 3% that of the Crab. No counterpart for the TeV source at other wavelengths is presently identified, and its extension would disfavour an exclusive pulsar or AGN origin. If associated with Cygnus OB2, this dense concentration of young, massive stars provides an environment conducive to multi-TeV particle acceleration and likely subsequent interaction with a nearby gas cloud. Alternatively, one could envisage gamma -ray production via a jet-driven termination shock.
Pliego, Jose F; Wehbe-Janek, Hania; Rajab, M Hasan; Browning, Jeff L; Fothergill, Russell E
2008-01-01
To evaluate the effectiveness of an obstetrical and gynecologic (Ob/Gyn) Boot Camp simulation training on perceived technical competency, confidence in a leadership role, and stress hardiness of resident training. We conducted a prospective pilot study on the effectiveness of an Ob/Gyn Boot Camp on resident training. Residents participated in an intensive immersion in clinical simulation of common obstetrical emergencies including shoulder dystocia, neonatal resuscitation, postpartum hemorrhage, and ruptured ectopic pregnancy. After the training, residents completed a Web-based survey on their perceptions of how the Ob/Gyn Boot Camp affected their 1) technical competency in the assessment and management of their patients, 2) confidence in taking a leadership role, and 3) stress hardiness. Residents rated their perceptions on a Likert scale of 1 to 5, 1 = poor to 5 = excellent. Twenty-three (14 Ob/Gyn and 9 family medicine) residents participated in this pilot study. Eighteen (78%) residents completed the online survey; 4 Ob/Gyn and 1 family medicine resident did not complete the survey. The residents reported that the simulation training stimulated an interest in learning key skills for obstetrical and gynecologic emergencies. Ob/Gyn residents reported significant improvement in their perceived technical competence and stress hardiness after the Boot Camp. However both Ob/Gyn and family medicine residents reported no significant improvement of confidence in their leadership abilities during obstetrical emergencies after the Boot Camp. Boot Camp simulation training early in the curriculum has the potential for enhancing residents' self-assessments of confidence, competency, and stress hardiness in managing obstetrical emergencies.
Molecular clouds in Orion and Monoceros
International Nuclear Information System (INIS)
Maddalena, R.J.
1986-01-01
About one-eighth of a well-sampled 850 deg 2 region of Orion and Monoceros, extending from the Taurus dark cloud complex to the CMa OB 1 association, shows emission at the frequency of the J = 1 → 0 transition of CO coming from either local clouds (d 8 from the galactic plane or from more distant objects located within a few degrees of the plane and well outside the solar circle. Local giant molecular clouds associated with Orion A and B have enhanced temperatures and densities near their western edges possibly due to compression of molecular gas by a high pressure region created by the cumulative effects of ∼10 supernovae that occurred in the Orion OB association. Another giant molecular cloud found to be associated with Mon R2 may be related to the Orion clouds. Two filamentary clouds (one possible 200 pc long but only 3-10 pc wide) were found that may represent a new class of object; magnetic fields probably play a role in confining these filaments. An expanding ring of clouds concentric with the H II region S 264 and its ionizing 08 star λ Ori was also investigated, and a possible evolutionary sequence for the ring is given in detail: the clouds probably constitute fragments of the original cloud from which λ Ori formed, the gas pressure of the H II region and the rocket effect having disrupted the cloud and accelerated the fragments to their present velocities
Bosma, T.; Janssen, D.B.
Chlorinated propanes are important pollutants that may show persistent behaviour in the environment. The biotransformation of 1-chloropropane, 1,2-dichloropropane, 1,3-dichloropropane and 1,2,3-trichloropropane was studied using resting cell suspensions of Methylosinus trichosporium OB3b expressing
OBS Technologies and permanent seismic Stations at Sea
Makris, J.; Nikolova, S. B.
2003-04-01
An off-shore telemetric system was developed during last 2 years. It consists of a buoy unit, OBS with seismic sensor and digitizer at the sea floor and coaxial cable for transferring data from the sea. The buoy unit includes all components for recording and transmitting data to the base station. A solar panel and wind generator are the sources of energy that charge the batteries in the buoy. An Omni directional antenna and a radio modem are used for data transfer. The buoy can be connected also to mobile network or satellite. The Seismic recording unit is SEDIS IV developed in GeoPro GmbH which is a 6 channel data logger equipped with a hard disk of 30 GByte capacity and a flash memory of 0.5 Gbyte which can continuously record at different sampling rate (from 31.25 to 1000sps). The operating system for SEDIS IV is LINUX, with possible data compression, event location and extraction. The data transfer and supply of the power to seismometer and ADC unit in OBS sphere is done through coaxial cable, connecting the buoy unit and OBS. The whole system was tested for a period of one month (October 2002) within frame of Nestor program in Pilos (Greece) and worked successfully.
Geo-Engineering through Internet Informatics (GEMINI)
Energy Technology Data Exchange (ETDEWEB)
Watney, W. Lynn; Doveton, John H.; Victorine, John R.; Bohling, Goeffrey C.; Bhattacharya, Saibal; Byers, Alan P.; Carr, Timothy R.; Dubois, Martin K.; Gagnon, Glen; Guy, Willard J.; Look, Kurt; Magnuson, Mike; Moore, Melissa; Olea, Ricardo; Pakalapadi, Jayprakash; Stalder, Ken; Collins, David R.
2002-06-25
GEMINI will resolve reservoir parameters that control well performance; characterize subtle reservoir properties important in understanding and modeling hydrocarbon pore volume and fluid flow; expedite recognition of bypassed, subtle, and complex oil and gas reservoirs at regional and local scale; differentiate commingled reservoirs; build integrated geologic and engineering model based on real-time, iterate solutions to evaluate reservoir management options for improved recovery; provide practical tools to assist the geoscientist, engineer, and petroleum operator in making their tasks more efficient and effective; enable evaluations to be made at different scales, ranging from individual well, through lease, field, to play and region (scalable information infrastructure); and provide training and technology transfer to evaluate capabilities of the client.
Neutral hydrogen in the stellar accociation Scorpius OB-2
Energy Technology Data Exchange (ETDEWEB)
Bystrova, N.V.
1979-01-01
The distribution of neutral hydrogen connected with the stellar association Scorpius OB-2 is more complex than the expanding semienvelope suggested earlier. The neutral gas is in connection with the nebulae S1, S7, S9 and with H/sub ..cap alpha../-filaments found in the association and giving it the appearence of a spiral galaxy. The HI-distribution is in disagreement with the model of a supernova remnant.
CSO BOLOCAM 1.1 mm CONTINUUM MAPPING OF THE BRAID NEBULA STAR FORMATION REGION IN CYGNUS OB7
International Nuclear Information System (INIS)
Aspin, Colin; Beck, Tracy L.; Davis, Chris J.
2011-01-01
We present a 1.1 mm map of the Braid Nebula star formation region in Cygnus OB7 taken using Bolocam on the Caltech Submillimeter Observatory. Within the 1 deg 2 covered by the map, we have detected 55 cold dust clumps all of which are new detections. A number of these clumps are coincident with IRAS point sources although the majority are not. Some of the previously studied optical/near-IR sources are detected at 1.1 mm. We estimate total dust/gas masses for the 55 clumps together with peak visual extinctions. We conclude that over the whole region, approximately 20% of the clumps are associated with IRAS sources suggesting that these are protostellar objects. The remaining 80% are classed as starless clumps. In addition, both FU Orionis (FUor) like objects in the field, the Braid Star and HH 381 IRS, are associated with strong millimeter emission. This implies that FUor eruptions can occur at very early stages of pre-main-sequence life. Finally, we determine that the cumulative clump mass function for the region is very similar to that found in both the Perseus and ρ Ophiuchus star-forming regions.
Energy Technology Data Exchange (ETDEWEB)
M. Nadeem; C. Rangkuti; K. Anuar; M.R.U. Haq; I.B. Tan; S.S. Shah [Universiti Teknologi PETRONAS, Bandar Seri Iskandar (Malaysia)
2006-10-15
Diesel engines exhausting gaseous emission and particulate matter have long been regarded as one of the major air pollution sources, particularly in metropolitan areas, and have been a source of serious public concern for a long time. The emulsification method is not only motivated by cost reduction but is also one of the potentially effective techniques to reduce exhaust emission from diesel engines. Water/diesel (W/D) emulsified formulations are reported to reduce the emissions of NOx, SOx, CO and particulate matter (PM) without compensating the engine's performance. Emulsion fuels with varying contents of water and diesel were prepared and stabilized by conventional and gemini surfactant, respectively. Surfactant's dosage, emulsification time, stirring intensity, emulsifying temperature and mixing time have been reported. Diesel engine performance and exhaust emission was also measured and analyzed with these indigenously prepared emulsified fuels. The obtained experimental results indicate that the emulsions stabilized by gemini surfactant have much finer and better-distributed water droplets as compared to those stabilized by conventional surfactant. A comparative study involving torque, engine brake mean effective pressure (BMEP), specific fuel consumption (SFC), particulate matter (PM), NOx and CO emissions is also reported for neat diesel and emulsified formulations. It was found that there was an insignificant reduction in engine's efficiency but on the other hand there are significant benefits associated with the incorporation of water contents in diesel regarding environmental hazards. The biggest reduction in PM, NOx, CO and SOx emission was achieved by the emulsion stabilized by gemini surfactant containing 15% water contents. 34 refs., 11 figs., 1 tab.
BOREAS TF-3 Automated Chamber CO2 Flux Data from the NSA-OBS
Goulden, Michael L.; Crill, Patrick M.; Hall, Forrest G. (Editor); Conrad, Sara (Editor)
2000-01-01
The BOReal Ecosystem Atmosphere Study Tower Flux (BOREAS TF-3) and Trace Gas Biogeochemistry (TGB-1) teams collected automated CO2 chamber flux data in their efforts to fully describe the CO2 flux at the Northern Study Area-Old Black Spruce (NSA-OBS) site. This data set contains fluxes of CO2 at the NSA-OBS site measured using automated chambers. In addition to reporting the CO2 flux, it reports chamber air temperature, moss temperature, and light levels during each measurement. The data set covers the period from 23-Sep-1995 through 26-Oct-1995 and from 28-May-1996 through 21-Oct-1996. The data are stored in tabular ASCII files.
Pacaud, Fabien; Delaye, Jean-Marc; Charpentier, Thibault; Cormier, Laurent; Salanne, Mathieu
2017-10-28
Sodium borosilicate glasses Na 2 O-B 2 O 3 -SiO 2 (NBS) are complex systems from a structural point of view. Three main building units are present: tetrahedral SiO 4 and BO 4 (B IV ) and triangular BO 3 (B III ). One of the salient features of these compounds is the change of the B III /B IV ratio with the alkali concentration, which is very difficult to capture in force fields-based molecular dynamics simulations. In this work, we develop a polarizable force field that is able to reproduce the boron coordination and more generally the structure of several NBS systems in the glass and in the melt. The parameters of the potential are fitted from density functional theory calculations only, in contrast with the existing empirical potentials for NBS systems. This ensures a strong improvement on the transferability of the parameters from one composition to another. Using this new force field, the structure of NBS systems is validated against neutron diffraction and nuclear magnetic resonance experiments. A special focus is given to the distribution of B III /B IV with respect to the composition and the temperature.
Comparison of the biometric measurements calculated with Zeiss IOL-Master and WaveLight OB-820
Directory of Open Access Journals (Sweden)
Labiris G
2017-04-01
Full Text Available Georgios Labiris,1,2 Panagiota Ntonti,2 Konstantinos Ntitsos,2 Andreas Katsanos,2 Haris Sideroudi,2 Vasilios Kozobolis1,2 1Department of Ophthalmology, University Hospital of Alexandroupolis, 2Eye Institute of Thrace, Alexandroupolis, Greece Background: The primary objective of this study was to investigate the level of agreement between IOL-Master and OB-820 ocular biometers.Materials and methods: In this prospective randomized case series, we measured the anterior chamber depth (ACD, the axial length (AL, the corneal radii (R1, R2, the ratio of mean corneal radius and spherical equivalent and the corneal astigmatism (cylinder [Cyl] before and after cataract extraction surgery.Results: Significant differences between pre- and postoperative data were observed for ACD for both biometric devices (P<0.01 and Cyl parameter in IOL-Master. Range and 95% limits of agreement (LoA were clinically significantly different for AL parameter pre- and postoperatively and for R2 and radius and spherical equivalent postoperatively (P<0.001. The rest of the parameters presented sufficient 95% LoA, which imply good agreement.Conclusion: In clinical practice, the IOL-master and OB-820 should not be used interchangeably due to discrepancy in the important AL parameter. Both biometers may provide consistent results regarding Cyl, ACD and R1. Keywords: cataract, IOL-Master, OB-820, biometry, level of agreement
Energy Technology Data Exchange (ETDEWEB)
Semenkov, Ivan N.; Miroshnikov, Alexey Yu. [The Organization of Russian Academy of Sciences Institute of geology of ore deposits, petrography, mineralogy and geochemistry Russian Academy of Sciences (Russian Federation)
2014-07-01
There are several high level {sup 137}Cs anomaly zones detected in the deposits of the SW part of the Kara Sea. These anomaly zones were formed in the Ob' and the Enisey river estuaries due to the geochemical 'river-sea' boarder barrier. Level of radiocaesium specific activity reaches 120 Bq*kg{sup -1} in the deposits from these zones. Radiochemical enterprises occur in the both river basins. Their activity results in caesium-137 transfer into the river net. Vast area is contaminated by {sup 137}Cs after nuclear weapons in Semipalatinsk test-site and Kyshtym disaster in the Ob' river basin. Moreover, caesium comes to the Ob' and the Enisey river basins with global atmospheric fallout. The inflow of global fallout caesium-137 to the catchments is 660 kCi (320 kCi including radioactive decay) that is 4 times higher than {sup 137}Cs emission due to Fukushima disaster. Therefore, these river basins as any other huge catchment are an important sources of radioactive contamination of the Arctic Ocean. The aim of our research is to study behavior of global fallout caesium-137 in the landscapes of the Ob and the Enisey river basins. We studied caesium-137 behavior on the example of first order catchments in taiga, wetland, forest-steppe, steppe, and semi-arid landscapes. Geographic information system (GIS) was made. The tenth-order catchments (n=154, Horton coding system) shape 20-groups due to topsoil properties controlling cesium mobility. Eleven first-order basins, characterized 7 groups of tenth order catchments, were studied. And 700 bulk-core soil samples were collected in 2011-2013. Cesium runoff is calculated for 3 first-order river basins in taiga and forest-steppe landscapes. Storage of global fallout caesium-137 declines from undisturbing taiga first-order river basin (90% of cumulative fallout including radioactive decay)> arable steppe and fores-steppe (70 - 75%)> undisturbing wetland (60%). Caesium-137 transfer is high in arable lands
Production of metal and metal-ceramic coatings on D-Gun Ob
International Nuclear Information System (INIS)
Gavrilenko, T.P.; Nikolaev, Y.A.; Ulianitsky, V.Y.
1995-01-01
Optimization of the detonation spraying process has been made for the production of metal and metal-ceramics coatings with the D-Gun Ob. Owing to the ability of Ob to work with several fuels and an inert diluent simultaneously, variation of detonation regimes in a wide range is possible, and because of localized powder injection in the D-Gun barrel, high uniformity of parameters of powder particles is achieved. The best conditions for particle heating and acceleration were calculated with the help of mathematical simulation, and the corresponding regimes were realized on D-Gun Ob. High-quality aluminum, copper, nickel, and nickel-chromium-silicon-carbon-boron alloy coatings were produced by using only propane fuel. Chromium carbide with nickel and tungsten carbide with cobalt coatings were produced with addition of acetylene. Optimal efficiency and high bonding strength were achieved for all powders. Data on microhardness, bonding strength, and efficiency are presented
ObsPy: A Python Toolbox for Seismology - Recent Developments and Applications
Megies, T.; Krischer, L.; Barsch, R.; Sales de Andrade, E.; Beyreuther, M.
2014-12-01
ObsPy (http://www.obspy.org) is a community-driven, open-source project dedicated to building a bridge for seismology into the scientific Python ecosystem. It offersa) read and write support for essentially all commonly used waveform, station, and event metadata file formats with a unified interface,b) a comprehensive signal processing toolbox tuned to the needs of seismologists,c) integrated access to all large data centers, web services and databases, andd) convenient wrappers to legacy codes like libtau and evalresp.Python, currently the most popular language for teaching introductory computer science courses at top-ranked U.S. departments, is a full-blown programming language with the flexibility of an interactive scripting language. Its extensive standard library and large variety of freely available high quality scientific modules cover most needs in developing scientific processing workflows. Together with packages like NumPy, SciPy, Matplotlib, IPython, Pandas, lxml, and PyQt, ObsPy enables the construction of complete workflows in Python. These vary from reading locally stored data or requesting data from one or more different data centers through to signal analysis and data processing and on to visualizations in GUI and web applications, output of modified/derived data and the creation of publication-quality figures.ObsPy enjoys a large world-wide rate of adoption in the community. Applications successfully using it include time-dependent and rotational seismology, big data processing, event relocations, and synthetic studies about attenuation kernels and full-waveform inversions to name a few examples. All functionality is extensively documented and the ObsPy tutorial and gallery give a good impression of the wide range of possible use cases.We will present the basic features of ObsPy, new developments and applications, and a roadmap for the near future and discuss the sustainability of our open-source development model.
GeMini: The Next Generation Mechanically-Cooled Germanium Spectrometer
International Nuclear Information System (INIS)
Burks, M.
2008-01-01
The next-generation mechanically-cooled germanium spectrometer has been developed. GeMini (GErmanium MINIature spectrometer) has been designed to bring high-resolution gamma-ray spectroscopy to a range of demanding field environments. Intended applications include short-notice and surprise inspections where positive nuclide identification of radioactive materials is required. GeMini weighs 2.75 kg (6 lbs) total including the detector, cryostat, cryocooler, batteries, electronics and readout. It is very low power allowing it to operate for 10 hours on a single set of rechargeable batteries. This instrument employs technology adapted from the gamma-ray spectrometer currently flying on NASA's Mercury MESSENGER spacecraft. Specifically, infrared shielding techniques allow for a vast reduction of thermal load. This in turn allows for a smaller, lighter-weight design, well-suited for a hand-held instrument. Two working prototypes have been built and tested in the lab. The target energy resolution is 3 keV fwhm or better for 1332 keV gamma-rays. The detectors currently achieve around 4.5 keV resolution, which is slightly higher than our goal due to microphonic noise. Our present work focuses on improving the resolution through mechanical and electronic means of reducing the microphonic noise. This paper will focus on the performance of the instrument and its applicability for inspectors in the field
Wang, Li Kai; Nair, Pravin A; Shuman, Stewart
2008-08-22
NAD(+)-dependent DNA ligases (LigAs) are ubiquitous in bacteria and essential for growth. LigA enzymes have a modular structure in which a central catalytic core composed of nucleotidyltransferase and oligonucleotide-binding (OB) domains is linked via a tetracysteine zinc finger to distal helix-hairpin-helix (HhH) and BRCT (BRCA1-like C-terminal) domains. The OB and HhH domains contribute prominently to the protein clamp formed by LigA around nicked duplex DNA. Here we conducted a structure-function analysis of the OB and HhH domains of Escherichia coli LigA by alanine scanning and conservative substitutions, entailing 43 mutations at 22 amino acids. We thereby identified essential functional groups in the OB domain that engage the DNA phosphodiester backbone flanking the nick (Arg(333)); penetrate the minor grove and distort the nick (Val(383) and Ile(384)); or stabilize the OB fold (Arg(379)). The essential constituents of the HhH domain include: four glycines (Gly(455), Gly(489), Gly(521), Gly(553)), which bind the phosphate backbone across the minor groove at the outer margins of the LigA-DNA interface; Arg(487), which penetrates the minor groove at the outer margin on the 3 (R)-OH side of the nick; and Arg(446), which promotes protein clamp formation via contacts to the nucleotidyltransferase domain. We find that the BRCT domain is required in its entirety for effective nick sealing and AMP-dependent supercoil relaxation.
High rate of vaginal erosions associated with the mentor ObTape.
Yamada, Brian S; Govier, Fred E; Stefanovic, Ksenija B; Kobashi, Kathleen C
2006-08-01
The transobturator tape method is a newer surgical technique for the treatment of stress urinary incontinence. Limited data exist related to complications with this approach or the types of mesh products used. We report our experience with vaginal erosions associated with the Mentor ObTape and American Medical Systems Monarc transobturator slings. Beginning in December 2003 selected female patients with anatomic urinary incontinence were prospectively followed after placement of the Mentor ObTape. Beginning in January 2004 we also began using the American Medical Systems Monarc in similar patients. Patients were admitted overnight after surgery, discharged on oral antibiotics, and seen in the clinic at 6 weeks postoperatively. A total of 67 patients have undergone placement of the Mentor ObTape and 9 of those patients (13.4%) have had vaginal extrusions of the sling. Eight patients reported a history of persistent vaginal discharge. One patient presented initially to an outside facility with a left thigh abscess tracking to the left inguinal incision site. Each patient was taken back to the operating room for mesh removal. A total of 56 patients have undergone placement of the AMS Monarc and none have had any vaginal erosions. Our high rate of vaginal extrusion using the ObTape has led us to discontinue the use of this product in our institution. Continued followup of all of these patients will be of critical importance.
Gemini/GMOS Spectroscopy of Globular Clusters in the Merger Remnant Galaxy M85
Ko, Youkyung; Lee, Myung Gyoon; Park, Hong Soo; Sohn, Jubee; Lim, Sungsoon; Hwang, Narae
2018-06-01
M85 is a peculiar S0 galaxy in Virgo and a well-known merger remnant. We present the first spectroscopic study of globular clusters (GCs) in M85. We obtain spectra for 21 GC candidates and the nucleus of M85 using the Gemini Multi-Object Spectrograph on the Gemini North 8.1 m telescope. From their radial velocities, 20 of the GCs are found to be members of M85. We find a strong rotation signal of the M85 GC system with a rotation amplitude of 235 km s‑1. The rotation axis of the GC system has a position angle of about 161°, which is 51.°5 larger than that of the stellar light. The rotation-corrected radial velocity dispersion of the GC system is estimated to be {σ }{{r},{cor}}=160 km s‑1. The rotation parameter {{Ω }}{R}icor}/{σ }{{r},{cor}} of the GC system is derived to be {1.47}-0.48+1.05, which is one of the largest among known early-type galaxies. The ages and metallicities of the GCs, which show the same trend as the results based on Lick indices, are derived from full spectrum fitting (ULySS). About half of the GCs are an intermediate-age population whose mean age is ∼3.7 ± 1.9 Gyr, having a mean [Fe/H] value of ‑0.26. The other half are old and metal-poor. These results suggest that M85 experienced a wet merging event about 4 Gyr ago, forming a significant population of star clusters. The strong rotational feature of the GC system can be explained by an off-center major merging.
Gemini 11 prime crew during water egress training in Gulf of Mexico
1966-01-01
Astronauts Charles Conrad Jr. (left) and Richard F. Gordon Jr. (right), prime crew for Gemini 11 space flight, practice water egress procedures in the Gulf of Mexico. Static Article 5 was used in the training exercise. A Manned Spaceflight Center (MSC) swimmer is in the water assisting in the training.
Geo-Engineering through Internet Informatics (GEMINI); ANNUAL
International Nuclear Information System (INIS)
Watney, W. Lynn; Doveton, John H.; Victorine, John R.; Bohling, Goeffrey C.; Bhattacharya, Saibal; Byers, Alan P.; Carr, Timothy R.; Dubois, Martin K.; Gagnon, Glen; Guy, Willard J.; Look, Kurt; Magnuson, Mike; Moore, Melissa; Olea, Ricardo; Pakalapadi, Jayprakash; Stalder, Ken; Collins, David R.
2002-01-01
GEMINI will resolve reservoir parameters that control well performance; characterize subtle reservoir properties important in understanding and modeling hydrocarbon pore volume and fluid flow; expedite recognition of bypassed, subtle, and complex oil and gas reservoirs at regional and local scale; differentiate commingled reservoirs; build integrated geologic and engineering model based on real-time, iterate solutions to evaluate reservoir management options for improved recovery; provide practical tools to assist the geoscientist, engineer, and petroleum operator in making their tasks more efficient and effective; enable evaluations to be made at different scales, ranging from individual well, through lease, field, to play and region (scalable information infrastructure); and provide training and technology transfer to evaluate capabilities of the client
Performance analysis of signaling protocols on OBS switches
Kirci, Pinar; Zaim, A. Halim
2005-10-01
In this paper, Just-In-Time (JIT), Just-Enough-Time (JET) and Horizon signalling schemes for Optical Burst Switched Networks (OBS) are presented. These signaling schemes run over a core dWDM network and a network architecture based on Optical Burst Switches (OBS) is proposed to support IP, ATM and Burst traffic. In IP and ATM traffic several packets are assembled in a single packet called burst and the burst contention is handled by burst dropping. The burst length distribution in IP traffic is arbitrary between 0 and 1, and is fixed in ATM traffic at 0,5. Burst traffic on the other hand is arbitrary between 1 and 5. The Setup and Setup ack length distributions are arbitrary. We apply the Poisson model with rate λ and Self-Similar model with pareto distribution rate α to identify inter-arrival times in these protocols. We consider a communication between a source client node and a destination client node over an ingress and one or more multiple intermediate switches.We use buffering only in the ingress node. The communication is based on single burst connections in which, the connection is set up just before sending a burst and then closed as soon as the burst is sent. Our analysis accounts for several important parameters, including the burst setup, burst setup ack, keepalive messages and the optical switching protocol. We compare the performance of the three signalling schemes on the network under as burst dropping probability under a range of network scenarios.
Gemini Observations of Galaxies in Rich Early Environments (GOGREEN) I: survey description
Balogh, Michael L.; Gilbank, David G.; Muzzin, Adam; Rudnick, Gregory; Cooper, Michael C.; Lidman, Chris; Biviano, Andrea; Demarco, Ricardo; McGee, Sean L.; Nantais, Julie B.; Noble, Allison; Old, Lyndsay; Wilson, Gillian; Yee, Howard K. C.; Bellhouse, Callum; Cerulo, Pierluigi; Chan, Jeffrey; Pintos-Castro, Irene; Simpson, Rane; van der Burg, Remco F. J.; Zaritsky, Dennis; Ziparo, Felicia; Alonso, María Victoria; Bower, Richard G.; De Lucia, Gabriella; Finoguenov, Alexis; Lambas, Diego Garcia; Muriel, Hernan; Parker, Laura C.; Rettura, Alessandro; Valotto, Carlos; Wetzel, Andrew
2017-10-01
We describe a new Large Program in progress on the Gemini North and South telescopes: Gemini Observations of Galaxies in Rich Early Environments (GOGREEN). This is an imaging and deep spectroscopic survey of 21 galaxy systems at 1 10 in halo mass. The scientific objectives include measuring the role of environment in the evolution of low-mass galaxies, and measuring the dynamics and stellar contents of their host haloes. The targets are selected from the SpARCS, SPT, COSMOS, and SXDS surveys, to be the evolutionary counterparts of today's clusters and groups. The new red-sensitive Hamamatsu detectors on GMOS, coupled with the nod-and-shuffle sky subtraction, allow simultaneous wavelength coverage over λ ˜ 0.6-1.05 μm, and this enables a homogeneous and statistically complete redshift survey of galaxies of all types. The spectroscopic sample targets galaxies with AB magnitudes z΄ < 24.25 and [3.6] μm < 22.5, and is therefore statistically complete for stellar masses M* ≳ 1010.3 M⊙, for all galaxy types and over the entire redshift range. Deep, multiwavelength imaging has been acquired over larger fields for most systems, spanning u through K, in addition to deep IRAC imaging at 3.6 μm. The spectroscopy is ˜50 per cent complete as of semester 17A, and we anticipate a final sample of ˜500 new cluster members. Combined with existing spectroscopy on the brighter galaxies from GCLASS, SPT, and other sources, GOGREEN will be a large legacy cluster and field galaxy sample at this redshift that spectroscopically covers a wide range in stellar mass, halo mass, and clustercentric radius.
IPV Screening and Readiness to Respond to IPV in Ob-Gyn Settings: A Patient-Physician Study
Directory of Open Access Journals (Sweden)
Katherine M. Jones
2018-01-01
Full Text Available Purpose. Intimate partner violence (IPV is a serious, preventable public health concern that largely affects women of reproductive age. Obstetrician-gynecologists (ob-gyns have a unique opportunity to identify and support women experiencing IPV to improve women’s health. Considering recent efforts to increase IPV awareness and intervention, the present study aimed to provide a current evaluation of nationally representative samples to assess ob-gyn readiness to respond to IPV as well as patient IPV-related experiences. Methods. 400 ob-gyns were randomly selected from American College of Obstetricians and Gynecologists’ (ACOG Collaborative Ambulatory Research Network. Each physician was mailed one physician survey and 25 patient surveys. Results. IPV training/education and IPV screening practices were associated with most measures of ob-gyn readiness to respond to IPV. Among respondents, 36.8% endorsed screening all patients at annual exams; however, 36.8% felt they did not have sufficient training to assist individuals in addressing IPV. Workplace encouragement of IPV response was associated with training, screening, detection, preparation/knowledge, response practices, and resources. Thirty-one percent of patients indicated their ob-gyn had asked about possible IPV experiences during their medical visit. Conclusion. Findings highlight specific gaps in ob-gyns’ IPV knowledge and response practices to be further addressed by IPV training.
Alam, Md. Sayem; Mohammed Siddiq, A.; Mandal, Asit Baran
2017-12-01
By the conductivity measurements the effects of fructose and temperature (293-308 K) on the micellization of a cationic gemini surfactant (GS), pentanediyl-1,5-bis(dimethylcetylammonium) bromide in aqueous solutions have been investigated. The critical micelle concentration (CMC) of GS was measured at the different temperatures and fructose concentrations. An increasing trend of the CMC values is with addition of fructose. With increasing temperature, the CMC values are in a similar increasing trend. The CMC of GS by dye solubilization method at room temperature have been determined. The standard Gibbs energy, enthalpy and entropy of GS micellization have been evaluated. From these thermodynamic parameters, it was found that in presence of fructose, the stability of the GS aqueous solutions decreases.
ObsPy - A Python Toolbox for Seismology - and Applications
Krischer, L.; Megies, T.; Barsch, R.; MacCarthy, J.; Lecocq, T.; Koymans, M. R.; Carothers, L.; Eulenfeld, T.; Reyes, C. G.; Falco, N.; Sales de Andrade, E.
2017-12-01
Recent years witnessed the evolution of Python's ecosystem into one of the most powerful and productive scientific environments across disciplines. ObsPy (https://www.obspy.org) is a fully community driven, open-source project dedicated to provide a bridge for seismology into that ecosystem. It is a Python toolbox offering: Read and write support for essentially every commonly used data format in seismology with a unified interface and automatic format detection. This includes waveform data (MiniSEED, SAC, SEG-Y, Reftek, …) as well as station (SEED, StationXML, SC3ML, …) and event meta information (QuakeML, ZMAP, …). Integrated access to the largest data centers, web services, and real-time data streams (FDSNWS, ArcLink, SeedLink, ...). A powerful signal processing toolbox tuned to the specific needs of seismologists. Utility functionality like travel time calculations with the TauP method, geodetic functions, and data visualizations. ObsPy has been in constant development for more than eight years and is developed and used by scientists around the world with successful applications in all branches of seismology. Additionally it nowadays serves as the foundation for a large number of more specialized packages. Newest features include: Full interoperability of SEED and StationXML/Inventory objects Access to the Nominal Response Library (NRL) for easy and quick creation of station metadata from scratch Support for the IRIS Federated Catalog Service Improved performance of the EarthWorm client Several improvements to MiniSEED read/write module Improved plotting capabilities for PPSD (spectrograms, PSD of discrete frequencies over time, ..) Support for.. Reading ArcLink Inventory XML Reading Reftek data format Writing SeisComp3 ML (SC3ML) Writing StationTXT format This presentation will give a short overview of the capabilities of ObsPy and point out several representative or new use cases and show-case some projects that are based on ObsPy, e.g.: seismo
ObsPy: A Python toolbox for seismology - Sustainability, New Features, and Applications
Krischer, L.; Megies, T.; Sales de Andrade, E.; Barsch, R.; MacCarthy, J.
2016-12-01
ObsPy (https://www.obspy.org) is a community-driven, open-source project dedicated to offer a bridge for seismology into the scientific Python ecosystem. Amongst other things, it provides Read and write support for essentially every commonly used data format in seismology with a unified interface. This includes waveform data as well as station and event meta information. A signal processing toolbox tuned to the specific needs of seismologists. Integrated access to the largest data centers, web services, and databases. Wrappers around third party codes like libmseed and evalresp. Using ObsPy enables users to take advantage of the vast scientific ecosystem that has developed around Python. In contrast to many other programming languages and tools, Python is simple enough to enable an exploratory and interactive coding style desired by many scientists. At the same time it is a full-fledged programming language usable by software engineers to build complex and large programs. This combination makes it very suitable for use in seismology where research code often must be translated to stable and production ready environments, especially in the age of big data. ObsPy has seen constant development for more than six years and enjoys a large rate of adoption in the seismological community with thousands of users. Successful applications include time-dependent and rotational seismology, big data processing, event relocations, and synthetic studies about attenuation kernels and full-waveform inversions to name a few examples. Additionally it sparked the development of several more specialized packages slowly building a modern seismological ecosystem around it. We will present a short overview of the capabilities of ObsPy and point out several representative use cases and more specialized software built around ObsPy. Additionally we will discuss new and upcoming features, as well as the sustainability of open-source scientific software.
Kim, Bieong-Kil; Doh, Kyung-Oh; Bae, Yun-Ui; Seu, Young-Bae
2011-01-01
Amongst a number of potential nonviral vectors, cationic liposomes have been actively researched, with both gemini surfactants and bola amphiphiles reported as being in possession of good structures in terms of cell viability and in vitro transfection. In this study, a cholesterol-based diquaternary ammonium gemini surfactant (Chol-GS) was synthesized and assessed as a novel nonviral gene vector. Chol-GS was synthesized from cholesterol by way of four reaction steps. The optimal efficiency was found to be at a weight ratio of 1:4 of lipid:DOPE (1,2-dioleoyl-L-alpha- glycero-3-phosphatidylethanolamine), and at a ratio of between 10:1~15:1 of liposome:DNA. The transfection efficiency was compared with commercial liposomes and with Lipofectamine, 1,2-dimyristyloxypropyl-3-dimethylhydroxyethylammonium bromide (DMRIE-C), and N-[1-(2,3-dioleoyloxy)propyl]- N,N,N-trimethylammonium chloride (DOTAP). The results indicate that the efficiency of Chol-GS is greater than that of all the tested commercial liposomes in COS7 and Huh7 cells, and higher than DOTAP and Lipofectamine in A549 cells. Confirmation of these findings was observed through the use of green fluorescent protein expression. Chol-GS exhibited a moderate level of cytotoxicity, at optimum concentrations for efficient transfection, indicating cell viability. Hence, the newly synthesized Chol-GS liposome has the potential of being an excellent nonviral vector for gene delivery.
A Search for Pulsar Companions to OB Runaway Stars
Kaspi, V. M.
1995-01-01
We have searched for radio pulsar companions to 40 nearby OB runaway stars. Observations were made at 474 and 770 MHz with the NRAO 140 ft telescope. The survey was sensitive to long- period pulsars with flux densities of 1 mJy or more. One previously unknown pulsar was discovered, PSRJ2044+4614, while observing towards target O star BD+45,3260. Follow-up timing observations of the pulsar measured its position to high precision, revealing a 9' separation between the pulsar and the target star, unequivocally indicating they are not associated.
Hayashimoto, N.; Hoshiba, M.
2013-12-01
1. Introduction Ocean bottom seismograph (OBS) is useful for making Earthquake Early Warning (EEW) earlier. However, careful handling of these data is required because the installation environment of OBSs may be different from that of land stations. Site amplification factor is an important factor to estimate the magnitudes, and to predict ground motions (e.g. seismic intensity) in EEW. In this presentation, we discuss the site amplification factor of OBS in the Tonankai area of Japan from these two points of view. 2. Examination of magnitude correction of OBS In the EEW of JMA, the magnitude is estimated from the maximum amplitude of the displacement in real time. To provide the fast magnitude estimation, the magnitude-estimation algorithm switches from the P to S formula (Meew(P) to Meew(S)) depending on the expected S-phase arrival (Kamigaichi,2004). To estimate the magnitude correction for OBS, we determine Meew(P) and Meew(S) at OBSs and compare them with JMA magnitude (Mjma). We find Meew(S) at OBS is generally larger than Mjma by approximately 0.6. The slight differences of spatial distribution of Meew(S) amplification are also found among other OBSs. From the numerical simulations, Nakamura et al. (MGR,submitted) pointed out that the oceanic layer and the low-velocity sediment layers causes the large amplifications in low frequency range (0.1-0.2Hz) at OBSs. We conclude that the site effect of OBS characterized by such a low velocity sediment layers causes those amplification of Magnitude. 3. The frequency-dependent site factor of OBS estimated from Fourier spectrum ratio and their application for prediction of seismic intensity of land station We compare Fourier spectra of S-wave portion on OBSs with those on adjacent land stations. Station pair whose distance is smaller than 50 km is analyzed, and we obtain that spectral ratio of land station (MIEH05 of the KiK-net/NIED) to OBS (KMA01 of the DONET/JAMSTEC) is 5-20 for frequencies 10-20Hz for both
Bosma, T.; Janssen, D.B.
1998-01-01
Chlorinated propanes are important pollutants that may show persistent behaviour in the environment. The biotransformation of 1-chloropropane, 1,2-dichloropropane, 1,3-dichloropropane and 1,2,3-trichloropropane was studied using resting cell suspensions of Methylosinus trichosporium OB3b expressing soluble methane monooxygenase. The transformation followed first-order kinetics. The rate constants were in the order 1-chloropropane > 1,3-dichloropropane > 1,2-dichloropropane > 1,2,3-trichloropr...
Directory of Open Access Journals (Sweden)
Velimir Gayevskiy
Full Text Available Bayesian inference methods are extensively used to detect the presence of population structure given genetic data. The primary output of software implementing these methods are ancestry profiles of sampled individuals. While these profiles robustly partition the data into subgroups, currently there is no objective method to determine whether the fixed factor of interest (e.g. geographic origin correlates with inferred subgroups or not, and if so, which populations are driving this correlation. We present ObStruct, a novel tool to objectively analyse the nature of structure revealed in Bayesian ancestry profiles using established statistical methods. ObStruct evaluates the extent of structural similarity between sampled and inferred populations, tests the significance of population differentiation, provides information on the contribution of sampled and inferred populations to the observed structure and crucially determines whether the predetermined factor of interest correlates with inferred population structure. Analyses of simulated and experimental data highlight ObStruct's ability to objectively assess the nature of structure in populations. We show the method is capable of capturing an increase in the level of structure with increasing time since divergence between simulated populations. Further, we applied the method to a highly structured dataset of 1,484 humans from seven continents and a less structured dataset of 179 Saccharomyces cerevisiae from three regions in New Zealand. Our results show that ObStruct provides an objective metric to classify the degree, drivers and significance of inferred structure, as well as providing novel insights into the relationships between sampled populations, and adds a final step to the pipeline for population structure analyses.
An ALMA continuum survey of circumstellar disks in the upper Scorpius OB association
Energy Technology Data Exchange (ETDEWEB)
Carpenter, John M.; Ricci, Luca; Isella, Andrea [Department of Astronomy, California Institute of Technology, MC 249-17, Pasadena, CA 91125 (United States)
2014-05-20
We present ALMA 880 μm continuum observations of 20 K- and M-type stars in the Upper Scorpius OB association (Upper Sco) that are surrounded by protoplanetary disks. These data are used to measure the dust content in disks around low-mass stars (0.1-1.6 M {sub ☉}) at a stellar age of 5-11 Myr. Thirteen sources were detected in the 880 μm dust continuum at ≥3σ with inferred dust masses between 0.3 and 52 M {sub ⊕}. The dust masses tend to be higher around the more massive stars, but the significance is marginal in that the probability of no correlation is p ≈ 0.03. The evolution in the dust content in disks was assessed by comparing the Upper Sco observations with published continuum measurements of disks around ∼1-2 Myr stars in the Class II stage in the Taurus molecular cloud. While the dust masses in the Upper Sco disks are on average lower than in Taurus, any difference in the dust mass distributions is significant at less than 3σ. For stellar masses between 0.49 M {sub ☉} and 1.6 M {sub ☉}, the mean dust mass in disks is lower in Upper Sco relative to Taurus by Δlog M {sub dust} = 0.44 ± 0.26.
Elevated endothelin-1 (ET-1) levels may contribute to hypoadiponectinemia in childhood obesity.
Nacci, Carmela; Leo, Valentina; De Benedictis, Leonarda; Carratù, Maria Rosaria; Bartolomeo, Nicola; Altomare, Maria; Giordano, Paola; Faienza, Maria Felicia; Montagnani, Monica
2013-04-01
Pediatric obesity is associated with endothelial dysfunction and hypoadiponectinemia, but the relationship between these two conditions remains to be fully clarified. Whether enhanced release of endothelin-1 (ET-1) may directly impair adiponectin (Ad) production in obese children is not known. The aim of the study was to explore whether and how high circulating levels of ET-1 may contribute to impair Ad production, release, and vascular activity. Sixty children were included into obese (Ob; n = 30), overweight (OW; n = 11), and lean (n = 19) groups. Total and high-molecular-weight Ad, ET-1, vascular cell adhesion molecule-1, and von Willebrand factor levels were measured in serum samples. Adipocytes were stimulated with exogenous ET-1 or with sera from lean, OW, and Ob, and Ad production and release measured in the absence or in the presence of ETA (BQ-123) and ETB (BQ-788) receptor blockers, p42/44 MAPK inhibitor PD-98059, or c-Jun NH2-terminal protein kinase inhibitor SP-600125. Vasodilation to Ad was evaluated in rat isolated arteries in the absence or in the presence of BQ-123/788. Total and high-molecular-weight Ad was significantly decreased and ET-1 levels significantly increased in OW (P ET-1. Exposure of adipocytes to exogenous ET-1 or serum from OW and Ob significantly decreased Ad mRNA and protein levels (P ET-1 on Ad was reverted by BQ-123/788 or PD-98059 but not SP-600125. Ad-mediated vasodilation was further increased in arteries pretreated with BQ-123/788. ET-1-mediated inhibition of Ad synthesis via p42/44 MAPK signaling may provide a possible explanation for hypoadiponectinemia in pediatric obesity and contribute to the development of cardiovascular complications.
Determining OBS Instrument Orientations: A Comparison of Algorithms
Doran, A. K.; Laske, G.
2015-12-01
The alignment of the orientation of the horizontal seismometer components with the geographical coordinate system is critical for a wide variety of seismic analyses, but the traditional deployment method of ocean bottom seismometers (OBS) precludes knowledge of this parameter. Current techniques for determining the orientation predominantly rely on body and surface wave data recorded from teleseismic events with sufficiently large magnitudes. Both wave types experience lateral refraction between the source and receiver as a result of heterogeneity and anisotropy, and therefore the arrival angle of any one phase can significantly deviate from the great circle minor arc. We systematically compare the results and uncertainties obtained through current determination methods, as well as describe a new algorithm that uses body wave, surface wave, and differential pressure gauge data (where available) to invert for horizontal orientation. To start with, our method is based on the easily transportable computer code of Stachnik et al. (2012) that is publicly available through IRIS. A major addition is that we utilize updated global dispersion maps to account for lateral refraction, as was done by Laske (1995). We also make measurements in a wide range of frequencies, and analyze surface wave trains of repeat orbits. Our method has the advantage of requiring fewer total events to achieve high precision estimates, which is beneficial for OBS deployments that can be as short as weeks. Although the program is designed for the purpose of use with OBS instruments, it also works with standard land installations. We intend to provide the community with a program that is easy to use, requires minimal user input, and is optimized to work with data cataloged at the IRIS DMC.
Development of the TeamOBS-PPH - targeting clinical performance in postpartum hemorrhage.
Brogaard, Lise; Hvidman, Lone; Hinshaw, Kim; Kierkegaard, Ole; Manser, Tanja; Musaeus, Peter; Arafeh, Julie; Daniels, Kay I; Judy, Amy E; Uldbjerg, Niels
2018-06-01
This study aimed to develop a valid and reliable TeamOBS-PPH tool for assessing clinical performance in the management of postpartum hemorrhage (PPH). The tool was evaluated using video-recordings of teams managing PPH in both real-life and simulated settings. A Delphi panel consisting of 12 obstetricians from the UK, Norway, Sweden, Iceland, and Denmark achieved consensus on (i) the elements to include in the assessment tool, (ii) the weighting of each element, and (iii) the final tool. The validity and reliability were evaluated according to Cook and Beckman. (Level 1) Four raters scored four video-recordings of in situ simulations of PPH. (Level 2) Two raters scored 85 video-recordings of real-life teams managing patients with PPH ≥1000 mL in two Danish hospitals. (Level 3) Two raters scored 15 video-recordings of in situ simulations of PPH from a US hospital. The tool was designed with scores from 0 to 100. (Level 1) Teams of novices had a median score of 54 (95% CI 48-60), whereas experienced teams had a median score of 75 (95% CI 71-79; p < 0.001). (Level 2) The intra-rater [intra-class correlation (ICC) = 0.96] and inter-rater (ICC = 0.83) agreements for real-life PPH were strong. The tool was applicable in all cases: atony, retained placenta, and lacerations. (Level 3) The tool was easily adapted to in situ simulation settings in the USA (ICC = 0.86). The TeamOBS-PPH tool appears to be valid and reliable for assessing clinical performance in real-life and simulated settings. The tool will be shared as the free TeamOBS App. © 2018 Nordic Federation of Societies of Obstetrics and Gynecology.
A CANDIDATE FOR THE MOST LUMINOUS OB ASSOCIATION IN THE GALAXY
International Nuclear Information System (INIS)
Rahman, Mubdi; Matzner, Christopher; Moon, Dae-Sik
2011-01-01
The Milky Way harbors giant H II regions, which may be powered by star complexes more luminous than any known Galactic OB association. Being across the disk of the Galaxy, however, these brightest associations are severely extinguished and confused. We present a search for one such association toward the most luminous H II region in the recent catalog by Murray and Rahman, which, at ∼9.7 kpc, has a recombination rate of ∼7 x 10 51 s -1 . Prior searches have identified only small-scale clustering around the rim of this shell-like region, but the primary association has not previously been identified. We apply a near-infrared color selection and find an overdensity of point sources toward its southern central part. The colors and magnitudes of these excess sources are consistent with O- and early B-type stars at extinctions 0.96 K < 1.2, and they are sufficiently numerous (406 ± 102 after subtraction of field sources) to ionize the surrounding H II region, making this a candidate for the most luminous OB association in the Galaxy. We reject an alternate theory, in which the apparent excess is caused by localized extinction, as inconsistent with source demographics.
Thomas, B. W. M.; Mead, R. N.; Mountjoy, G.
2006-05-01
Aluminate glasses are difficult to prepare as they do not contain traditional network formers, but they are promising materials for optical applications. The atomic structure of calcium aluminate glasses has been studied using several experimental techniques. The current study uses molecular dynamics to obtain a model of a (CaO)0.625(Al2O3)0.375 glass close to the eutectic. The glass consists of a tetrahedral alumina network with average network polymerization \\langle Q^{n}\\rangle of n = 3.3. Ca acts as a network modifier with average coordination of 6.2. Ca is typically coordinated to three bridging oxygens (Ob) and three non-bridging oxygens (Onb), with Ca-Onb bonds noticeably shorter than the Ca-Ob bonds. A new method of analysing modifier cation coordination is presented, which specifically shows the distribution of Ca coordination NCaO in terms of combinations of NCaOb and NCaOnb. Ob is most often coordinated to two Al plus two Ca, and Onb is most often coordinated to one Al plus three Ca. The typical coordinations of Ca, Ob, and Onb all have a noticeable similarity to those for the 5CaO·3Al2O3 crystal. The Ca-Ca distribution shows a clear similarity to that for (CaO)0.5(SiO2)0.5 glass, and this is attributed to the equal atomic number densities of Ca in these glasses.
Ultra-deep GEMINI Near-infrared Observations of the Bulge Globular Cluster NGC 6624.
Saracino, S.; Dalessandro, E.; Ferraro, F. R.; Geisler, D.; Mauro, F.; Lanzoni, B.; Origlia, L.; Miocchi, P.; Cohen, R. E.; Villanova, S.; Moni Bidin, C.
2016-11-01
We used ultra-deep J and K s images secured with the near-infrared (NIR) GSAOI camera assisted by the multi-conjugate adaptive optics system GeMS at the GEMINI South Telescope in Chile, to obtain a (K s , J - K s ) color-magnitude diagram (CMD) for the bulge globular cluster NGC 6624. We obtained the deepest and most accurate NIR CMD from the ground for this cluster, by reaching K s ˜ 21.5, approximately 8 mag below the horizontal branch level. The entire extension of the Main Sequence (MS) is nicely sampled and at K s ˜ 20 we detected the so-called MS “knee” in a purely NIR CMD. By taking advantage of the exquisite quality of the data, we estimated the absolute age of NGC 6624 (t age = 12.0 ± 0.5 Gyr), which turns out to be in good agreement with previous studies in the literature. We also analyzed the luminosity and mass functions of MS stars down to M ˜ 0.45 M⊙, finding evidence of a significant increase of low-mass stars at increasing distances from the cluster center. This is a clear signature of mass segregation, confirming that NGC 6624 is in an advanced stage of dynamical evolution. Based on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil) and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina). Based on observations gathered with ESO-VISTA telescope (program ID 179.B-2002).
Analysis of interstellar extinction towards the hypergiant Cyg OB2 No. 12
Maryeva, O. V.; Chentsov, E. L.; Goranskij, V. P.; Karpov, S. V.
The Cyg OB2 stellar association hosts an entire zoo of unique objects, and among them -- an enigmatic star Cyg OB2 No. 12 (Schulte 12, MT 304). MT 304 is enigmatic not only due to its highest luminosity (according to various estimates, it is one of the brightest stars in the Galaxy), but also because its reddening is anomalously large, greater than the mean reddening in the association. To explain the nature of anomalous reddening (AV≃ 10 mag) of MT 304, we carried out spectrophotometric observations of 25 stars located in its vicinity. We mapped interstellar extinction within the 2.5 arcmin radius and found it to increase towards MT 304. According to our results, the two most reddened stars in the association after MT 304 are J203240.35+411420.1 and J203239.90+411436.2, both located about 15 arcsec from it. Interstellar extinction AV towards these stars is about 9 mag. Our results favor the hypothesis of the circumstellar nature of reddening excess. In the second part of the paper we present the results of our modeling of MT 282 (B1 IV) and MT 343 (B1 V), which belong to the older population of the association and have ages greater than 10 Myr.
International Nuclear Information System (INIS)
Gilvary, E.P.
1988-01-01
Hindlimb skeletal muscle weights and binding of L-tri-iodothyronine (T 3 ) to isolated nuclei of this tissue were investigated in obese (ob/ob) mice and their lean littermates. Maximal binding capacities (Bmax) and dissociation constants (Kd) were determined by incubating isolated muscle nuclei with increasing conc. of 125 I-T 3 (0.4 nM to 4nM). At 12 wks. of age, although weighing substantially more, obese mice had only 55% as much muscle mass as their lean littermates. There was no phenotype effect observed for Kd, however, Bmax was significantly less for the obese mice. In a second experiment, a 16-wk. feeding study was conducted with 4 groups of mice according to the following design: lean mice fed rodent chow; obese mice fed rodent chow; obese mice, n-6 fatty acid (FA)-rich diet; and obese mice, n-3FA-rich diet. Erythrocyte T 3 receptor binding capacities were measured by incubating red cell ghosts from mice of these 4 groups with 125 I-T 3 . As with skeletal muscle nuclei there were no phenotype effects observed for Kd between any two groups. In contrasts obese mice fed chow and n-6FA-rich diets both exhibited lower Bmax than their lean counterparts, while no significant difference was observed between the latter group and the obese mice fed an n-3FA-rich diet. Bmax values of the n-6 group were also decreased compared to the n-3 group
Optical performance of the Gemini carbon dioxide laser fusion system
International Nuclear Information System (INIS)
Viswanathan, V.K.; Hayden, J.J.; Liberman, I.
1979-01-01
The performance of the Gemini two beam carbon dioxide laser fusion system was recently upgraded by installation of optical components with improved quality in the final amplifier. A theoretical analysis was conducted in conjunction with measurements of the new performance. The analysis and experimental procedures, and results obtained are reported and compared. Good agreement was found which was within the uncertainties of the analysis and the inaccuracies of the experiments. The focal spot Strehl ratio was between 0.24 and 0.3 for both beams
International Nuclear Information System (INIS)
Wright, N. J.; Drake, J. J.; Drew, J. E.; Vink, J. S.
2010-01-01
Cygnus OB2 is the nearest example of a massive star-forming region (SFR), containing over 50 O-type stars and hundreds of B-type stars. We have analyzed the properties of young stars in two fields in Cyg OB2 using the recently published deep catalog of Chandra X-ray point sources with complementary optical and near-IR photometry. Our sample is complete to ∼1 M sun (excluding A- and B-type stars that do not emit X-rays), making this the deepest study of the stellar properties and star formation history in Cyg OB2 to date. From Siess et al. isochrone fits to the near-IR color-magnitude diagram, we derive ages of 3.5 +0.75 -1.0 and 5.25 +1.5 -1.0 Myr for sources in the two fields, both with considerable spreads around the pre-main-sequence isochrones. The presence of a stellar population somewhat older than the present-day O-type stars, also fits in with the low fraction of sources with inner circumstellar disks (as traced by the K-band excess) that we find to be very low, but appropriate for a population of age ∼5 Myr. We also find that the region lacks a population of highly embedded sources that is often observed in young SFRs, suggesting star formation in the vicinity has declined. We measure the stellar mass functions (MFs) in this limit and find a power-law slope of Γ = -1.09 ± 0.13, in good agreement with the global mean value estimated by Kroupa. A steepening of the slope at higher masses is observed and suggested as due to the presence of the previous generation of stars that have lost their most massive members. Finally, combining our MF and an estimate of the radial density profile of the association suggests a total mass of Cyg OB2 of ∼3 x 10 4 M sun , similar to that of many of our Galaxy's most massive SFRs.
VizieR Online Data Catalog: GMOS spectroscopic obs. of SNR candidates in M83 (Winkler+, 2017)
Winkler, P. F.; Blair, W. P.; Long, K. S.
2017-11-01
We used the GMOS on the 8.2m Gemini-South telescope to obtain all the spectra reported here. Most were obtained in a classically scheduled observing run on 2011 April 7-9 (UT); masks 1-7. We later obtained spectra for two additional masks (which we refer to as masks 8 and 9 for simplicity) in a queue-scheduled program (GS-2015A-Q-90) during the 2015A semester. (6 data files).
Association of plutonium with sediments from the Ob and Yenisey Rivers and Estuaries
International Nuclear Information System (INIS)
Skipperud, Lindis; Brown, Justin; Fifield, L. Keith; Oughton, Deborah H.; Salbu, Brit
2009-01-01
The present study applied sequential extraction techniques to investigate the binding and mobility of plutonium (Pu) in sediments from the rivers and estuaries of the Ob and Yenisey. As a study site, the Ob and Yenisey are particularly interesting as both rivers have weapons-grade Pu sources in their catchment areas, including the Russian Pu production and reprocessing plants at Mayak, Tomsk-7 and Krashnoyarsk, and the Semipalantinsk nuclear weapons testing site in Kazakhstan. Plutonium activity and 240 Pu/ 239 Pu ratios were determined using accelerator mass spectrometry (AMS). Sequential extractions showed that between 47 and 80% of the Pu in Yenisey River sediments and 35-53% of the Pu in soils around the Techa River are mobilized with weak oxidising agents, which can indicate that Pu is bound to organic material. In contrast, Pu in Ob and Yenisey Estuarine sediments was more strongly bound, with 60-100% being found in the HNO 3 -extractable fraction. This change in speciation could reflect either that Pu bound to organic material in the Techa and Yenisey River sediments becomes more fixed to the sediments with time, or that organic-bound Pu is mobilized and released to the water when the sediments encounter the more saline water of the Ob and Yenisey estuaries. In general, 240 Pu/ 239 Pu ratios were relatively consistent between different extraction fractions, although, in whole sediments, an increase in ratio was observed with distance from the source. This reflects the increased influence of weapon fallout from catchment runoff within the river systems, as compared to the weapons-grade sources close to the production and reprocessing plants. Knowledge of Pu speciation in the Ob and Yenisey Rivers, and the processes controlling its behaviour in estuarine systems, can improve predictions of its transfer and subsequent environmental impact to Arctic Seas
A Novel Congestion Detection Scheme in TCP Over OBS Networks
Shihada, Basem; Ho, Pin-Han; Zhang, Qiong
2009-01-01
This paper introduces a novel congestion detection scheme for high-bandwidth TCP flows over optical burst switching (OBS) networks, called statistical additive increase multiplicative decrease (SAIMD). SAIMD maintains and analyzes a number
The performance characteristics of the Philips Gemini PET/CT scanner
International Nuclear Information System (INIS)
O'Keefe, G.J.; Papenfuss, A.T.; Scott, A.M.; Rowe, C.C.
2002-01-01
Full text: The Department of Nuclear Medicine, Centre for PET at the ARMC is commissioning a next generation PET/CT scanner based on gadolinium silicic dioxide (GSO) crystal technology to replace the BGO crystal PET scanner that has been in operation since 1992. The Gemini PET/CT scanner is a fully 3D PET system which offers significantly increased resolution and sensitivity allowing wholebody scans in under 30 minutes. Until the late 90's, PET scanners were largely used with septa for neurological imaging and the performance characteristics of PET scanners were presented according to the NEMA-NU2-94 standard which specifically addresses the performance of PET scanners for neurological applications. PET is now largely used without septa for oncological imaging and as such, the NEMA-NU2-94 standard does not adequately reflect performance. The NEMA-NU2-2001 standard was designed to incorporate the effects of out-of-FOV activity and its contribution to performance by virtue of the increased scatter and randoms that result when performing wholebody scans without the use of septa. As part of the acceptance program of the Allegro/Gemini systems, the NEMA-NU2-2001 standard will be used to characterise the spatial resolution, sensitivity, randoms and scatter contributions and the Noise Equivalent Count rate (NECr). These results will be presented and compared with the ECAT 951/31R performance characteristics. Copyright (2002) The Australian and New Zealand Society of Nuclear Medicine Inc
Srinivas, Banoth; Rani, Ganapathiwar Swarupa; Kumar, Bhukya Kiran; Chandrasekhar, Banoth; Krishna, Kommalapati Vamsi; Devi, Tangutur Anjana; Bhima, Bhukya
2017-12-01
The purpose of this study is to evaluate the probiotic characteristics of 15 yeast strains isolated from nectar of toddy palm. Initially, the collected samples were inoculated on yeast extract peptone dextrose agar plates and the colonies so obtained were culturally and morphologically characterized. Commercial probiotic yeast, Saccharomyces boulardii served as the control in these experiments. Of the 15 yeast strains, the isolates that were resistant to antibiotics and worked synergistically with other cultures were considered for further evaluation. Selected isolates were evaluated in vitro for tolerance to simulated gastrointestinal conditions such as temperature, pH, bile and gastric juice. Further the yeast isolates were evaluated for their pathogenicity and adherence to intestinal epithelial cells. The 2 yeast isolates with efficient probiotic properties were finally characterized by sequencing their 5.8 S rRNA and partial sequences of internal transcribed spacer 1 and 2. The sequences were BLAST searched in the National Center for Biotechnology Information, nucleic acid database for sequence similarity of organisms and phylogenetic evolutionary analysis was carried out. Based on maximum similarity of basic local alignment search tool results, organisms were characterized as Pichia kudriavzevii OBS1 (100%) and Saccharomyces cerevisiae OBS2 (96%) and sequences were finally deposited in the GenBank data library. Among these two isolates, S. cerevisiae OBS2 displayed slight/moderate antioxidant and anticancer property. Hence, strain OBS2 can be utilized and explored as a potential probiotic for therapeutic applications.
ESTIMATION OF BURSTS LENGTH AND DESIGN OF A FIBER DELAY LINE BASED OBS ROUTER
Directory of Open Access Journals (Sweden)
RICHA AWASTHI
2017-03-01
Full Text Available The demand for higher bandwidth is increasing day by day and this ever growing demand cannot be catered to with current electronic technology. Thus new communication technology like optical communication needs to be used. In the similar context OBS (optical burst switching is considered as next generation data transfer technology. In OBS information is transmitted in forms of optical bursts of variable lengths. However, contention among the bursts is a major problem in OBS system, and for contention resolution defection routing is mostly preferred. However, deflection routing increases delay. In this paper, it is shown that the arrival of very large bursts is rare event, and for moderate burst length the buffering of contending burst can provide very effective solution. However, in case of arrival of large bursts deflection can be used.
ObsPy – What can it do for data centers and observatories?
Directory of Open Access Journals (Sweden)
Joachim Wassermann
2011-04-01
Full Text Available Data acquisition by seismic centers relies on real-time systems, like SeisComP3, Antelope and Earthworm. However, these are complex systems that are designed for fast and precisely defined standard real-time analyses. Therefore, it is not a simple task to access or modify internal routines, and to integrate them into custom-processing workflows or to perform in-depth data analyses. Often a library is necessary that provides convenient access to data and allows easy control over all of the operations that are to be performed on the data. ObsPy is such a library, which is designed to access and process seismological waveform data and metadata. We use short and simple examples here to demonstrate how effective it is to use Python for seismological data analysis. Then, we illustrate the general capabilities of ObsPy, and highlight some of its specific aspects that are relevant for seismological data centers and observatories, through presentation of real-world examples. Finally, we demonstrate how the ObsPy library can be used to develop custom graphical user interface applications.
Directory of Open Access Journals (Sweden)
Danxia Yu
Full Text Available BACKGROUND: Little is known regarding the associations between high-molecular-weight (HMW- adiponectin, leptin and soluble leptin receptor (sOB-R and metabolic syndrome (MetS in Chinese. Also few studies elucidate the effects of inflammation and body fat mass on the relations. METHODS: Plasma HMW-adiponectin, leptin and sOB-R were measured among 1055 Chinese men and women (35∼54 yrs. Whole body and trunk fat mass were determined by Dual-energy X-ray absorptiometry. MetS was defined by the updated NCEP/ATPIII criterion for Asian-Americans. RESULTS: HMW-adiponectin was inversely associated with MetS in multivariate model including fat mass index (FMI, inflammatory markers, leptin and sOB-R (OR in the highest quartile= 0.30, 95%CI 0.18∼0.50, P<.0001. Plasma sOB-R was also inversely associated with MetS independent of body fatness and inflammatory markers, whereas the association was somewhat attenuated after adjusting HMW-adiponectin (OR for the highest quartile = 0.78, 95%CI 0.47∼1.32, P = 0.15. In contrast, leptin was associated with increased odds of MetS independent of inflammatory markers, HMW-adiponectin, and sOB-R (OR for the highest quartile= 2.64, 95%CI 1.35∼5.18, P = 0.006, although further adjustment for FMI abolished this association. CONCLUSIONS: HMW-adiponectin exhibited strong inverse associations with MetS independent of body composition, inflammation, leptin and sOB-R; while the associations of leptin and sOB-R were largely explained by fat mass or HMW-adiponectin, respectively.
Structure-function analysis of the OB and latch domains of chlorella virus DNA ligase.
Samai, Poulami; Shuman, Stewart
2011-06-24
Chlorella virus DNA ligase (ChVLig) is a minimized eukaryal ATP-dependent DNA sealing enzyme with an intrinsic nick-sensing function. ChVLig consists of three structural domains, nucleotidyltransferase (NTase), OB-fold, and latch, that envelop the nicked DNA as a C-shaped protein clamp. The OB domain engages the DNA minor groove on the face of the duplex behind the nick, and it makes contacts to amino acids in the NTase domain surrounding the ligase active site. The latch module occupies the DNA major groove flanking the nick. Residues at the tip of the latch contact the NTase domain to close the ligase clamp. Here we performed a structure-guided mutational analysis of the OB and latch domains. Alanine scanning defined seven individual amino acids as essential in vivo (Lys-274, Arg-285, Phe-286, and Val-288 in the OB domain; Asn-214, Phe-215, and Tyr-217 in the latch), after which structure-activity relations were clarified by conservative substitutions. Biochemical tests of the composite nick sealing reaction and of each of the three chemical steps of the ligation pathway highlighted the importance of Arg-285 and Phe-286 in the catalysis of the DNA adenylylation and phosphodiester synthesis reactions. Phe-286 interacts with the nick 5'-phosphate nucleotide and the 3'-OH base pair and distorts the DNA helical conformation at the nick. Arg-285 is a key component of the OB-NTase interface, where it forms a salt bridge to the essential Asp-29 side chain, which is imputed to coordinate divalent metal catalysts during the nick sealing steps.
Structure-Function Analysis of the OB and Latch Domains of Chlorella Virus DNA Ligase*
Samai, Poulami; Shuman, Stewart
2011-01-01
Chlorella virus DNA ligase (ChVLig) is a minimized eukaryal ATP-dependent DNA sealing enzyme with an intrinsic nick-sensing function. ChVLig consists of three structural domains, nucleotidyltransferase (NTase), OB-fold, and latch, that envelop the nicked DNA as a C-shaped protein clamp. The OB domain engages the DNA minor groove on the face of the duplex behind the nick, and it makes contacts to amino acids in the NTase domain surrounding the ligase active site. The latch module occupies the DNA major groove flanking the nick. Residues at the tip of the latch contact the NTase domain to close the ligase clamp. Here we performed a structure-guided mutational analysis of the OB and latch domains. Alanine scanning defined seven individual amino acids as essential in vivo (Lys-274, Arg-285, Phe-286, and Val-288 in the OB domain; Asn-214, Phe-215, and Tyr-217 in the latch), after which structure-activity relations were clarified by conservative substitutions. Biochemical tests of the composite nick sealing reaction and of each of the three chemical steps of the ligation pathway highlighted the importance of Arg-285 and Phe-286 in the catalysis of the DNA adenylylation and phosphodiester synthesis reactions. Phe-286 interacts with the nick 5′-phosphate nucleotide and the 3′-OH base pair and distorts the DNA helical conformation at the nick. Arg-285 is a key component of the OB-NTase interface, where it forms a salt bridge to the essential Asp-29 side chain, which is imputed to coordinate divalent metal catalysts during the nick sealing steps. PMID:21527793
Inter-Division IV/V WG on Active OB Stars
Owocki, S.; Aerts, C.; Fabregat, J.; Gies, D.; Henrichs, H.F.; McDavid, D.; Porter, J.; Rivinius, T.; Peters, G.; Stefl, S.
2007-01-01
Our group studies active early-type (OB) stars, with historical focus on classical Be stars, but extending in recent years to include Slowly Pulsating B-stars (SPB), Beta-Cephei stars, the strongly magnetic Bp stars, Luminous Blue Vairiable (LBV) stars, and B[e] stars. An overall goal is to
Expression of Leptin (Ob Gene Product) in Reproductive System ...
African Journals Online (AJOL)
Purpose: To determine serum leptin and its ob mRNA expression both in the PCOS and non-PCOS ovary, endometrium and adipose tissue in normal or polycystic ovary syndrome (PCOS) in South Indian population. PCOS (Polycystic Ovary Syndrome) and non-PCOS subject's endometrium, ovary and adipose tissue were ...
Fielden, Matthew; Perrin, C.; Kremer, Andreas; Bergsma, M.; Stuart, M.C.A.; Camilleri, P.; Engberts, J.B.F.N.
2001-01-01
Novel reduced sugar gemini amphiphiles linked through their tertiary amino head groups via alkyl spacers of 4 or 6 carbons, and with varying (unsaturated) alkyl tail lengths of 12-18, have been synthesized and tested for transfection in vitro in an adherent Chinese hamster ovary cell line (CHO-K1).
Discovery of Multiseeded Multimode Formation of Embedded Clusters in the Rosette Molecular Complex
Li, Jin Zeng; Smith, Michael D.
2005-02-01
An investigation based on data from the spatially complete Two Micron All Sky Survey (2MASS) reveals that a remarkable burst of clustered star formation is taking place throughout the southeast quadrant of the Rosette Molecular Cloud. Compact clusters are forming in a multiseeded mode, in parallel and at various places. In addition, sparse aggregates of embedded young stars are extensively distributed. In this study we report the primary results and implications for high-mass and clustered star formation in giant molecular clouds. In particular, we incorporate for the first time the birth of medium- to low-mass stars into the scenario of sequential formation of OB clusters. Following the emergence of the young OB cluster NGC 2244, a variety of manifestations of forming clusters of medium to high mass appears in the vicinity of the swept-up layer of the H II region as well as farther into the molecular cloud. The embedded clusters appear to form in a structured manner, which suggests they follow tracks laid out by the decay of macroturbulence. We address the possible origins of the turbulence. This leads us to propose a tree model to interpret the neat spatial distribution of clusters within a large section of the Rosette complex. Prominent new-generation OB clusters are identified at the root of the tree pattern.
Directory of Open Access Journals (Sweden)
Siva Sankara Vara Prasad Sakamuri
Full Text Available BACKGROUND: 11beta-hydroxysteroid dehydrogenase type 1 (11β-HSD1 regulates local glucocorticoid action in tissues by catalysing conversion of inactive glucocorticoids to active glucocorticoids. 11β-HSD1 inhibition ameliorates obesity and associated co-morbidities. Here, we tested the effect of 11β-HSD inhibitor, carbenoxolone (CBX on obesity and associated comorbidities in obese rats of WNIN/Ob strain, a new animal model for genetic obesity. METHODOLOGY/PRINCIPAL FINDINGS: Subcutaneous injection of CBX (50 mg/kg body weight or volume-matched vehicle was given once daily for four weeks to three month-old WNIN/Ob lean and obese rats (n = 6 for each phenotype and for each treatment. Body composition, plasma lipids and hormones were assayed. Hepatic steatosis, adipose tissue morphology, inflammation and fibrosis were also studied. Insulin resistance and glucose intolerance were determined along with tissue glycogen content. Gene expressions were determined in liver and adipose tissue. CBX significantly inhibited 11β-HSD1 activity in liver and adipose tissue of WNIN/Ob lean and obese rats. CBX significantly decreased body fat percentage, hypertriglyceridemia, hypercholesterolemia, insulin resistance in obese rats. CBX ameliorated hepatic steatosis, adipocyte hypertrophy, adipose tissue inflammation and fibrosis in obese rats. Tissue glycogen content was significantly decreased by CBX in liver and adipose tissue of obese rats. Severe fat loss and glucose- intolerance were observed in lean rats after CBX treatment. CONCLUSIONS/SIGNIFICANCE: We conclude that 11β-HSD1 inhibition by CBX decreases obesity and associated co-morbidities in WNIN/Ob obese rats. Our study supports the hypothesis that inhibition of 11β-HSD1 is a key strategy to treat metabolic syndrome. Severe fat loss and glucose -intolerance by CBX treatment in lean rats suggest that chronic 11β-HSD1 inhibition may lead to insulin resistance in normal conditions.
Amri, E Z; Dani, C; Doglio, A; Etienne, J; Grimaldi, P; Ailhaud, G
1986-01-01
A subclone of preadipocyte Ob17 cells has been isolated (Ob1754 clonal line). Confluent Ob1754 cells treated with an inhibitor of spermidine and spermine synthesis, methylglyoxal bis(guanylhydrazone), were totally dependent upon putrescine addition for the expression of glycerol-3-phosphate dehydrogenase which behaved as a late marker of adipose conversion. Under these conditions, the early expression of lipoprotein lipase during growth arrest remained unchanged. Studies at the mRNA level showed that the expression of unidentified pOb24 and pGH3 mRNAs, which was parallel to that of lipoprotein lipase, is independent of polyamine addition whereas the late emergence of glycerol-3-phosphate dehydrogenase mRNA was putrescine-dependent and co-ordinated with the expression of pAL422 mRNA encoding for a myelin-P2 homologue [Bernlohr, Angus, Lane, Bolanowski & Kelly (1984) Proc. Natl. Acad. Sci. U.S.A. 81, 5468-5472]. The appearance of lipoprotein lipase preceded DNA synthesis and post-confluent mitoses which were both putrescine-dependent and which took place before the appearance of glycerol-3-phosphate dehydrogenase. Thus the adipose conversion of Ob1754 cells involves the expression of at least two separate sets of markers which are differently regulated. Images Fig. 3. Fig. 6. PMID:3800927
Bharadwaj, P.; Wang, X.; Schuster, Gerard T.; McIntosh, K.
2013-01-01
The theory of supervirtual interferometry is modified so that free-surface related multiple refractions can be used to enhance the signal-to-noise ratio (SNR) of primary refraction events by a factor proportional to√Ns, where Ns is the number of post-critical sources for a specified refraction multiple. We also show that refraction multiples can be transformed into primary refraction events recorded at virtual hydrophones located between the actual hydrophones. Thus, data recorded by a coarse sampling of ocean bottom seismic (OBS) stations can be transformed, in principle, into a virtual survey with P times more OBS stations, where P is the order of the visible free-surface related multiple refractions. The key assumption is that the refraction arrivals are those of head waves, not pure diving waves. The effectiveness of this method is validated with both synthetic OBS data and an OBS data set recorded offshore from Taiwan. Results show the successful reconstruction of far-offset traces out to a source-receiver offset of 120 km. The primary supervirtual traces increase the number of pickable first arrivals from approximately 1600 to more than 3100 for a subset of the OBS data set where the source is only on one side of the recording stations. In addition, the head waves associated with the first-order free-surface refraction multiples allow for the creation of six new common receiver gathers recorded at virtual OBS station located about half way between the actual OBS stations. This doubles the number of OBS stations compared to the original survey and increases the total number of pickable traces from approximately 1600 to more than 6200. In summary, our results with the OBS data demonstrate that refraction interferometry can sometimes more than quadruple the number of usable traces, increase the source-receiver offsets, fill in the receiver line with a denser distribution of OBS stations, and provide more reliable picking of first arrivals. Apotential liability
Bharadwaj, P.
2013-01-10
The theory of supervirtual interferometry is modified so that free-surface related multiple refractions can be used to enhance the signal-to-noise ratio (SNR) of primary refraction events by a factor proportional to√Ns, where Ns is the number of post-critical sources for a specified refraction multiple. We also show that refraction multiples can be transformed into primary refraction events recorded at virtual hydrophones located between the actual hydrophones. Thus, data recorded by a coarse sampling of ocean bottom seismic (OBS) stations can be transformed, in principle, into a virtual survey with P times more OBS stations, where P is the order of the visible free-surface related multiple refractions. The key assumption is that the refraction arrivals are those of head waves, not pure diving waves. The effectiveness of this method is validated with both synthetic OBS data and an OBS data set recorded offshore from Taiwan. Results show the successful reconstruction of far-offset traces out to a source-receiver offset of 120 km. The primary supervirtual traces increase the number of pickable first arrivals from approximately 1600 to more than 3100 for a subset of the OBS data set where the source is only on one side of the recording stations. In addition, the head waves associated with the first-order free-surface refraction multiples allow for the creation of six new common receiver gathers recorded at virtual OBS station located about half way between the actual OBS stations. This doubles the number of OBS stations compared to the original survey and increases the total number of pickable traces from approximately 1600 to more than 6200. In summary, our results with the OBS data demonstrate that refraction interferometry can sometimes more than quadruple the number of usable traces, increase the source-receiver offsets, fill in the receiver line with a denser distribution of OBS stations, and provide more reliable picking of first arrivals. Apotential liability
Attenuation of S-waves in the lithosphere of the Sea of Crete according to OBS observations
Kovachev, S. A.; Kuzin, I. P.; Shoda, O. Yu.; Soloviev, S. L.
1991-11-01
Five OBS were installed in the Sea of Crete in 1987. During a period of nine days 430 local earthquakes were recorded. Hypocentres were determined for 85 microearthquakes. A correlation between magnitude ML and duration of seismic events on the records of the ocean bottom seismographs (OBS) was found from data of 14 shocks recorded simultaneously by OBS and some land-based Greek stations. A magnitude-frequency relationship for earthquakes recorded by OBS was obtained in the magnitude range ML = 2-4. Amplitude curves describing the attenuation of body waves in the lithosphere of the Sea of Crete were compiled. Assessment of quality factor Qs was made by comparison of empirical and theoretical amplitude curves. The values of Qs for the lithosphere of the Sea of Crete were calculated and found equal to 200-300. Low values of Qs and consequently strong attenuation of S-waves in the lithosphere of the Sea of Crete could be explained by extension of the lithosphere accompanied by its partial contamination with melted magma.
Analog photographs from NASA GEMINI missions from 1965-03-01 to 1966-11-01 (NCEI Accession 6900271)
National Oceanic and Atmospheric Administration, Department of Commerce — Analog images from NASA GEMINI III - XII missions. These images are on 70mm film and are not currently accessible online. Some images from this collection were...
Extending the GEMINI advanced review station development
International Nuclear Information System (INIS)
Kadner, S.; Spahn, W.; Pepper, S.
1999-01-01
Recent changes in the objectives of arms control agreements will have a dramatic impact on the nuclear non-proliferation regime. Meeting the demands of the nuclear non-proliferation regime will require the utilisation of the best available technological means for verification. The following discussion focuses on the increasing demands for safeguards with a view towards the possible technological solutions available to meet these demands. Based on the assumption that the gap between the international nonproliferation verification agenda and the available financial means can only be bridged via technology, the following discussion hopes to offer a compelling argument for the adoption of remote monitoring technologies in safeguards applications, specifically, data collection and review. The GEMINI Advanced Review Station (GARS) was developed with initial support from USPOTAS. This poster presentation presents the latest developments in GARS, including its extension to other surveillance systems under IAEA consideration, NDA applications, and networked safeguards. (author)
Management aspects of Gemini's base facility operations project
Arriagada, Gustavo; Nitta, Atsuko; Adamson, A. J.; Nunez, Arturo; Serio, Andrew; Cordova, Martin
2016-08-01
Gemini's Base Facilities Operations (BFO) Project provided the capabilities to perform routine nighttime operations without anyone on the summit. The expected benefits were to achieve money savings and to become an enabler of the future development of remote operations. The project was executed using a tailored version of Prince2 project management methodology. It was schedule driven and managing it demanded flexibility and creativity to produce what was needed, taking into consideration all the constraints present at the time: Time available to implement BFO at Gemini North (GN), two years. The project had to be done in a matrix resources environment. There were only three resources assigned exclusively to BFO. The implementation of new capabilities had to be done without disrupting operations. And we needed to succeed, introducing the new operational model that implied Telescope and instrumentation Operators (Science Operations Specialists - SOS) relying on technology to assess summit conditions. To meet schedule we created a large number of concurrent smaller projects called Work Packages (WP). To be reassured that we would successfully implement BFO, we initially spent a good portion of time and effort, collecting and learning about user's needs. This was done through close interaction with SOSs, Observers, Engineers and Technicians. Once we had a clear understanding of the requirements, we took the approach of implementing the "bare minimum" necessary technology that would meet them and that would be maintainable in the long term. Another key element was the introduction of the "gradual descent" concept. In this, we increasingly provided tools to the SOSs and Observers to prevent them from going outside the control room during nighttime operations, giving them the opportunity of familiarizing themselves with the new tools over a time span of several months. Also, by using these tools at an early stage, Engineers and Technicians had more time for debugging
The Gemini Planet Imager Exoplanet Survey
Nielsen, Eric L.; Macintosh, Bruce; Graham, James R.; Barman, Travis S.; Doyon, Rene; Fabrycky, Daniel; Fitzgerald, Michael P.; Kalas, Paul; Konopacky, Quinn M.; Marchis, Franck; Marley, Mark S.; Marois, Christian; Patience, Jenny; Perrin, Marshall D.; Oppenheimer, Rebecca; Song, Inseok; GPIES Team
2017-01-01
The Gemini Planet Imager Exoplanet Survey (GPIES) is one of the largest most sensitive direct imaging searches for exoplanets conducted to date, and having observed more than 300 stars the survey is halfway complete. We present highlights from the first half of the survey, including the discovery and characterization of the young exoplanet 51 Eri b and the brown dwarf HR 2562 B, new imaging of multiple disks, and resolving the young stellar binary V343 Nor for the first time. GPI has also provided new spectra and orbits of previous known planets and brown dwarfs and polarization measurements of a wide range of disks. Finally, we discuss the constraints placed by the first half of the GPIES campaign on the population of giant planets at orbital separations beyond that of Jupiter. Supported by NSF grants AST-0909188 and AST-1313718, AST-1411868, AST 141378, NNX11AF74G, and DGE-1232825, and by NASA grants NNX15AD95G/NEXSS and NNX11AD21G.
Gemini-IFU spectroscopy of HH 111
Energy Technology Data Exchange (ETDEWEB)
Cerqueira, A. H.; Vasconcelos, M. J.; Feitosa, J.; Plana, H. [LATO-DCET, Universidade Estadual de Santa Cruz Rod. Jorge Amado, km 16, Ilhéus, BA, CEP 45662-900 (Brazil); Raga, A. C., E-mail: hoth@uesc.br [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, A.P. 70-543, 04510 D.F. (Mexico)
2015-03-01
We present new optical observations of the Herbig–Haro (HH) 111 jet using the Gemini Multi Object Spectrograph in its Integral Field Unit mode. Eight fields of 5{sup ′′}×3.{sup ′′}5 have been positioned along and across the HH 111 jet, covering the spatial region from knot E to L in HH 111 (namely, knots E, F, G, H, J, K, and L). We present images and velocity channel maps for the [O i] 6300+6360, Hα, [N ii] 6548+6583, and [S ii] 6716+6730 lines, as well as for the [S ii] 6716/6730 line ratio. We find that the HH 111 jet has an inner region with lower excitation and higher radial velocity, surrounded by a broader region of higher excitation and lower radial velocity. Also, we find higher electron densities at lower radial velocities. These results imply that the HH 111 jet has a fast, axial region with lower velocity shocks surrounded by a lower velocity sheath with higher velocity shocks.
Identification of differentiation-stage specific molecular markers for the osteoblastic phenotype
DEFF Research Database (Denmark)
Twine, Natalie; Chen, Li; Wilkins, Marc
to age-matched control (n=4). Using RNA-seq and cluster analysis, we identified a set of stage-specific molecular markers that define the progression of OB phenotype during ex vivo culture of hMSC, predict in vivo bone formation capacity of hMSC and can be employed to study the mechanisms of impaired......The phenotype of osteoblastic (OB) cells in culture is currently defined using a limited number of markers of low sensitivity and specificity which belong mostly to extracellular matrix proteins. Also, for clinical use of human skeletal (mesenchymal) stem cells (hMSC) in bone regeneration......, there is a need to identify predictive markers for in vivo bone forming capacity. Thus, we employed Illumina RNA sequencing (RNASeq) to examine changes in gene expression across 8 time points between 0-12 days of ex vivo OB differentiation of hMSC. We identified a subset of expressed genes as potentially...
International Nuclear Information System (INIS)
Catalioto, R.M.; Ailhaud, G.; Negrel, R.
1990-01-01
Growth Hormone has recently been shown to stimulate the formation of diacylglycerol in Ob1771 mouse preadipocyte cells without increasing inositol lipid turnover. Addition of growth hormone to Ob1771 cells prelabelled with [ 3 H]glycerol or [ 3 H]choline led to a rapid, transient and stoechiometric formation of labelled diacylglycerol and phosphocholine, respectively. In contrast, no change was observed in the level of choline and phosphatidic acid whereas the release of water-soluble metabolites in [ 3 H]ethanolamine prelabelled cells exposed to growth hormone was hardly detectable. Stimulation by growth hormone of cells prelabelled with (2-palmitoyl 9, 10 [ 3 H])phosphatidylcholine also induced the production of labelled diacyglycerol. Pertussis toxin abolished both diacylglycerol and phosphocholine formation induced by growth hormone. It is concluded that growth hormone mediates diacylglycerol production in Ob1771 cells by means of phosphatidylcholine breakdown involving a phospholipase C which is likely coupled to the growth hormone receptor via a pertussis toxin-sensitive G-protein
Energy Technology Data Exchange (ETDEWEB)
Catalioto, R.M.; Ailhaud, G.; Negrel, R. (Universite de Nice-Sophia Antipolis (France))
1990-12-31
Growth Hormone has recently been shown to stimulate the formation of diacylglycerol in Ob1771 mouse preadipocyte cells without increasing inositol lipid turnover. Addition of growth hormone to Ob1771 cells prelabelled with ({sup 3}H)glycerol or ({sup 3}H)choline led to a rapid, transient and stoechiometric formation of labelled diacylglycerol and phosphocholine, respectively. In contrast, no change was observed in the level of choline and phosphatidic acid whereas the release of water-soluble metabolites in ({sup 3}H)ethanolamine prelabelled cells exposed to growth hormone was hardly detectable. Stimulation by growth hormone of cells prelabelled with (2-palmitoyl 9, 10 ({sup 3}H))phosphatidylcholine also induced the production of labelled diacyglycerol. Pertussis toxin abolished both diacylglycerol and phosphocholine formation induced by growth hormone. It is concluded that growth hormone mediates diacylglycerol production in Ob1771 cells by means of phosphatidylcholine breakdown involving a phospholipase C which is likely coupled to the growth hormone receptor via a pertussis toxin-sensitive G-protein.
Bioinformatics analysis identify novel OB fold protein coding genes in C. elegans.
Directory of Open Access Journals (Sweden)
Daryanaz Dargahi
Full Text Available BACKGROUND: The C. elegans genome has been extensively annotated by the WormBase consortium that uses state of the art bioinformatics pipelines, functional genomics and manual curation approaches. As a result, the identification of novel genes in silico in this model organism is becoming more challenging requiring new approaches. The Oligonucleotide-oligosaccharide binding (OB fold is a highly divergent protein family, in which protein sequences, in spite of having the same fold, share very little sequence identity (5-25%. Therefore, evidence from sequence-based annotation may not be sufficient to identify all the members of this family. In C. elegans, the number of OB-fold proteins reported is remarkably low (n=46 compared to other evolutionary-related eukaryotes, such as yeast S. cerevisiae (n=344 or fruit fly D. melanogaster (n=84. Gene loss during evolution or differences in the level of annotation for this protein family, may explain these discrepancies. METHODOLOGY/PRINCIPAL FINDINGS: This study examines the possibility that novel OB-fold coding genes exist in the worm. We developed a bioinformatics approach that uses the most sensitive sequence-sequence, sequence-profile and profile-profile similarity search methods followed by 3D-structure prediction as a filtering step to eliminate false positive candidate sequences. We have predicted 18 coding genes containing the OB-fold that have remarkably partially been characterized in C. elegans. CONCLUSIONS/SIGNIFICANCE: This study raises the possibility that the annotation of highly divergent protein fold families can be improved in C. elegans. Similar strategies could be implemented for large scale analysis by the WormBase consortium when novel versions of the genome sequence of C. elegans, or other evolutionary related species are being released. This approach is of general interest to the scientific community since it can be used to annotate any genome.
Energy Technology Data Exchange (ETDEWEB)
Duggirala, R.; Stern, M.P.; Reinhart, L.J. [Univ. of Texas Health Science Center, San Antonio, TX (United States)] [and others
1996-09-01
Despite the evidence that human obesity has strong genetic determinants, efforts at identifying specific genes that influence human obesity have largely been unsuccessful. Using the sibship data obtained from 32 low-income Mexican American pedigrees ascertained on a type II diabetic proband and a multipoint variance-components method, we tested for linkage between various obesity-related traits plus associated metabolic traits and 15 markers on human chromosome 7. We found evidence for linkage between markers in the OB gene region and various traits, as follows: D7S514 and extremity skinfolds (LOD = 3.1), human carboxypeptidase A1 (HCPA1) and 32,33-split proinsulin level (LOD = 4.2), and HCPA1 and proinsulin level (LOD = 3.2). A putative susceptibility locus linked to the marker D7S514 explained 56% of the total phenotypic variation in extremity skinfolds. Variation at the HCPA1 locus explained 64% of phenotypic variation in proinsulin level and {approximately}73% of phenotypic variation in split proinsulin concentration, respectively. Weaker evidence for linkage to several other obesity-related traits (e.g., waist circumference, body-mass index, fat mass by bioimpedance, etc.) was observed for a genetic location, which is {approximately}15 cM telomeric to OB. In conclusion, our study reveals that the OB region plays a significant role in determining the phenotypic variation of both insulin precursors and obesity-related traits, at least in Mexican Americans. 66 refs., 3 figs., 4 tabs.
Further RIOTS4 Characterization of Field OB Stars in the SMC
Oey, M. S.; Barnes, Jesse R.; Paggeot, Kevin J.; Dorigo Jones, John; Castro, Norberto; Simon-Diaz, Sergio; Kratter, Kaitlin M.; Moe, Maxwell; Szymanski, Michal
2018-06-01
We present recent results from the Runaways and O-Type Star Spectroscopic Survey of the SMC (RIOTS4), a survey quantifying properties of the field OB stars in the Small Magellanic Cloud (SMC). Based on PSF-fitting photometry and astrometry of OGLE-III I-band images, we quantify the degree of isolation for the target OB stars, classifying them as "tip-of-the-iceberg" stars accompanied by small, sparse, clusters; or as true, isolated field stars. Many of these field stars must be runaways, which we evaluate using GAIA DR2 proper motions. We measure v sin i using the IACOB code Fourier analysis, finding that the bimodal distribution of projected rotation velocities is less pronounced for O stars than early B stars. We examine rotation in relation to relative isolation and runaway status.
VizieR Online Data Catalog: Properties of OB associations in IC 1613 (Garcia+, 2010)
Garcia, M.; Herrero, A.; Castro, N.; Corral, L.; Rosenberg, A.
2014-06-01
To understand the structure and evolution of massive stars, systematic surveys of the Local Group galaxies have been undertaken, to find these objects in environments of different chemical abundances. We focus on the metal-poor irregular galaxy IC 1613 to analyze the stellar and wind structure of its low-metallicity massive stars. We ultimately aim to study the metallicity-dependent driving mechanism of the winds of blue massive stars and use metal-poor massive stars of the Local Volume as a proxy for the stars in the early Universe. In a previous paper we produced a list of OB associations in IC 1613. Their properties are not only a powerful aid towards finding the most interesting candidate massive stars, but also reveal the structure and recent star formation history of the galaxy. We characterize these OB associations and study their connection with the galactic global properties. The reddening-free Q parameter is a powerful tool in the photometric analysis of young populations of massive stars, since it exhibits a smaller degree of degeneracy with OB spectral types than the B-V color. The color-magnitude diagram (Q vs. V) of the OB associations in IC 1613 is studied to determine their age and mass, and confirm the population of young massive stars. We identified more than 10 stars with M>=50M⊙. Spectral classification available for some of them confirm their massive nature, yet we find the common discrepancy with the spectroscopically derived masses. There is a general increasing trend of the mass of the most massive member with the number of members of each association, but not with the stellar density. The average diameter of the associations of this catalog is 40pc, half the historically considered typical size of OB associations. Size increases with the association population. The distribution of the groups strongly correlates with that of neutral and ionized hydrogen. We find the largest dispersion of association ages in the bubble region of the galaxy
Multifunctional Bi2ZnOB2O6 single crystals for second and third order nonlinear optical applications
International Nuclear Information System (INIS)
Iliopoulos, K.; Kasprowicz, D.; Majchrowski, A.; Michalski, E.; Gindre, D.; Sahraoui, B.
2013-01-01
Bi 2 ZnOB 2 O 6 nonlinear optical single crystals were grown by means of the Kyropoulos method from stoichiometric melt. The second and third harmonic generation (SHG/THG) of Bi 2 ZnOB 2 O 6 crystals were investigated by the SHG/THG Maker fringes technique. Moreover, SHG microscopy studies were carried out providing two-dimensional SHG images as a function of the incident laser polarization. The high nonlinear optical efficiency combined with the possibility to grow high quality crystals make Bi 2 ZnOB 2 O 6 an excellent candidate for photonic applications
Observation of brightness profiles of the soft X-ray background in Gemini, Orion and Eridanus
International Nuclear Information System (INIS)
Zwijnenberg, E.
1976-01-01
The instrumentation and the measuring plan of a rocket flight experiment has been described, where the soft X-ray background (0.1-2.0 keV) of the sky near the galactic anti-center is measured. The equipment contains among other things an X-ray focussing instrument with high angular resolution and a large area detection system. Brightness profiles are taken from a number of objects among which are supernova remnants like the crab nebula and IC 443. The hot spot in Eridanus could be attributed to a supernova remnant with more than one shock front. Other objects seen are the Gemini enhancement and the Monoceros nebula
Ferreira Bortoletti, Fátima; Teresa Benevides-Pereira, Ana Maria; Vasconcellos, Esdras Guerreiro; Siqueira, José Oliveira; Araujo Júnior, Edward; Nardozza, Luciano Marcondes Machado; Sebastiani, Ricardo Werner; Moron, Antonio Fernandes
2012-01-01
Objective. To identify the risk factors to the development of Burnout Syndrome in Ob/Gyn Brazilian physicians in four dimensions: emotional exhaustion (EE), professional repression (PR), dehumanization (De), and emotional distancing (EmD). Methods. A prospective cross-sectional study was realized with 48 Ob/Gyn physicians (12 lecturers, 12 attending physicians, 12 medical residents, and 12 graduate students) from Department of Obstetrics, São Paulo Federal University (UNIFESP). We used a sociodemographic questionnaire focusing on the activities (administrative, educational, healthcare, and research). We applied a Burnout Syndrome Inventory (BSI) composed of two parts: triggering factors (ISB1) and the Burnout Syndrome (ISB2). The ISB1 is composed of two scales: positive organizational conditions (POC) and negative organizational conditions (NOC). The ISB2 is composed of four scales: EE, PR, De, and EmD. Results. We observed a rate below and above average to POC and NOC, respectively. The dimensions recorded a level above average to EE, an index at the upper limit of the average to De, a median index to EmD, and a median index to PR. Conclusions. The Ob/Gyn physicians are in an area of vulnerability for the development of Burnout Syndrome due to the high level of EE and De, associated with a median index of PR. The high rate of NOC contributes to the triggering of this scenery.
Madrid, Juan P.; Lee-Waddell, Karen; Serra, Paolo; Koribalski, Bärbel S.; Schirmer, Mischa; Spekkens, Kristine; Wang, Jing
2018-02-01
Using the Gemini Multi Object Spectrograph (GMOS) we search for optical counterparts of two massive (∼109 M ⊙) neutral hydrogen clouds near the spiral galaxy IC 5270, located in the outskirts of the IC 1459 group. These two H I clouds were recently discovered using the Australian Square Kilometer Array Pathfinder (ASKAP). Two low surface brightness optical counterparts to one of these H I clouds are identified in the new Gemini data that reaches down to magnitudes of ∼27.5 mag in the g-band. The observed H I mass-to-light ratio derived with these new data, {M}{{H}{{I}}}/{L}g=242, is among the highest reported to date. We are also able to rule out that the two H I clouds are dwarf companions of IC 5270. Tidal interactions and ram pressure stripping are plausible explanations for the physical origin of these two clouds.
Rodigas, Timothy J.; Follette, Katherine B.; Weinberger, Alycia; Close, Laird; Hines, Dean C.
2014-08-01
When giant planets form, they grow by accreting gas and dust. HD 142527 is a young star that offers a scaled-up view of this process. It has a broad, asymmetric ring of gas and dust beyond ~100 AU and a wide inner gap. Within the gap, a low-mass stellar companion orbits the primary star at just ~12 AU, and both the primary and secondary are accreting gas. In an attempt to directly detect the dusty counterpart to this accreted gas, we have observed HD 142527 with the Gemini Planet Imager in polarized light at Y band (0.95-1.14 μm). We clearly detect the companion in total intensity and show that its position and photometry are generally consistent with the expected values. We also detect a point source in polarized light that may be spatially separated by ~ a few AU from the location of the companion in total intensity. This suggests that dust is likely falling onto or orbiting the companion. Given the possible contribution of scattered light from this dust to previously reported photometry of the companion, the current mass limits should be viewed as upper limits only. If the dust near the companion is eventually confirmed to be spatially separated, this system would resemble a scaled-up version of the young planetary system inside the gap of the transition disk around LkCa 15. Based on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministrio da Cincia, Tecnologia e Inovao (Brazil), and Ministerio de Ciencia, Tecnologa e Innovacin Productiva (Argentina).
McDermid, Richard M.; Krajnovic, Davor; Cappellari, Michele; Trujillo, Chadwick; Christou, Julian; Davies, Roger L.
2010-07-01
We present observations of early-type galaxies with laser guide star adaptive optics (LGS AO) obtained at Gemini North telescope using the NIFS integral field unit (IFU). We employ an innovative technique where the focus compensation due to the changing distance to the sodium layer is made 'open loop', allowing the extended galaxy nucleus to be used only for tip-tilt correction. The purpose of these observations is to determine high spatial resolution stellar kinematics within the nuclei of these galaxies to determine the masses of the super-massive black holes. The resulting data have spatial resolution of 0.2" FWHM or better. This is sufficient to positively constrain the presence of the central black hole in even low-mass early-type galaxies, suggesting that larger samples of such objects could be observed with this technique in the future. The open-loop focus correction technique is a supported queue-observing mode at Gemini, significantly extending the sky coverage in particular for faint, extended guide sources. We also provide preliminary results from tests combining tip/tilt correction from the Gemini peripheral guider with on-axis LGS. The current test system demonstrates feasibility of this mode, providing about a factor 2-3 improvement over natural seeing. With planned upgrades to the peripheral wave-front sensor, we hope to provide close to 100% sky coverage with low Strehl corrections, or 'improved seeing', significantly increasing flux concentration for deep field and extended object studies.
Farhan Ul-Haque, Muhammad; Kalidass, Bhagyalakshmi; Vorobev, Alexey; Baral, Bipin S; DiSpirito, Alan A; Semrau, Jeremy D
2015-04-01
Methanotrophs can express a cytoplasmic (soluble) methane monooxygenase (sMMO) or membrane-bound (particulate) methane monooxygenase (pMMO). Expression of these MMOs is strongly regulated by the availability of copper. Many methanotrophs have been found to synthesize a novel compound, methanobactin (Mb), that is responsible for the uptake of copper, and methanobactin produced by Methylosinus trichosporium OB3b plays a key role in controlling expression of MMO genes in this strain. As all known forms of methanobactin are structurally similar, it was hypothesized that methanobactin from one methanotroph may alter gene expression in another. When Methylosinus trichosporium OB3b was grown in the presence of 1 μM CuCl2, expression of mmoX, encoding a subunit of the hydroxylase component of sMMO, was very low. mmoX expression increased, however, when methanobactin from Methylocystis sp. strain SB2 (SB2-Mb) was added, as did whole-cell sMMO activity, but there was no significant change in the amount of copper associated with M. trichosporium OB3b. If M. trichosporium OB3b was grown in the absence of CuCl2, the mmoX expression level was high but decreased by several orders of magnitude if copper prebound to SB2-Mb (Cu-SB2-Mb) was added, and biomass-associated copper was increased. Exposure of Methylosinus trichosporium OB3b to SB2-Mb had no effect on expression of mbnA, encoding the polypeptide precursor of methanobactin in either the presence or absence of CuCl2. mbnA expression, however, was reduced when Cu-SB2-Mb was added in both the absence and presence of CuCl2. These data suggest that methanobactin acts as a general signaling molecule in methanotrophs and that methanobactin "piracy" may be commonplace. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Association entre le travail par quarts et l’obésité chez les hommes dans le nord-est de l’Ontario
Directory of Open Access Journals (Sweden)
Anne Grundy
2017-01-01
Full Text Available Introduction : Même si certaines études suggèrent une association entre le travail par quarts et l’obésité, peu sont fondées sur la population ou tiennent compte de divers horaires de travail par quarts. L’obésité étant associée à plusieurs problèmes de santé chroniques, il est important de comprendre quelles formes de travail par quarts ont une incidence sur elle et d’effectuer des travaux permettant d’évaluer de façon plus détaillée l’exposition au travail par quarts. Méthodologie : Au moyen d’une régression logistique polytomique multivariée, nous avons étudié l’association entre le travail par quarts (de soir ou nuit, par quarts ou autre type de rotation et le surpoids et l’obésité, en fonction d’une mesure transversale de l’indice de masse corporelle chez 1 561 hommes. Ces hommes avaient déjà servi de témoins dans une étude cas-témoins sur le cancer de la prostate menée dans le nord-est de l’Ontario de 1995 à 1999. Nous avons obtenu l’information sur leurs antécédents de travail (notamment sur le travail par quarts, leur taille et leur poids à partir de données autodéclarées recueillies par questionnaire. Résultats : Nous avons observé une association entre le fait d’avoir déjà travaillé par quarts (par opposition au fait de n’avoir jamais travaillé par quarts et le surpoids (RC [rapport de cotes] = 1,34; IC [intervalle de confiance] à 95 % : 1,05 à 1,73 ainsi que l’obésité (RC = 1,57; IC à 95 % : 1,12 à 2,21. Nous avons également observé des associations statistiquement non significatives avec le fait d’avoir déjà travaillé (par opposition au fait de n’avoir jamais travaillé de façon permanente selon un quart de soir ou de nuit. Nous avons par ailleurs observé une tendance à la hausse statistiquement significative en ce qui concerne le risque de surpoids et d’obésité en fonction de la durée du travail par quarts. Conclusion : Tant l
Liao, Xueming; Gao, Zhinong; Xia, Yan; Niu, Fei; Zhai, Wenzhong
2017-04-04
A series of carboxylate gemini surfactants (CGS, C n -Φ-C n , n = 12, 14, 16, 18) with diphenyl ketone as a spacer group were prepared using a simple and feasible synthetic method. These CGS exhibited an excellent surface activity with extremely low critical micelle concentration (CMC) value (approximately 10 -5 mol/L), good performance in reducing surface tension (nearly 30 mN/m), and the ability of molecular self-assembly into different aggregate morphologies via adjusting the concentrations, which is attributed to the introduction of diphenyl ketone and carboxylic acid ammonium salt in the molecular structure. Moreover, the surface activity and self-assembly ability of CGS were further optimized by tuning the length of the tail chain. These excellent properties imply that CGS can be a soft template to prepare nanomaterials, especially in morphology-controllable synthesis. By adjusting the concentration of one of CGS (C 12 -Φ-C 12 ), nano-La 2 O 3 particles with diverse morphologies were obtained, including spherical shape, bead-chain shape, rod shape, velvet-antler shape, cedar shape, and bowknot shape. This work offers a vital insight into the rational design of template agents for the development of morphology-controllable nanomaterials.
Time-Dependent Antimicrobial Activity of Filtering Nonwovens with Gemini Surfactant-Based Biocides
Directory of Open Access Journals (Sweden)
Katarzyna Majchrzycka
2017-09-01
Full Text Available Previous studies on nonwovens used for respiratory protective devices (RPDs were related to equipment intended for short-term use. There is only limited research on the development of biocidal nonwoven fabrics for reusable RPDs that could be used safely in an industrial work environment where there is a risk of microbial growth. Moreover, a new group of biocides with high antimicrobial activity—gemini surfactants, has never been explored for textile’s application in previous studies. The aim of this study was to develop high-efficiency melt-blown nonwovens containing gemini surfactants with time-dependent biocidal activity, and to validate their antimicrobial properties under conditions simulating their use at a plant biomass-processing unit. A set of porous biocidal structures (SPBS was prepared and applied to the melt-blown polypropylene (PP nonwovens. The biocidal properties of the structures were triggered by humidity and had different activation rates. Scanning electron microscopy was used to undertake structural studies of the modified PP/SPBS nonwovens. In addition, simulation of plant biomass dust deposition on the nonwovens was performed. The biocidal activity of PP/SPBS nonwovens was evaluated following incubation with Escherichia coli and Aspergillus niger from the American Type Culture Collection, and with Pseudomonas fluorescens and Penicillium chrysogenum isolated from the biomass. PP/SPBS nonwovens exhibited antimicrobial activity to varying levels. Higher antimicrobial activity was noted for bacteria (R = 87.85–97.46% and lower for moulds (R = 80.11–94.53%.
Philips Gemini TF64 PET/CT Acceptance Testing
International Nuclear Information System (INIS)
González Gonzalez, Joaquín J.; Calderón Marin, Carlos F.; Varela Corona, Consuelo; Machado Tejeda, Adalberto; González Correa, Héctor J.
2016-01-01
The Philips Gemini TF64 is the first PET/CT scanner installed in Cuba at the Institute of Oncology and Radiobiology in 2014. It is a third generation fully tridimensional whole body PET scanner with time-of-flight (TOF) technology combined with a 64-slice Brilliance CT scanner. The CT detector module contains 672x64 solid state detector, incorporating GOS scintillators, optical diodes and electronic signal channels arranged in 64 side by side arcs, with 672 detectors in each arc. There are sixteen 0.75 mm individual detector elements around the center and four 1.5 mm elements at each end, resulting in a 24 mm total detection length. The PET detector consists of 28 pixelar modules of a 23x44 array of 4x4x22 mm3 of LYSO crystals arranged in an Anger-logic detector design. The hardware coincidence-timing window for this scanner is set at 4 ns and delayed coincidence window technique is used to estimate the random coincidences in collected data. In this study the performance characteristics of PET/CT scanner were measured as part of the program tests of acceptance for clinical use.Methodology. The performance characteristics of CT scanner were evaluated by manufacturer protocol using Philips system performance phantom. Some additional geometrical tests were performed by the user. The intrinsic measurements of energy resolution as well as timing resolution, which define the TOF performance of PET scanner, were performed following the recommendations of manufacturer using 18 F. Spatial resolution, sensitivity, scatter fraction, counting rate performance, image quality and accuracy were measured according to the NEMA NU-2 2007 procedures. Additionally, to characterize the effect of TOF reconstruction on lesion contrast and noise, the standard NEMA torso phantom was reconstructed with and without TOF capability. The accuracy of PET/CT image registration was tested according to the manufacturer protocol using an image alignment calibration holder with 6 point sources of 22
Mass loss from OB supergiants in x-ray binary systems
International Nuclear Information System (INIS)
Alme, M.L.; Wilson, J.R.
1975-01-01
A study of the atmospheres of OB supergiants in x-ray binary systems indicates that when the stellar surface is close enough to the saddle in the gravitational potential to provide a mass transfer rate adequate to power a compact x-ray source, large-amplitude variations in the rate of mass flow occur. 9 references
Relative Stabilities of Conserved and Non-Conserved Structures in the OB-Fold Superfamily
Directory of Open Access Journals (Sweden)
Andrei T. Alexandrescu
2009-05-01
Full Text Available The OB-fold is a diverse structure superfamily based on a β-barrel motif that is often supplemented with additional non-conserved secondary structures. Previous deletion mutagenesis and NMR hydrogen exchange studies of three OB-fold proteins showed that the structural stabilities of sites within the conserved β-barrels were larger than sites in non-conserved segments. In this work we examined a database of 80 representative domain structures currently classified as OB-folds, to establish the basis of this effect. Residue-specific values were obtained for the number of Cα-Cα distance contacts, sequence hydrophobicities, crystallographic B-factors, and theoretical B-factors calculated from a Gaussian Network Model. All four parameters point to a larger average flexibility for the non-conserved structures compared to the conserved β-barrels. The theoretical B-factors and contact densities show the highest sensitivity.Our results suggest a model of protein structure evolution in which novel structural features develop at the periphery of conserved motifs. Core residues are more resistant to structural changes during evolution since their substitution would disrupt a larger number of interactions. Similar factors are likely to account for the differences in stability to unfolding between conserved and non-conserved structures.
Wasungu, Luc; Scarzello, Marco; van Dam, Gooitzen; Molema, Grietje; Wagenaar, Anno; Engberts, Jan B. F. N.; Hoekstra, Dick
In this study, the in vitro and in vivo transfection capacity of novel pH-sensitive sugar-based gemini surfactants was investigated. In an aqueous environment at physiological pH, these compounds form bilayer vesicles, but they undergo a lamellar-to-micellar phase transition in the endosomal pH
Kozuka, Chisayo; Shimizu-Okabe, Chigusa; Takayama, Chitoshi; Nakano, Kaku; Morinaga, Hidetaka; Kinjo, Ayano; Fukuda, Kotaro; Kamei, Asuka; Yasuoka, Akihito; Kondo, Takashi; Abe, Keiko; Egashira, Kensuke; Masuzaki, Hiroaki
2017-11-01
Our previous works demonstrated that brown rice-specific bioactive substance, γ-oryzanol acts as a chaperone, attenuates exaggerated endoplasmic reticulum (ER) stress in brain hypothalamus and pancreatic islets, thereby ameliorating metabolic derangement in high fat diet (HFD)-induced obese diabetic mice. However, extremely low absorption efficiency from intestine of γ-oryzanol is a tough obstacle for the clinical application. Therefore, in this study, to overcome extremely low bioavailability of γ-oryzanol with super-high lipophilicity, we encapsulated γ-oryzanol in polymer poly (DL-lactide-co-glycolide) (PLGA) nanoparticles (Nano-Orz), and evaluated its metabolically beneficial impact in genetically obese-diabetic ob/ob mice, the best-known severest diabetic model in mice. To our surprise, Nano-Orz markedly ameliorated fuel metabolism with an unexpected magnitude (∼1000-fold lower dose) compared with regular γ-oryzanol. Furthermore, such a conspicuous impact was achievable by its administration once every 2 weeks. Besides the excellent impact on dysfunction of hypothalamus and pancreatic islets, Nano-Orz markedly decreased ER stress and inflammation in liver and adipose tissue. Collectively, nanotechnology-based developments of functional foods oriented toward γ-oryzanol shed light on the novel approach for the treatment of a variety of metabolic diseases in humans.
Directory of Open Access Journals (Sweden)
Ayyalasomayajula Vajreswari
2011-06-01
Full Text Available Abstract Background 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD1 catalyzes the conversion of inactive glucocorticoids to active glucocorticoids and its inhibition ameliorates obesity and metabolic syndrome. So far, no studies have reported the effect of dietary vitamin A on 11β-HSD1 activity in visceral fat and liver under normal and obese conditions. Here, we studied the effect of chronic feeding of vitamin A-enriched diet (129 mg/kg diet on 11β-HSD1 activity in liver and visceral fat of WNIN/Ob lean and obese rats. Methods Male, 5-month-old, lean and obese rats of WNIN/Ob strain (n = 16 for each phenotype were divided into two subgroups consisting of 8 rats of each phenotype. Control groups received stock diet containing 2.6 mg vitamin A/kg diet, where as experimental groups received diet containing 129 mg vitamin A/Kg diet for 20 weeks. Food and water were provided ad libitum. At the end of the experiment, tissues were collected and 11β-HSD1 activity was assayed in liver and visceral fat. Results Vitamin A supplementation significantly decreased body weight, visceral fat mass and 11β-HSD1 activity in visceral fat of WNIN/Ob obese rats. Hepatic 11β-HSD1 activity and gene expression were significantly reduced by vitamin A supplementation in both the phenotypes. CCAAT/enhancer binding protein α (C/EBPα, the main transcription factor essential for the expression of 11β-HSD1, decreased in liver of vitamin A fed-obese rats, but not in lean rats. Liver × receptor α (LXRα, a nuclear transcription factor which is known to downregulate 11β-HSD1 gene expression was significantly increased by vitamin A supplementation in both the phenotypes. Conclusions This study suggests that chronic consumption of vitamin A-enriched diet decreases 11β-HSD1 activity in liver and visceral fat of WNIN/Ob obese rats. Decreased 11β-HSD1 activity by vitamin A may result in decreased levels of active glucocorticoids in adipose tissue and possibly
Surface charge density determines the efficiency of cationic gemini surfactant based lipofection.
Ryhänen, Samppa J; Säily, Matti J; Paukku, Tommi; Borocci, Stefano; Mancini, Giovanna; Holopainen, Juha M; Kinnunen, Paavo K J
2003-01-01
The efficiencies of the binary liposomes composed of 1,2-dimyristoyl-sn-glycero-3-phosphocholine and cationic gemini surfactant, (2S,3R)-2,3-dimethoxy-1,4-bis(N-hexadecyl-N,N-dimethylammonium)butane dibromide as transfection vectors, were measured using the enhanced green fluorescent protein coding plasmid and COS-1 cells. Strong correlation between the transfection efficiency and lipid stoichiometry was observed. Accordingly, liposomes with X(SR-1) > or = 0.50 conveyed the enhanced green fluorescent protein coding plasmid effectively into cells. The condensation of DNA by liposomes with X(SR-1) > 0.50 was indicated by static light scattering and ethidium bromide intercalation assay, whereas differential scanning calorimetry and fluorescence anisotropy of diphenylhexatriene revealed stoichiometry dependent reorganization in the headgroup region of the liposome bilayer, in alignment with our previous Langmuir-balance study. Surface charge density and the organization of positive charges appear to determine the mode of interaction of DNA with (2S,3R)-2,3-dimethoxy-1,4-bis(N-hexadecyl-N,N-dimethylammonium)butane dibromide/1,2-dimyristoyl-sn-glycero-3-phosphocholine liposomes, only resulting in DNA condensation when X(SR-1) > 0.50. Condensation of DNA in turn seems to be required for efficient transfection.
Obésité abdominale et autres biomarqueurs de risque ...
African Journals Online (AJOL)
Obésité abdominale et autres biomarqueurs de risque cardiométabolique: influence du niveau socioéconomique et du mode de vie dans deux populations noires apparentées, Cotonou (Bénin) et Port-au-Prince (Haïti). Asma EL Mabchour, Hélène Delisle, Colette Vilgrain, Phillipe Larco, Roger Sodjinou ...
Génétique épidémiologique et moléculaire de l’obésité humaine
Directory of Open Access Journals (Sweden)
Iron Albert
2000-01-01
. Il a été choisi par l’OMS en 1998 pour établir la classification de l’obésité adulte [1]. Entre 18,5 et 25, le poids du sujet est normal, souhaitable avec un risque standard. Au-delà de 25, on définit d’abord une zone de surpoids puis trois degrés de sévérité et de complications croissantes.
Improvements to the gridding of precipitation data across Europe under the E-OBS scheme
Cornes, Richard; van den Besselaar, Else; Jones, Phil; van der Schrier, Gerard; Verver, Ge
2016-04-01
Gridded precipitation data are a valuable resource for analyzing past variations and trends in the hydroclimate. Such data also provide a reference against which model simulations may be driven, compared and/or adjusted. The E-OBS precipitation dataset is widely used for such analyses across Europe, and is particularly valuable since it provides a spatially complete, daily field across the European domain. In this analysis, improvements to the E-OBS precipitation dataset will be presented that aim to provide a more reliable estimate of grid-box precipitation values, particularly in mountainous areas and in regions with a relative sparsity of input station data. The established three-stage E-OBS gridding scheme is retained, whereby monthly precipitation totals are gridded using a thin-plate spline; daily anomalies are gridded using indicator kriging; and the final dataset is produced by multiplying the two grids. The current analysis focuses on improving the monthly thin-plate spline, which has overall control on the final daily dataset. The results from different techniques are compared and the influence on the final daily data is assessed by comparing the data against gridded country-wide datasets produced by various National Meteorological Services
Thomas, Kenneth S.
2016-01-01
Kenneth Thomas will discuss the Intra-Extra Vehicular Activity Russian & Gemini spacesuits. While the United States and Russia adapted to existing launch- and reentry-type suits to allow the first human ventures into the vacuum of space, there were differences in execution and capabilities. Mr. Thomas will discuss the advantages and disadvantages of this approach compared to exclusively intravehicular or extra-vehicular suit systems.
Directory of Open Access Journals (Sweden)
Giuseppe Murdolo
Full Text Available BACKGROUND: The aim of this study was to investigate sex differences and associations of high molecular weight (HMW adiponectin, leptin and proinflammatory adipokines, individually or in combinations, with adiposity and insulin resistance (IR measures in prepubertal childhood. METHODOLOGY: We studied 305 prepubertal children (boys/girls: 144/161; Tanner stage 1; age: 5-13 yr, included in a cohort of 44,231 adolescents who participated in an extensive Italian school-based survey. According to Cole's criteria, 105 individuals were lean (L; boys/girls: 59/46, 60 overweight (OW; boys/girls: 32/28 and 140 obese (OB; boys/girls: 70/70. Measurements comprised total and HMW adiponectin, leptin, as well as a panel of proinflammatory adipokines/chemokines associated with diabetes risk. PRINCIPAL FINDINGS: Leptin-, and the leptin-to-HMW adiponectin ratio (L/HMW-, increased progressively (p<0.0001 from L to OW to OB boys and girls. When compared with L peers, OW and OB girls exhibited lower (p<0.001 HMW adiponectin levels, while in boys the HMW multimers did not differ significantly across the BMI-stratified groups. OB girls displayed higher (p<0.05 IL-8, IL-18, monocyte chemoattractant protein-1 (MCP-1 and soluble intercellular adhesion molecule-1 levels (sICAM-1 than L girls, whereas increased macrophage migration inhibitory factor (MIF concentrations in OB vs OW boys were seen. HMW adiponectin (negatively, leptin or inflammatory markers (positively correlated with adiposity and IR measures. In multivariate models, leptin represented a strong and independent determinant of HOMA-IR (R(2 0.378; p<0.01. Adjustment for age, BMI(z-score, lipids and inflammatory mediators abolished the association between leptin and HOMA-IR in boys, while in girls leptin remained still a significant predictor of IR (R(2 0.513; p<0.01. Finally, in both sexes, the joint effect of the L/HMW did not improve the prediction of basal IR as compared with leptin levels alone, which were
Interaction effects on galaxy pairs with Gemini/GMOS- III: stellar population synthesis
Krabbe, A. C.; Rosa, D. A.; Pastoriza, M. G.; Hägele, G. F.; Cardaci, M. V.; Dors, O. L., Jr.; Winge, C.
2017-05-01
We present an observational study of the impacts of interactions on the stellar population in a sample of galaxy pairs. Long-slit spectra in the wavelength range 3440-7300 Å obtained with the Gemini Multi-Object Spectrograph (GMOS) at Gemini South for 15 galaxies in nine close pairs were used. The spatial distributions of the stellar population contributions were obtained using the stellar population synthesis code starlight. Taking into account the different contributions to the emitted light, we found that most of the galaxies in our sample are dominated by young/intermediate stellar populations. This result differs from the one derived for isolated galaxies, where the old stellar population dominates the disc surface brightness. We interpreted such different behaviour as being due to the effect of gas inflows along the discs of interacting galaxies on the star formation over a time-scale of the order of about 2 Gyr. We also found that, in general, the secondary galaxy of a pair has a higher contribution from the young stellar population than the primary one. We compared the estimated values of stellar and nebular extinction derived from the synthesis method and the Hα/Hβ emission-line ratio, finding that nebular extinctions are systematically higher than stellar ones by about a factor of 2. We did not find any correlation between nebular and stellar metallicities. Neither did we find a correlation between stellar metallicities and ages, while a positive correlation between nebular metallicities and stellar ages was obtained, with older regions being the most metal-rich.
Energy Technology Data Exchange (ETDEWEB)
Huitson, C. M. [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States); Désert, J.-M. [API, University of Amsterdam, P.O. Box 94249, 1090 GE Amsterdam (Netherlands); Bean, J. L. [Department of Astronomy and Astrophysics, University of Chicago, Chicago, IL 60637 (United States); Fortney, J. J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Stevenson, K. B. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Bergmann, M., E-mail: catherine.huitson@colorado.edu [NOAO and Gemini Observatory, present address Palo Alto, CA (United States)
2017-09-01
We present the complete optical transmission spectrum of the hot Jupiter WASP-4b from 440 to 940 nm at R ∼ 400–1500 obtained with the Gemini Multi-Object Spectrometers (GMOS); this is the first result from a comparative exoplanetology survey program of close-in gas giants conducted with GMOS. WASP-4b has an equilibrium temperature of 1700 K and is favorable to study in transmission due to its large scale height (370 km). We derive the transmission spectrum of WASP-4b using four transits observed with the MOS technique. We demonstrate repeatable results across multiple epochs with GMOS, and derive a combined transmission spectrum at a precision about twice above photon noise, which is roughly equal to one atmospheric scale height. The transmission spectrum is well fitted with a uniform opacity as a function of wavelength. The uniform opacity and absence of a Rayleigh slope from molecular hydrogen suggest that the atmosphere is dominated by clouds with condensate grain sizes of ∼1 μ m. This result is consistent with previous observations of hot Jupiters since clouds have been seen in planets with similar equilibrium temperatures to WASP-4b. We describe a custom pipeline that we have written to reduce GMOS time-series data of exoplanet transits, and present a thorough analysis of the dominant noise sources in GMOS, which primarily consist of wavelength- and time-dependent displacements of the spectra on the detector, mainly due to a lack of atmospheric dispersion correction.
International Nuclear Information System (INIS)
Huitson, C. M.; Désert, J.-M.; Bean, J. L.; Fortney, J. J.; Stevenson, K. B.; Bergmann, M.
2017-01-01
We present the complete optical transmission spectrum of the hot Jupiter WASP-4b from 440 to 940 nm at R ∼ 400–1500 obtained with the Gemini Multi-Object Spectrometers (GMOS); this is the first result from a comparative exoplanetology survey program of close-in gas giants conducted with GMOS. WASP-4b has an equilibrium temperature of 1700 K and is favorable to study in transmission due to its large scale height (370 km). We derive the transmission spectrum of WASP-4b using four transits observed with the MOS technique. We demonstrate repeatable results across multiple epochs with GMOS, and derive a combined transmission spectrum at a precision about twice above photon noise, which is roughly equal to one atmospheric scale height. The transmission spectrum is well fitted with a uniform opacity as a function of wavelength. The uniform opacity and absence of a Rayleigh slope from molecular hydrogen suggest that the atmosphere is dominated by clouds with condensate grain sizes of ∼1 μ m. This result is consistent with previous observations of hot Jupiters since clouds have been seen in planets with similar equilibrium temperatures to WASP-4b. We describe a custom pipeline that we have written to reduce GMOS time-series data of exoplanet transits, and present a thorough analysis of the dominant noise sources in GMOS, which primarily consist of wavelength- and time-dependent displacements of the spectra on the detector, mainly due to a lack of atmospheric dispersion correction.
Huitson, C. M.; Désert, J.-M.; Bean, J. L.; Fortney, J. J.; Stevenson, K. B.; Bergmann, M.
2017-09-01
We present the complete optical transmission spectrum of the hot Jupiter WASP-4b from 440 to 940 nm at R ˜ 400-1500 obtained with the Gemini Multi-Object Spectrometers (GMOS); this is the first result from a comparative exoplanetology survey program of close-in gas giants conducted with GMOS. WASP-4b has an equilibrium temperature of 1700 K and is favorable to study in transmission due to its large scale height (370 km). We derive the transmission spectrum of WASP-4b using four transits observed with the MOS technique. We demonstrate repeatable results across multiple epochs with GMOS, and derive a combined transmission spectrum at a precision about twice above photon noise, which is roughly equal to one atmospheric scale height. The transmission spectrum is well fitted with a uniform opacity as a function of wavelength. The uniform opacity and absence of a Rayleigh slope from molecular hydrogen suggest that the atmosphere is dominated by clouds with condensate grain sizes of ˜1 μm. This result is consistent with previous observations of hot Jupiters since clouds have been seen in planets with similar equilibrium temperatures to WASP-4b. We describe a custom pipeline that we have written to reduce GMOS time-series data of exoplanet transits, and present a thorough analysis of the dominant noise sources in GMOS, which primarily consist of wavelength- and time-dependent displacements of the spectra on the detector, mainly due to a lack of atmospheric dispersion correction.
MODELING THE RADIO EMISSION FROM Cyg OB2 NO. 5: A QUADRUPLE SYSTEM?
International Nuclear Information System (INIS)
Kennedy, M.; Dougherty, S. M.; Fink, A.; Williams, P. M.
2010-01-01
Fifty observations at frequencies between 1.4 GHz and 43 GHz of the 6.6 day O6.5-7+O5.5-6 binary Cyg OB2 No. 5 using the Very Large Array over 20 years are re-examined. The aim is to determine the location and character of the previously detected variable radio emission. The radio emission from the system consists of a primary component that is associated with the binary, and a non-thermal source (NE), 0.''8 to the NE of the binary that has been ascribed to a wind-collision region (WCR) between the stellar winds of the binary and that of a B-type star (Star D) to the NE. Previous studies have not accounted for the potential contribution of NE to the total radio emission, most especially in observations where the primary and NE sources are not resolved as separate sources. NE shows no evidence of variation in 23 epochs where it is resolved separately from the primary radio component, demonstrating that the variable emission arises in the primary component. Since NE is non-variable, the radio flux from the primary can now be well determined for the first time, most especially in observations that do not resolve both the primary and NE components. The variable radio emission from the primary component has a period of 6.7 ± 0.3 years which is described by a simple model of a non-thermal source orbiting within the stellar wind envelope of the binary. Such a model implies the presence of a third, unresolved stellar companion (Star C) orbiting the 6.6 day binary with a period of 6.7 years and independent of Star D to the NE. The variable non-thermal emission arises from either a WCR between Star C and the binary system, or possibly from Star C directly. The model gives a mass-loss rate of 3.4 x 10 -5 M sun yr -1 for Cyg OB2 No. 5, unusually high for an Of supergiant and comparable to that of WR stars, and consistent with an unusually strong He I 1.083 μm emission line, also redolent of WR stars. An examination of radial velocity observations available from the
Energy Technology Data Exchange (ETDEWEB)
Katsuta, J. [Department of Physical Sciences, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Uchiyama, Y. [Rikkyo University, Nishi-Ikebukuro, Toshima-ku, Tokyo 171-8501 (Japan); Funk, S., E-mail: katsuta@hep01.hepl.hiroshima-u.ac.jp [Erlangen Centre for Astroparticle Physics, D-91058 Erlangen (Germany)
2017-04-20
We report a study of extended γ -ray emission with the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope , which is likely to be the second case of a γ -ray detection from a star-forming region (SFR) in our Galaxy. The LAT source is located in the G25 region, 1.°7 × 2.°1 around ( l , b ) = (25.°0, 0.°0). The γ -ray emission is found to be composed of two extended sources and one pointlike source. The extended sources have similar sizes of about 1.°4 × 0.°6. An ∼0.°4 diameter subregion of one has a photon index of Γ = 1.53 ± 0.15, and is spatially coincident with HESS J1837−069, likely a pulsar wind nebula. The other parts of the extended sources have a photon index of Γ = 2.1 ± 0.2 without significant spectral curvature. Given their spatial and spectral properties, they have no clear associations with sources at other wavelengths. Their γ -ray properties are similar to those of the Cygnus cocoon SFR, the only firmly established γ -ray detection of an SFR in the Galaxy. Indeed, we find bubble-like structures of atomic and molecular gas in G25, which may be created by a putative OB association/cluster. The γ -ray emitting regions appear confined in the bubble-like structure; similar properties are also found in the Cygnus cocoon. In addition, using observations with the XMM-Newton , we find a candidate young massive OB association/cluster G25.18+0.26 in the G25 region. We propose that the extended γ -ray emission in G25 is associated with an SFR driven by G25.18+0.26. Based on this scenario, we discuss possible acceleration processes in the SFR and compare them with the Cygnus cocoon.
QDs Supported on Langmuir-Blodgett Films of Polymers and Gemini Surfactant
Directory of Open Access Journals (Sweden)
T. Alejo
2013-01-01
Full Text Available Different LB films of poly(octadecene-co-maleic anhydride, PMAO, poly(styrene-co-maleic anhydride partial 2 butoxy ethyl ester cumene terminated, PS-MA-BEE, and Gemini surfactant ethyl-bis(dimethyl octadecylammonium bromide, 18-2-18, have been used to study the effect of the substrate coating on the surface self-assembly of CdSe quantum dots (QDs. Results show that all the “coating molecules” avoid the 3D aggregation of QDs observed when these nanoparticles are directly deposited on mica. Different morphologies were observed depending on the molecules used as coatings, and this was related to the surface properties, such as wetting ability, and the morphology of the coating LB films.
Larkin, Cormac; Vink, Jorick; Kalari, Venu; Groh, Jose
2018-01-01
OB stars are the most luminous and massive stars, living short lives and exerting a disproportionate influence on their environments. They are key to understanding progenitors of gravitational wave sources and reionization of the early Universe. To detect new OB stars, we combine photometric catalog data with TLUSTY and ATLAS9 stellar atmospheres. This method is also believed to be sensitive to elusive “stripped” stars, thought to lose their hydrogen envelope through binary interaction.OB stars are intrinsically luminous, so complete populations are assumed for local group galaxies such as the Small Magellanic Cloud. Our findings challenge this, as we find 26 new OB candidates. Spectroscopy of 7 candidates shows a 100% detection rate. Most interestingly, 5 of our candidates are consistent with “stripped” stars.To date only 5 “stripped” candidates have been found serendipitously (e.g. HD 45166) as current methods are not sensitive to them. Our work doubles the sample of detected candidates, highlighting that our approach is the first to identify them in a targeted, systematic way. The finding of “stripped” stars could rewrite our understanding of the early Universe, offering an alternative hypothesis to Wolf-Rayet driven cosmic reionization.
International Nuclear Information System (INIS)
Panteleyev, G.P.; Livingston, H.D.; Sayles, F.L.; Medkova, O.N.
1995-01-01
As an approach to an assessment of the transport of artificial radionuclides through the Ob river system towards the arctic Ocean, results are presented from the analyses of a series of sediment cores collected in the Ob delta and estuary in 1994. These cores, collected in areas of sediment accumulation, contain the depositional history at the Ob mouth of substances associated with sediment particles from the whole river system watershed. Several approaches to dating these sediments permitted the development of a chronology for the deposition of plutonium isotopes and Cs-137, following their first introduction to the environment a half century ago. Some preliminary results for I-129 are also presented. 6 figs
Loss of stearoyl-CoA desaturase 1 rescues cardiac function in obese leptin-deficient mice.
Dobrzyn, Pawel; Dobrzyn, Agnieszka; Miyazaki, Makoto; Ntambi, James M
2010-08-01
The heart of leptin-deficient ob/ob mice is characterized by pathologic left ventricular hypertrophy along with elevated triglyceride (TG) content, increased stearoyl-CoA desaturase (SCD) activity, and increased myocyte apoptosis. In the present study, using an ob/ob;SCD1(-/-) mouse model, we tested the hypothesis that lack of SCD1 could improve steatosis and left ventricle (LV) function in leptin deficiency. We show that disruption of the SCD1 gene improves cardiac function in ob/ob mice by correcting systolic and diastolic dysfunction without affecting levels of plasma TG and FFA. The improvement is associated with reduced expression of genes involved in FA transport and lipid synthesis in the heart, as well as reduction in cardiac FFA, diacylglycerol, TG, and ceramide levels. The rate of FA beta-oxidation is also significantly lower in the heart of ob/ob;SCD1(-/-) mice compared with ob/ob controls. Moreover, SCD1 deficiency reduces cardiac apoptosis in ob/ob mice due to increased expression of antiapoptotic factor Bcl-2 and inhibition of inducible nitric oxide synthase and caspase-3 activities. Reduction in myocardial lipid accumulation and inhibition of apoptosis appear to be one of the main mechanisms responsible for improved LV function in ob/ob mice caused by SCD1 deficiency.
Kobulnicky, Henry A.; Kiminki, Daniel C.; Lundquist, Michael J.; Burke, Jamison; Chapman, James; Keller, Erica; Lester, Kathryn; Rolen, Emily K.; Topel, Eric; Bhattacharjee, Anirban; Smullen, Rachel A.; Alvarez, Carlos A. Vargas; Runnoe, Jessie C.; Dale, Daniel A.; Brotherton, Michael M.
2014-01-01
We analyze orbital solutions for 48 massive multiple-star systems in the Cygnus OB2 Association, 23 of which are newly presented here, to find that the observed distribution of orbital periods is approximately uniform in log P for P 45 d, even after correction for completeness, indicating either a lower binary fraction or a shift toward low-mass companions. A high degree of similarity (91% likelihood) between the Cyg OB2 period distribution and that of other surveys suggests that the binary p...
Gels and gel-derived glasses in the system Na2O-B2O3-SiO2
Mukherjee, S. P.
1983-01-01
The containerless melting of high-purity multicomponent homogeneous gels and gel monoliths offers a unique approach to making ultrapure multicomponent optical glasses in the reduced gravity environment of space. Procedures for preparing and characterizing gels and gel-derived glasses in the system Na2O-B2O3-SiO2 are described. Preparation is based on the polymerization reactions of alkoxysilane with trimethyl borate or boric acid and a suitable sodium compound. The chemistry of the gelling process is discussed in terms of process parameters and the gel compositions. The physicochemical nature of gels prepared by three different procedures was found to be significantly different. Infrared absorption spectra indicate finite differences in the molecular structures of the different gels. The melting of the gel powders and the transformation of porous gel monoliths to transparent 'glass' without melting are described.
BOREAS TF-3 NSA-OBS Tower Flux, Meteorological, and Soil Temperature Data
Wofsy, Steven; Sutton, Doug; Goulden, Mike; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor)
2000-01-01
The BOReal Ecosystem-Atmosphere Study Tower Flux (BOREAS TF-3) team collected tower flux, surface meteorological, and soil temperature data at the BOREAS Northern Study Area-Old Black Spruce (NSA-OBS) site continuously from the March 1994 through October 1996. The data are available in tabular ASCII files.
International Nuclear Information System (INIS)
Gula, A.; Adamczak, A.; Bubak, M.
1985-01-01
It is shown that the experimental values of dμd formation rate, obtained without taking into account the decay of the μ-molecular resonance compound [(dμd) + dee] * back to the formation channel dμ+D 2 , are underestimated.The correction depends on the rate of this resonance back decay and the rates of processes leading to fusion in dμd. For their current estimates the correction significantly exceeds the experimental error of the uncorrected dμd formation rate λ m obs = 2.76 ± 0.08 μs -1 reported recently. It is argued that back decay may lead to variation of λ m obs with target density which may provide useful information on the parameters of muon-catalyzed fusion. 18 refs., 2 figs. (author)
Directory of Open Access Journals (Sweden)
Zuzanna Pietralik
Full Text Available The success rate of gene therapy depends on the efficient transfection of genetic material into cells. The golden mean between harmlessness and high effectiveness can be provided by synthetic lipid-like molecules that are similar to the components of biological membranes. Cationic gemini surfactants are one such moiety and because of their favourable physicochemical properties (double positive electric charge, reduced toxicity, low values of critical micelle concentration, they show great potential as delivery system components for genetic material in gene therapy. The aim of this study was to investigate the process of the complexation of cationic gemini surfactants with nucleic acids: double-stranded DNA of different sizes (21 bp, ~185 bp, ~20 kbp and siRNA (21 bp. The tested series of dicationic surfactants consists of bis-imidazolium quaternary salts with varying lengths of hydrophobic side chains (m = 5, 6, 7, 8, 9, 11, 12, 14, 16. On the basis of the data obtained by circular dichroism spectroscopy and electrophoresis, we concluded that the studied gemini surfactants with long side chains effectively bind nucleic acids at low concentrations, which leads to the formation of stable lipoplexes. Images obtained by atomic force microscopy also confirmed the formation of vesicular structures, i.e., complexes between DNA and surfactants. The cytotoxicity of selected surfactants was also tested on HeLa cells. The surfactant toxicity significantly depends on surfactant geometry (the length of hydrophobic chain.
International Nuclear Information System (INIS)
Das, Debanu; Kozbial, Piotr; Han, Gye Won; Carlton, Dennis; Jaroszewski, Lukasz; Abdubek, Polat; Astakhova, Tamara; Axelrod, Herbert L.; Bakolitsa, Constantina; Chen, Connie; Chiu, Hsiu-Ju; Chiu, Michelle; Clayton, Thomas; Deller, Marc C.; Duan, Lian; Ellrott, Kyle; Elsliger, Marc-André; Ernst, Dustin; Farr, Carol L.; Feuerhelm, Julie; Grzechnik, Anna; Grant, Joanna C.; Jin, Kevin K.; Johnson, Hope A.; Klock, Heath E.; Knuth, Mark W.; Krishna, S. Sri; Kumar, Abhinav; Marciano, David; McMullan, Daniel; Miller, Mitchell D.; Morse, Andrew T.; Nigoghossian, Edward; Nopakun, Amanda; Okach, Linda; Oommachen, Silvya; Paulsen, Jessica; Puckett, Christina; Reyes, Ron; Rife, Christopher L.; Sefcovic, Natasha; Tien, Henry J.; Trame, Christine B.; Bedem, Henry van den; Weekes, Dana; Wooten, Tiffany; Xu, Qingping; Hodgson, Keith O.; Wooley, John; Deacon, Ashley M.; Godzik, Adam; Lesley, Scott A.; Wilson, Ian A.
2009-01-01
KPN03535 is a protein unique to K. pneumoniae. The crystal structure reveals that KPN03535 represents a novel variant of the OB-fold and is likely to be a DNA-binding lipoprotein. KPN03535 (gi|152972051) is a putative lipoprotein of unknown function that is secreted by Klebsiella pneumoniae MGH 78578. The crystal structure reveals that despite a lack of any detectable sequence similarity to known structures, it is a novel variant of the OB-fold and structurally similar to the bacterial Cpx-pathway protein NlpE, single-stranded DNA-binding (SSB) proteins and toxins. K. pneumoniae MGH 78578 forms part of the normal human skin, mouth and gut flora and is an opportunistic pathogen that is linked to about 8% of all hospital-acquired infections in the USA. This structure provides the foundation for further investigations into this divergent member of the OB-fold family
Characterization of liver changes in ZSF1 rats, an animal model of metabolic syndrome
Directory of Open Access Journals (Sweden)
Marta Borges-Canha
Full Text Available Background: The non-alcoholic fatty liver disease is the hepatic counterpart of the metabolic syndrome. ZSF1 rats are a metabolic syndrome animal model in which liver changes have not been described yet. Aim: The characterization of liver histological and innate immunity changes in ZSF1 rats. Methods: Five groups of rats were included (n = 7 each group: healthy Wistar-Kyoto control rats (Ctrl, hypertensive ZSF1 lean (Ln, ZSF1 obese rats with a normal diet (Ob, ZSF1 obese rates with a high-fat diet (Ob-HFD, and ZSF1 obese rats with low-intensity exercise training (Ob-Ex. The animals were sacrificed at 20 weeks of age, their livers were collected for: a measurements of the area of steatosis, fibrosis and inflammation (histomorphological analysis; and b innate immunity (toll-like receptor [TLR] 2, TLR4, peroxisome proliferator-activated receptor γ [PPARγ], toll interacting protein [TOLLIP] and inflammatory marker (tumor necrosis factor-alpha [TNFvs], interleukin 1 [IL-1] expression analysis by real-time PCR. Results: Ob, Ob-HFD and Ob-Ex were significantly heavier than Ln and Ctrl animals. Ob, Ob-HFD and Ob-Ex animals had impaired glucose tolerance and insulin resistance. ZSF1 Ob, Ob-HFD and Ob-Ex presented a higher degree of steatosis (3,5x; p < 0.05 than Ctrl or ZSF1 Ln rats. Steatohepatitis and fibrosis were not observed in any of the groups. No differences in expression were observed between Ctrl, Ln and Ob animals (except for the significantly higher expression of TOLLIP observed in the Ob vs Ln comparison. Ob-HFD and Ob-Ex rats showed increased expression of PPARγ and TOLLIP as compared to other groups. However, both groups also showed increased expression of TLR2 and TLR4. Nevertheless, this did not translate into a differential expression of TNFα or IL-1 in any of the groups. Conclusion: The ZSF1 model is associated with liver steatosis but not with steatohepatitis or a significantly increased expression of innate immunity or
Variable millimetre radiation from the colliding-wind binary Cygnus OB2 #8A
Blomme, R.; Fenech, D. M.; Prinja, R. K.; Pittard, J. M.; Morford, J. C.
2017-12-01
Context. Massive binaries have stellar winds that collide. In the colliding-wind region, various physically interesting processes occur, leading to enhanced X-ray emission, non-thermal radio emission, as well as non-thermal X-rays and gamma-rays. Non-thermal radio emission (due to synchrotron radiation) has so far been observed at centimetre wavelengths. At millimetre wavelengths, the stellar winds and the colliding-wind region emit more thermal free-free radiation, and it is expected that any non-thermal contribution will be difficult or impossible to detect. Aims: We aim to determine if the material in the colliding-wind region contributes substantially to the observed millimetre fluxes of a colliding-wind binary. We also try to distinguish the synchrotron emission from the free-free emission. Methods: We monitored the massive binary Cyg OB2 #8A at 3 mm with the NOrthern Extended Millimeter Array (NOEMA) interferometer of the Institut de Radioastronomie Millimétrique (IRAM). The data were collected in 14 separate observing runs (in 2014 and 2016), and provide good coverage of the orbital period. Results: The observed millimetre fluxes range between 1.1 and 2.3 mJy, and show phase-locked variability, clearly indicating that a large part of the emission is due to the colliding-wind region. A simple synchrotron model gives fluxes with the correct order of magnitude, but with a maximum that is phase-shifted with respect to the observations. Qualitatively this phase shift can be explained by our neglect of orbital motion on the shape of the colliding-wind region. A model using only free-free emission results in only a slightly worse explanation of the observations. Additionally, on the map of our observations we also detect the O6.5 III star Cyg OB2 #8B, for which we determine a 3 mm flux of 0.21 ± 0.033 mJy. Conclusions: The question of whether synchrotron radiation or free-free emission dominates the millimetre fluxes of Cyg OB2 #8A remains open. More detailed
Thermodynamic aspects of polymer–surfactant interactions: Gemini (16-5-16-PVP-water system
Directory of Open Access Journals (Sweden)
Naved Azum
2016-11-01
Full Text Available The interaction between polyvinylpyrrolidone (PVP and gemini surfactant (16-5-16 in aqueous solution has been analyzed using conductometry. From conductivity data the critical aggregation concentration (cac, critical micelle concentration (cmc, the effective degree of counter-ion binding (β at different temperatures were obtained. The thermodynamic parameters, i.e., Gibbs energy of aggregation and micellization, standard enthalpy of aggregation, and standard entropy of aggregation of surfactant/polymer system were estimated, employing pseudophase separation model. The negative values of Gibbs energy and standard enthalpy suggest that the surfactant/polymer aggregation process is spontaneous and exothermic respectively.
Performance characteristics of 3D GSO PET/CT scanner (Philips GEMINI PET/CT)
International Nuclear Information System (INIS)
Kim, Jin Su; Lee, Jae Sung; Lee, Byeong Il; Lee, Dong Soo; Chung, June Key; Lee, Myung Chul
2004-01-01
Philips GEMINI is a newly introduced whole-body GSO PET/CT scanner. In this study, performance of the scanner including spatial resolution, sensitivity, scatter fraction, noise equivalent count ratio (NECR) was measured utilizing NEMA NU2-2001 standard protocol and compared with performance of LSO, BGO crystal scanner. GEMINI is composed of the Philips ALLEGRO PET and MX8000 D multi-slice CT scanners. The PET scanner has 28 detector segments which have an array of 29 by 22 GSO crystals (4*6*20 mm), covering axial FOV of 18 cm. PET data to measure spatial resolution, sensitivity, scatter fraction, and NECR were acquired in 3D mode according to the NEMA NU2 protocols (coincidence window: 8 ns, energy window : 409∼664 keV). For the measurement of spatial resolution, images were reconstructed with FBP using ramp filter and an iterative reconstruction algorithm, 3D RAMLA. Data for sensitivity measurement were acquired using NEMA sensitivity phantom filled with F-18 solution and surrounded by 1∼5 aluminum sleeves after we confirmed that dead time loss did not exceed 1%. To measure NECR and scatter fraction, 1110 MBq of F-18 solution was injected into a NEMA scatter phantom with a length of 70 cm and dynamic scan with 20-min frame duration was acquired for 7 half-lives. Oblique sinograms were collapsed into transaxial slices using single slice rebinning method, and true to background (scatter + random) ratio for each slice and frame was estimated. Scatter fraction was determined by averaging the true to background ratio of last 3 frames in which the dead time loss was below 1%. Transverse and axial resolutions at 1 cm radius were (1) 5.3 and 6.5 mm (FBP), (2) 5.1 and 5.9 mm (3D RAMLA). Transverse radial, transverse tangential, and axial resolution at 10 cm were (1) 5.7, 5.7, and 7.0 mm (FBP), (2) 5.4, 5.4, and 6.4 mm (3D RAMLA). Attenuation free values of sensitivity were 3,620 counts/sec/MBq at the center of transaxial FOV and 4,324 counts/sec/MBq at 10 cm offset
hello, yann; Charvis, Philippe; Yegikyan, Manuk; verfaillie, Romain; Rivet, Diane
2016-04-01
Real time monitoring of seismic activity is a major issue for early warning of earthquakes and tsunamis. It can be done using regional scale wired nodes, such as Neptune in Canada and in the U.S, or DONET in Japan. Another approach to monitor seismic activity at sea is to deploying repeatedly OBS array like during the amphibious Cascadia Initiative (four time 1-year deployments), the Japanese Pacific Array (broadband OBSs "ocean-bottom broadband dispersion survey" with 2-years autonomy), the Obsismer program in the French Lesser Antilles (eight time 6-months deployments) and the Osisec program in Ecuador (four time 6-months deployments). These autonomous OBSs are self-recovered or recovered using an ROV. These systems are costly including ship time, and require to recover the OBS before to start working on data. Among the most recent alternative we developed a 3/4 years autonomy ocean bottom system with 9 channels (?) allowing the acquisition of different seismic or environmental parameters. MUG-OBS is a free falling instrument rated down to 6000 m. The installation of the sensor is monitored by acoustic commands from the surface and a health bulletin with data checking is recovered by acoustic during the installation. The major innovation is that it is possible to recover the data any time on demand (regularly every 6-months or after a crisis) using one of the 6 data-shuttles released from the surface by acoustic command using a one day fast cruise boat of opportunity. Since sensors stayed at the same location for 3 years, it is a perfect tool to monitor large seismic events, background seismic activity and aftershock distribution. Clock, drift measurement and GPS localization is automatic when the shuttle reaches the surface. For remote areas, shuttles released automatically and a seismic events bulletin is transmitted. Selected data can be recovered by two-way Iridium satellite communication. After a period of 3 years the main station is self-recovered by
VizieR Online Data Catalog: 44 SZ-selected galaxy clusters ACT observations (Sifon+, 2016)
Sifon, C.; Battaglia, N.; Hasselfield, M.; Menanteau, F.; Barrientos, L. F.; Bond, J. R.; Crichton, D.; Devlin, M. J.; Dunner, R.; Hilton, M.; Hincks, A. D.; Hlozek, R.; Huffenberger, K. M.; Hughes, J. P.; Infante, L.; Kosowsky, A.; Marsden, D.; Marriage, T. A.; Moodley, K.; Niemack, M. D.; Page, L. A.; Spergel, D. N.; Staggs, S. T.; Trac, H.; Wollack, E. J.
2017-11-01
ACT is a 6-metre off-axis Gregorian telescope located at an altitude of 5200um in the Atacama desert in Chile, designed to observe the CMB at arcminute resolution. Galaxy clusters were detected in the 148GHz band by matched-filtering the maps with the pressure profile suggested by Arnaud et al. (2010A&A...517A..92A), fit to X-ray selected local (zGMOS) on the Gemini-South telescope, split in semesters 2011B (ObsID:GS-2011B-C-1, PI:Barrientos/Menanteau) and 2012A (ObsID:GS-2012A-C-1, PI:Menanteau), prioritizing clusters in the cosmological sample at 0.3
Kyauk, E.
2011-12-01
Polyhydroxybutyrate (PHB) is a biodegradable thermoplastic that is produced by various microorganisms. Because of its potential to replace conventional plastics, it has been closely researched in the past few years. Methanotrophic bacteria, bacteria that consume methane, produce this bioplastic when it lacks certain nutrients. The utilization of methane to produce PHB shows much promise as methane is a cheap, plentiful gas. In this study, we observed the methanotroph, Methylosinus trichosporium OB3b , and its yield of PHB in the absence of nitrogen. The optical density of Methylosinus trichosporium OB3b was measured in order to observe cell growth and PHB production patterns over a 48 hour period.
Search for OB stars running away from young star clusters. II. The NGC 6357 star-forming region
Gvaramadze, V. V.; Kniazev, A. Y.; Kroupa, P.; Oh, S.
2011-11-01
Dynamical few-body encounters in the dense cores of young massive star clusters are responsible for the loss of a significant fraction of their massive stellar content. Some of the escaping (runaway) stars move through the ambient medium supersonically and can be revealed via detection of their bow shocks (visible in the infrared, optical or radio). In this paper, which is the second of a series of papers devoted to the search for OB stars running away from young ( ≲ several Myr) Galactic clusters and OB associations, we present the results of the search for bow shocks around the star-forming region NGC 6357. Using the archival data of the Midcourse Space Experiment (MSX) satellite and the Spitzer Space Telescope, and the preliminary data release of the Wide-Field Infrared Survey Explorer (WISE), we discovered seven bow shocks, whose geometry is consistent with the possibility that they are generated by stars expelled from the young (~1-2 Myr) star clusters, Pismis 24 and AH03 J1725-34.4, associated with NGC 6357. Two of the seven bow shocks are driven by the already known OB stars, HD 319881 and [N78] 34. Follow-up spectroscopy of three other bow-shock-producing stars showed that they are massive (O-type) stars as well, while the 2MASS photometry of the remaining two stars suggests that they could be B0 V stars, provided that both are located at the same distance as NGC 6357. Detection of numerous massive stars ejected from the very young clusters is consistent with the theoretical expectation that star clusters can effectively lose massive stars at the very beginning of their dynamical evolution (long before the second mechanism for production of runaway stars, based on a supernova explosion in a massive tight binary system, begins to operate) and lends strong support to the idea that probably all field OB stars have been dynamically ejected from their birth clusters. A by-product of our search for bow shocks around NGC 6357 is the detection of three circular
ObsPy: Establishing and maintaining an open-source community package
Krischer, L.; Megies, T.; Barsch, R.
2017-12-01
Python's ecosystem evolved into one of the most powerful and productive research environment across disciplines. ObsPy (https://obspy.org) is a fully community driven, open-source project dedicated to provide a bridge for seismology into that ecosystem. It does so by offering Read and write support for essentially every commonly used data format in seismology, Integrated access to the largest data centers, web services, and real-time data streams, A powerful signal processing toolbox tuned to the specific needs of seismologists, and Utility functionality like travel time calculations, geodetic functions, and data visualizations. ObsPy has been in constant unfunded development for more than eight years and is developed and used by scientists around the world with successful applications in all branches of seismology. By now around 70 people directly contributed code to ObsPy and we aim to make it a self-sustaining community project.This contributions focusses on several meta aspects of open-source software in science, in particular how we experienced them. During the panel we would like to discuss obvious questions like long-term sustainability with very limited to no funding, insufficient computer science training in many sciences, and gaining hard scientific credits for software development, but also the following questions: How to best deal with the fact that a lot of scientific software is very specialized thus usually solves a complex problem but at the same time can only ever reach a limited pool of developers and users by virtue of it being so specialized? Therefore the "many eyes on the code" approach to develop and improve open-source software only applies in a limited fashion. An initial publication for a significant new scientific software package is fairly straightforward. How to on-board and motivate potential new contributors when they can no longer be lured by a potential co-authorship? When is spending significant time and effort on reusable
Llewellyn, J. A.
1967-01-01
The Launch Complex 37 lightning strike of July 27, 1967, was reviewed and compared to a similar incident on the Gemini Program. Available data indicate little likelihood of damaging currents having been present in SA-204 Launch Vehicle or the ground equipment during the July 27th incident. Based on the results of subsystem and system testing after the strike, anticipated results of future testing, the six months elapsed time between the strike-and launch, and the fact that much of the critical airborne electrical/electronic equipment has been removed since the strike for other reasons, no new actions are considered necessary at this time in the Gemini case, significant failures occurred in both airborne and ground circuits. Due to the resultant semi, condlictor uncertainty, and the relatively' short time prior to planned launch, all critical airborne components containing semiconduetors were replaced, and a sophisticated data comparison task was implemented.
OB ASSOCIATIONS AT THE UPPER END OF THE MILKY WAY LUMINOSITY FUNCTION
Energy Technology Data Exchange (ETDEWEB)
Rahman, Mubdi; Matzner, Christopher D.; Moon, Dae-Sik, E-mail: mubdi@pha.jhu.edu [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H8 (Canada)
2013-04-01
The Milky Way's most luminous, young, and massive (M {approx}> 10{sup 4} M{sub Sun }) star clusters and OB associations have largely evaded detection despite knowledge of their surrounding H II regions. We search for these clusters and associations within the 40 star-forming complexes from Rahman and Murray in the 13 most luminous Wilkinson Microwave Anisotropy Probe (WMAP) free-free emission sources of the Galaxy. Selecting for objects with the dust-reddened colors of OB stars, we identify new candidate associations using the Two Micron All Sky Survey point-source catalog. In 40 star-forming complexes searched, 22 contain cluster/association candidates with sizes and masses in the range of 3'-26' and 10{sup 2.3}-10{sup 5} M{sub Sun }. Of the 22 candidates, at least seven have estimated masses {approx}> 10{sup 4} M{sub Sun }, doubling the number of such massive clusters known in the Galaxy. Only one of the searched WMAP sources remains without a candidate. Applying our method to a statistically similar set of test locations, we estimate that 3.0 {+-} 0.6 of our 22 candidate associations are unrelated to the star-forming complexes. In addition, the apparent extinctions of our candidate associations correlate well with the predictions from a Galactic model. These facts, along with the clear detection of a known OB association and the previous spectral verification of one cluster found by this method, validate our method. In eight of the most luminous WMAP sources, the candidate associations can account for the observed free-free flux. With our new compilation, the Galactic census of young, massive stellar associations may now be about half complete.
Simón-Díaz, S.
2015-01-01
Imagine we could do asteroseismology of large samples of OB-type stars by using just one spectrum per target. That would be great! But this is probably a crazy and stupid idea. Or maybe not. Maybe we have the possibility to open a new window to investigate stellar oscillations in massive stars that has been in front of us for many years, but has not attracted very much our attention: the characterization and understanding of the so-called macroturbulent broadening in OB-type stars.
GEMINI PLANET IMAGER SPECTROSCOPY OF THE HR 8799 PLANETS c AND d
International Nuclear Information System (INIS)
Ingraham, Patrick; Macintosh, Bruce; Marley, Mark S.; Saumon, Didier; Marois, Christian; Dunn, Jennifer; Erikson, Darren; Barman, Travis; Bauman, Brian; Burrows, Adam; Chilcote, Jeffrey K.; Fitzgerald, Michael P.; De Rosa, Robert J.; Dillon, Daren; Gavel, Donald; Doyon, René; Goodsell, Stephen J.; Hartung, Markus; Hibon, Pascale; Graham, James R.
2014-01-01
During the first-light run of the Gemini Planet Imager we obtained K-band spectra of exoplanets HR 8799 c and d. Analysis of the spectra indicates that planet d may be warmer than planet c. Comparisons to recent patchy cloud models and previously obtained observations over multiple wavelengths confirm that thick clouds combined with horizontal variation in the cloud cover generally reproduce the planets' spectral energy distributions. When combined with the 3 to 4 μm photometric data points, the observations provide strong constraints on the atmospheric methane content for both planets. The data also provide further evidence that future modeling efforts must include cloud opacity, possibly including cloud holes, disequilibrium chemistry, and super-solar metallicity
Optimal Inversion Parameters for Full Waveform Inversion using OBS Data Set
Kim, S.; Chung, W.; Shin, S.; Kim, D.; Lee, D.
2017-12-01
In recent years, full Waveform Inversion (FWI) has been the most researched technique in seismic data processing. It uses the residuals between observed and modeled data as an objective function; thereafter, the final subsurface velocity model is generated through a series of iterations meant to minimize the residuals.Research on FWI has expanded from acoustic media to elastic media. In acoustic media, the subsurface property is defined by P-velocity; however, in elastic media, properties are defined by multiple parameters, such as P-velocity, S-velocity, and density. Further, the elastic media can also be defined by Lamé constants, density or impedance PI, SI; consequently, research is being carried out to ascertain the optimal parameters.From results of advanced exploration equipment and Ocean Bottom Seismic (OBS) survey, it is now possible to obtain multi-component seismic data. However, to perform FWI on these data and generate an accurate subsurface model, it is important to determine optimal inversion parameters among (Vp, Vs, ρ), (λ, μ, ρ), and (PI, SI) in elastic media. In this study, staggered grid finite difference method was applied to simulate OBS survey. As in inversion, l2-norm was set as objective function. Further, the accurate computation of gradient direction was performed using the back-propagation technique and its scaling was done using the Pseudo-hessian matrix.In acoustic media, only Vp is used as the inversion parameter. In contrast, various sets of parameters, such as (Vp, Vs, ρ) and (λ, μ, ρ) can be used to define inversion in elastic media. Therefore, it is important to ascertain the parameter that gives the most accurate result for inversion with OBS data set.In this study, we generated Vp and Vs subsurface models by using (λ, μ, ρ) and (Vp, Vs, ρ) as inversion parameters in every iteration, and compared the final two FWI results.This research was supported by the Basic Research Project(17-3312) of the Korea Institute of
Sinclair, J. A.; Orton, G. S.; Greathouse, T. K.; Lacy, J.; Giles, R.; Fletcher, L. N.; Vogt, M.; Irwin, P. G.
2017-12-01
Jupiter exhibits auroral emission at a multitude of wavelengths. Auroral emission at X-ray, ultraviolet and near-infrared wavelengths demonstrate the precipitation of ion and electrons in Jupiter's upper atmosphere, at altitudes exceeding 250 km above the 1-bar level. Enhanced mid-infrared emission of CH4, C2H2, C2H4 and further hydrocarbons is also observed coincident with Jupiter's auroral regions. Retrieval analyses of infrared spectra from IRTF-TEXES (Texas Echelon Cross Echelle Spectrograph on NASA's Infrared Telescope Facility) indicate strong heating at the 1-mbar level and evidence of ion-neutral chemistry, which enriches the abundances of unsaturated hydrocarbons (Sinclair et al., 2017b, doi:10.1002/2017GL073529, Sinclair et al., 2017c (under review)). The extent to which these phenomena in the stratosphere are correlated and coupled physically with the shorter-wavelength auroral emission originating from higher altitudes has been a challenge due to the limited spatial resolution available on the IRTF. Smaller-scale features observed in the near-infrared and ultraviolet emission, such as the main `oval', transient `swirls' and dusk-active regions within the main oval (e.g. Stallard et al., 2014, doi:10.1016/j/Icarus.2015.12.044, Nichols et al., 2017, doi: 10.1002/2017GL073029) are potentially being blurred in the mid-infrared by the diffraction-limited resolution (0.7") of IRTF's 3-metre primary aperture. However, on March 17-19th 2017, we obtained spectral measurements of H2 S(1), CH4, C2H2, C2H4 and C2H6 emission of Jupiter's high latitudes using TEXES on Gemini-North, which has a 8-metre primary aperture. This rare opportunity combines the superior spectral resolving power of TEXES and the high spatial resolution provided by Gemini-North's 8-metre aperture. We will perform a retrieval analyses to determine the 3D distributions of temperature, C2H2, C2H4 and C2H6. The morphology will be compared with near-contemporaneous measurements of H3+ emission from
International Nuclear Information System (INIS)
Horch, Elliott P.; Howell, Steve B.; Everett, Mark E.; Ciardi, David R.
2012-01-01
We present the results of 71 speckle observations of binary and unresolved stars, most of which were observed with the DSSI speckle camera at the Gemini North Telescope in 2012 July. The main purpose of the run was to obtain diffraction-limited images of high-priority targets for the Kepler and CoRoT missions, but in addition, we observed a number of close binary stars where the resolution limit of Gemini was used to better determine orbital parameters and/or confirm results obtained at or below the diffraction limit of smaller telescopes. Five new binaries and one triple system were discovered, and first orbits are calculated for other two systems. Several systems are discussed in detail.
Energy Technology Data Exchange (ETDEWEB)
Batigoec, Cigdem [Department of Chemistry, Faculty of Sciences, Trakya University, 22030 Edirne (Turkey); Akbas, Halide, E-mail: hakbas34@yahoo.com [Department of Chemistry, Faculty of Sciences, Trakya University, 22030 Edirne (Turkey); Boz, Mesut [Department of Chemistry, Faculty of Sciences, Trakya University, 22030 Edirne (Turkey)
2011-09-15
Highlights: > The cmc and {alpha} values of surfactant increased with increasing solvent content and temperature. > The values of ({Delta}G{sub m}{sup 0}) are negative in all cases for the micelle formation becomes less favourable. > The values of negative enthalpy indicate importance of the London dispersion forces for the micellization. > The positive entropy is due to a contribution supplied from the solvent. - Abstract: The effect of organic solvents on micellization behaviour and thermodynamic parameters of a cationic gemini (dimeric) surfactant, C{sub 12}H{sub 25}(CH{sub 3}){sub 2}N{sup +}-(CH{sub 2}){sub 2}-N{sup +}(CH{sub 3}){sub 2}C{sub 12}H{sub 25}.2Br{sup -}, (12-2-12) was studied in aqueous solutions over the range of T = (293.15 to 323.15) K using the conductometric technique. Ethylene glycol (EG), dimethylsulfoxide (DMSO) and 1,4-dioxan (DO) were used as organic solvents with three different contents. The critical micelle concentration (cmc) and the degree of counter ion dissociation ({alpha}) of micelles in the water and in the (water + organic solvent) mixtures including 10%, 20%, and 30% solvent contents were determined. The standard Gibbs free energy ({Delta}G{sub m}{sup 0}), enthalpy ({Delta}H{sub m}{sup 0}) and entropy ({Delta}S{sub m}{sup 0}) of micellization were estimated from the temperature dependence of the cmc values. It was observed that the critical micelle concentration of the gemini surfactant and the degree of counter ion dissociation of the micelle increased as the volume percentage of organic solvent, and temperature increased. The standard Gibbs free energy of micellization was found to be less negative with the increase in the organic solvent content and temperature.
Gemini spectroscopy of the outer disk star cluster BH176
Sharina, M. E.; Donzelli, C. J.; Davoust, E.; Shimansky, V. V.; Charbonnel, C.
2014-10-01
Context. BH176 is an old metal-rich star cluster. It is spatially and kinematically consistent with belonging to the Monoceros Ring. It is larger in size and more distant from the Galactic plane than typical open clusters, and it does not belong to the Galactic bulge. Aims: Our aim is to determine the origin of this unique object by accurately determining its distance, metallicity, and age. The best way to reach this goal is to combine spectroscopic and photometric methods. Methods: We present medium-resolution observations of red clump and red giant branch stars in BH176 obtained with the Gemini South Multi-Object Spectrograph. We derive radial velocities, metallicities, effective temperatures, and surface gravities of the observed stars and use these parameters to distinguish member stars from field objects. Results: We determine the following parameters for BH176: Vh = 0 ± 15 km s-1, [Fe/H] = -0.1 ± 0.1, age 7 ± 0.5 Gyr, E(V - I) = 0.79 ± 0.03, distance 15.2 ± 0.2 kpc, α-element abundance [α/Fe] ~ 0.25 dex (the mean of [Mg/Fe], and [Ca/Fe]). Conclusions: BH176 is a member of old Galactic open clusters that presumably belong to the thick disk. It may have originated as a massive star cluster after the encounter of the forming thin disk with a high-velocity gas cloud or as a satellite dwarf galaxy. Appendix A is available in electronic form at http://www.aanda.org
GNIRS-DQS: A Gemini Near Infrared Spectrograph Distant Quasar Survey
Matthews, Brandon; Shemmer, Ohad; Brotherton, Michael S.; Andruchow, Ileana; Boroson, Todd A.; Brandt, W. Niel; Cellone, Sergio; Ferrero, Gabriel; Gallagher, Sarah; Green, Richard F.; Hennawi, Joseph F.; Lira, Paulina; Myers, Adam D.; Plotkin, Richard; Richards, Gordon T.; Runnoe, Jessie; Schneider, Donald P.; Shen, Yue; Strauss, Michael A.; Willott, Chris J.; Wills, Beverley J.
2018-06-01
We describe an ongoing three-year Gemini survey, launched in 2017, that will obtain near-infrared spectroscopy of 416 Sloan Digital Sky Survey (SDSS) quasars between redshifts of 1.5 and 3.5 in the ~1.0-2.5 μm band. These spectra will cover critical diagnostic emission lines, such as Mg II, Hβ, and [O III], in each source. This project will more than double the existing inventory of near-infrared spectra of luminous quasars at these redshifts, including the era of fast quasar growth. Additional rest frame ultraviolet coverage of at least the C IV emission line is provided by the SDSS spectrum of each source. We will utilize the spectroscopic inventory to determine the most accurate and precise quasar black hole masses, accretion rates, and redshifts, and use the results to derive improved prescriptions for UV-based proxies for these parameters. The improved redshifts will establish velocities of quasar outflows that interact with the host galaxies, and will help constrain how imprecise distance estimates bias quasar clustering measurements. Furthermore, our measurements will facilitate a more complete understanding of how the rest-frame UV-optical spectral properties depend on redshift and luminosity, and test whether the physical properties of the quasar central engine evolve over cosmic time. We will make our data immediately available to the public, provide reduced spectra via a dedicated website, and produce a catalog of measurements and fundamental quasar properties.
DEFF Research Database (Denmark)
Fuentes, T; Ara, I; Guadalupe-Grau, A
2010-01-01
To examine whether obesity-associated leptin resistance could be due to down-regulation of leptin receptors (OB-Rs) and/or up-regulation of suppressor of cytokine signalling 3 (SOCS3) and protein tyrosine phosphatase 1B (PTP1B) in skeletal muscle, which blunt janus kinase 2-dependent leptin...
Adipokines : rôle dans l’obésité et l’insulino‐résistance
Directory of Open Access Journals (Sweden)
Aubert Roberte
2003-03-01
Full Text Available Le tissu adipeux longtemps considéré comme un organe de stockage est maintenant reconnu comme un organe endocrine. Cette revue étudie l’action de 3 adipokines sécrétées par le tissu adipeux et impliquées dans le contrôle de l’homéostasie énergétique et l’insulino‐résistance, la leptine, l’adiponectine et la résistine. La découverte de la leptine a permis la compréhension des mécanismes centraux de la prise alimentaire et de la dépense énergétique. L’espoir que la leptine puisse intervenir dans le traitement de l’obésité a été déçu, mais elle joue un rôle important dans l’insulino‐sensibilité. L’adiponectine circulante est diminuée dans l’obésité et la perte pondérale augmente son taux. Elle améliore la sensibilité à l’insuline en agissant sur le métabolisme glucidique et lipidique. Bien que pour le moment le rôle de la résistine soit encore mal défini, les études chez l’animal suggèrent qu’elle soit impliqués dans l’insulino‐résistance. Chez l’homme il n’y a pas de relation entre l’expression de la résistine et l’obésité. On peut donc se demander si la résistine, dans l’espèce humaine, est bien le lien entre obésité et diabète de type 2.
Bhat, Waseem Feeroze; Bhat, Imtiyaz Ahmad; Bhat, Sheraz Ahmad; Bano, Bilqees
2016-12-01
Many protein misfolding diseases in mammalian system are characterised by the accumulation of protein aggregates in amyloid fibrillar forms. Several therapeutic approaches include reduction in the production of the amyloidogenic form of proteins, increase in the clearance rate of misfolded or aggregated proteins, and direct inhibition of the self-assembly process have been explained. One of the possible remedial treatments for such disorders may be to identify molecules which are capable of either preventing formation of fibrils or disintegrating the formed fibrils. In this work, we have studied the effect of conventional surfactants; sodium dodecylsulphate (SDS), cetyl trimethylammonium bromide (CTAB) and dicationic gemini (16-4-16) surfactant on the disintegration of the goat brain cystatin (GBC) fibrils above their critical micelle concentrations (CMC) using ThT fluorescence, CD, TEM, Congo red and turbidity approaches. The results obtained are significant and showing the best disintegrating potency on GBC fibrils with gemini surfactant. The outcome from this work will aid in the development and/or design of potential inhibitory agents against amyloid deposits associated with amyloid diseases. Copyright © 2016 Elsevier B.V. All rights reserved.
Mass loss rates of OB stars derived from infrared observations
International Nuclear Information System (INIS)
Tanzi, E.G.; Tarenghi, M.; Panagia, N.
1981-01-01
In this paper the authors report briefly on a study of the mass loss of early type stars in the infrared. Up to now near infrared (1.25 - 4.8 μ) broad band photometry of 70 southern OB stars of various luminosity class has been secured. Program stars have been selected, among those bright enough in the infrared to give a suitable photometric accuracy, in order to cover a wide range of spectral types. 37 stars are found to exhibit emission in excess over a blackbody photospheric continuum, which is interpreted in terms of gas ejected in the form of an accelerated wind. By means of model calculations the corresponding mass loss rates are derived. The obtained values compare well with those determined independently by various authors for stars in common. Their data show that mass loss rates increase with luminosity and are a decreasing function of surface gravity. (Auth.)
Mizuno, Márcia Sanae; Crisma, Amanda Rabello; Borelli, Primavera; Schäfer, Bárbara Tavares; Silveira, Mariana Póvoa; Castelucci, Patricia
2014-01-01
AIM: To investigate the colocalization, density and profile of neuronal areas of enteric neurons in the ileum of male obese mice. METHODS: The small intestinal samples of male mice in an obese group (OG) (C57BL/6J ob/ob) and a control group (CG) (+/+) were used. The tissues were analyzed using a double immunostaining technique for immunoreactivity (ir) of the P2X2 receptor, nitric oxide synthase (NOS), choline acetyl transferase (ChAT) and calretinin (Calr). Also, we investigated the density and profile of neuronal areas of the NOS-, ChAT- and Calr-ir neurons in the myenteric plexus. Myenteric neurons were labeled using an NADH-diaphorase histochemical staining method. RESULTS: The analysis demonstrated that the P2X2 receptor was expressed in the cytoplasm and in the nuclear and cytoplasmic membranes only in the CG. Neuronal density values (neuron/cm2) decreased 31% (CG: 6579 ± 837; OG: 4556 ± 407) and 16.5% (CG: 7796 ± 528; OG: 6513 ± 610) in the NOS-ir and calretinin-ir neurons in the OG, respectively (P < 0.05). Density of ChAT-ir (CG: 6200 ± 310; OG: 8125 ± 749) neurons significantly increased 31% in the OG (P < 0.05). Neuron size studies demonstrated that NOS, ChAT, and Calr-ir neurons did not differ significantly between the CG and OG groups. The examination of NADH-diaphorase-positive myenteric neurons revealed an overall similarity between the OG and CG. CONCLUSION: Obesity may exert its effects by promoting a decrease in P2X2 receptor expression and modifications in the density of the NOS-ir, ChAT-ir and CalR-ir myenteric neurons. PMID:25320527
Energy Technology Data Exchange (ETDEWEB)
Erkasap, N.; Ozkurt, M. [Department of Physiology, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Erkasap, S.; Yasar, F. [Department of General Surgery, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Uzuner, K. [Department of Physiology, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Ihtiyar, E. [Department of General Surgery, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Uslu, S.; Kara, M. [Department of Biochemistry, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Bolluk, O. [Department of Biostatistics, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey)
2013-03-19
The objective of the present study was to investigate the effect of leptin on the progression of colorectal carcinoma to metastatic disease by analyzing the serum leptin concentration and Ob-R gene expression in colon cancer tissues. Tissue samples were obtained from 31 patients who underwent surgical resection for colon (18 cases) and metastatic colon (13 cases) cancer. Serum leptin concentration was determined by an enzyme-linked immunosorbent assay (ELISA) and Ob-R mRNA expression by real-time polymerase chain reaction (RT-PCR) for both groups. ELISA data were analyzed by the Student t-test and RT-PCR data were analyzed by the Mann-Whitney U-test. RT-PCR results demonstrated that mRNA expression of Ob-R in human metastatic colorectal cancer was higher than in local colorectal cancer tissues. On the other hand, mean serum leptin concentration was significantly higher in local colorectal cancer patients compared to patients with metastatic colorectal cancer. The results of the present study suggest a role for leptin in the progression of colon cancer to metastatic disease without weight loss. In other words, significantly increased Ob-R mRNA expression and decreased serum leptin concentration in patients with metastatic colon cancer indicate that sensitization to leptin activity may be a major indicator of metastasis to the colon tissue and the determination of leptin concentration and leptin gene expression may be used to aid the diagnosis.
International Nuclear Information System (INIS)
Erkasap, N.; Ozkurt, M.; Erkasap, S.; Yasar, F.; Uzuner, K.; Ihtiyar, E.; Uslu, S.; Kara, M.; Bolluk, O.
2013-01-01
The objective of the present study was to investigate the effect of leptin on the progression of colorectal carcinoma to metastatic disease by analyzing the serum leptin concentration and Ob-R gene expression in colon cancer tissues. Tissue samples were obtained from 31 patients who underwent surgical resection for colon (18 cases) and metastatic colon (13 cases) cancer. Serum leptin concentration was determined by an enzyme-linked immunosorbent assay (ELISA) and Ob-R mRNA expression by real-time polymerase chain reaction (RT-PCR) for both groups. ELISA data were analyzed by the Student t-test and RT-PCR data were analyzed by the Mann-Whitney U-test. RT-PCR results demonstrated that mRNA expression of Ob-R in human metastatic colorectal cancer was higher than in local colorectal cancer tissues. On the other hand, mean serum leptin concentration was significantly higher in local colorectal cancer patients compared to patients with metastatic colorectal cancer. The results of the present study suggest a role for leptin in the progression of colon cancer to metastatic disease without weight loss. In other words, significantly increased Ob-R mRNA expression and decreased serum leptin concentration in patients with metastatic colon cancer indicate that sensitization to leptin activity may be a major indicator of metastasis to the colon tissue and the determination of leptin concentration and leptin gene expression may be used to aid the diagnosis
Directory of Open Access Journals (Sweden)
N. Erkasap
Full Text Available The objective of the present study was to investigate the effect of leptin on the progression of colorectal carcinoma to metastatic disease by analyzing the serum leptin concentration and Ob-R gene expression in colon cancer tissues. Tissue samples were obtained from 31 patients who underwent surgical resection for colon (18 cases and metastatic colon (13 cases cancer. Serum leptin concentration was determined by an enzyme-linked immunosorbent assay (ELISA and Ob-R mRNA expression by real-time polymerase chain reaction (RT-PCR for both groups. ELISA data were analyzed by the Student t-test and RT-PCR data were analyzed by the Mann-Whitney U-test. RT-PCR results demonstrated that mRNA expression of Ob-R in human metastatic colorectal cancer was higher than in local colorectal cancer tissues. On the other hand, mean serum leptin concentration was significantly higher in local colorectal cancer patients compared to patients with metastatic colorectal cancer. The results of the present study suggest a role for leptin in the progression of colon cancer to metastatic disease without weight loss. In other words, significantly increased Ob-R mRNA expression and decreased serum leptin concentration in patients with metastatic colon cancer indicate that sensitization to leptin activity may be a major indicator of metastasis to the colon tissue and the determination of leptin concentration and leptin gene expression may be used to aid the diagnosis.
Leptin signaling molecular actions and drug target in hepatocellular carcinoma
Directory of Open Access Journals (Sweden)
Jiang N
2014-11-01
Full Text Available Nan Jiang,1,* Rongtong Sun,2,* Qing Sun3 1Shandong University School of Medicine, Jinan, Shandong Province, People’s Republic of China; 2Weihai Municipal Hospital, Weihai, Shandong Province, People’s Republic of China; 3Department of Pathology, QianFoShan Hospital Affiliated to Shandong University, Jinan, Shandong Province, People’s Republic of China *These authors contributed equally to this work Abstract: Previous reports indicate that over 13 different tumors, including hepatocellular carcinoma (HCC, are related to obesity. Obesity-associated inflammatory, metabolic, and endocrine mediators, as well as the functioning of the gut microbiota, are suspected to contribute to tumorigenesis. In obese people, proinflammatory cytokines/chemokines including tumor necrosis factor-alpha, interleukin (IL-1 and IL-6, insulin and insulin-like growth factors, adipokines, plasminogen activator inhibitor-1, adiponectin, and leptin are found to play crucial roles in the initiation and development of cancer. The cytokines induced by leptin in adipose tissue or tumor cells have been intensely studied. Leptin-induced signaling pathways are critical for biological functions such as adiposity, energy balance, endocrine function, immune reaction, and angiogenesis as well as oncogenesis. Leptin is an activator of cell proliferation and anti-apoptosis in several cell types, and an inducer of cancer stem cells; its critical roles in tumorigenesis are based on its oncogenic, mitogenic, proinflammatory, and pro-angiogenic actions. This review provides an update of the pathological effects of leptin signaling with special emphasis on potential molecular mechanisms and therapeutic targeting, which could potentially be used in future clinical settings. In addition, leptin-induced angiogenic ability and molecular mechanisms in HCC are discussed. The stringent binding affinity of leptin and its receptor Ob-R, as well as the highly upregulated expression of both
Abundância de oxigênio no aglomerado do bojo NGC 6553, com dados Gemini-Phoenix
Barbuy, B.; Melendez, J.; Bica, E.; Zoccali, M.; Ortolani, S.; Renzini, A.; Hill, V.
2003-08-01
Excesso de elementos-alfa com relação ao ferro dá indicação de enriquecimento por supernovas de tipo II. Foram observadas 5 estrelas gigantes do aglomerado globular do bojo NGC 6553, com o espectrógrafo Phoenix no Gemini-Sul. Foram obtidos espectros na banda H, na região centrada em 1.555 mm, com Dl = 75 Å, a uma resolução R = 50 000. A análise detalhada consistiu em determinar temperaturas efetivas e gravidades usando fotometria VIJK, e as linhas de FeI para determinar velocidades de microturbulência e metalicidade [Fe/H]. Linhas de CO e OH foram sintetizadas e comparadas aos espectros observados. A análise resulta em [Fe/H] = -0.2, [O/Fe] = +0.2, mostrando portanto excesso do elemento-a oxigênio.
Dicty_cDB: Contig-U15883-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi
Hard X-ray Flux from Low-Mass Stars in the Cygnus OB2 Association
Caramazza, M.; Drake, J. J.; Micela, G.; Flaccomio, E.
2009-05-01
We investigate the X-ray emission in the 20-40 keV band expected from the flaring low-mass stellar population in Cygnus OB2 assuming that the observed soft X-ray emission is due to a superposition of flares and that the ratio of hard X-ray to soft X-ray emission is described by a scaling found for solar flares by Isola and co-workers. We estimate a low-mass stellar hard X-ray flux in the 20-40 keV band in the range ~7×1031-7×1033 erg/s and speculate the limit of this values. Hard X-ray emission could lie at a level not much below the current observed flux upper limits for Cygnus OB2. Simbol-X, with its broad energy band (10-100 keV) and its sensitivity should be able to detect this emission and would provide insights into the hard X-ray production of flares on pre-main sequence stars.
BOREAS TF-8 NSA-OJP and SSA-OBS Ceilometer Data
Moore, Kathleen E.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Fitzjarrald, David R.
2000-01-01
The BOREAS TF-8 team used ceilometers to collect data on the fraction of the sky covered with clouds and the cloud height. Included with these data is the surface-based lifting condensation level, derived from temperature and humidity values acquired at the flux tower at the NSA-OJP site. Ceilo-meter data were collected at the NSA-OJP site in 1994 and at the NSA-OJP and SSA-OBS sites in 1996. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).
General physical characteristics of the interstellar molecular gas
International Nuclear Information System (INIS)
Turner, B.E.
1979-01-01
The interstellar medium may be characterized by several physically rather distinct regimes: coronal gas, intercloud gas, diffuse clouds, isolated dark clouds and globules (of small to modest mass), more massive molecular clouds containing OB (and later) stars, and giant molecular clouds. Values of temperature, density, ionization fraction, mass, size, and velocity field are discussed for each regime. Heating and cooling mechanisms are reviewed. Nearly all molecular clouds exceed the Jeans criteria for gravitational instability, yet detailed models reveal no cases where observations can be interpreted unambiguously in terms of rapid collapse. The possibility that clouds are supported by turbulence, rotation, or magnetic fields is discussed, and it is concluded that none of these agencies suffice. Comments are made about fragmentation and star formation in molecular clouds, with possible explanations for why only low mass stars form in low mass clouds, why early-type stars form only in clouds with masses > approximately 10 3 M solar masses, and why O-stars seem to form near edges of clouds. Finally, large-scale interactions between molecular clouds and the galactic disk stellar population are discussed. (Auth.)
Oldenhuis, Roelof; Oedzes, Johannes Y.; Waarde, Jacob J. van der; Janssen, Dick B.
The kinetics of the degradation of trichloroethylene (TCE) and seven other chlorinated aliphatic hydrocarbons by Methylosinus trichosporium OB3b were studied. All experiments were performed with cells grown under copper stress and thus expressing soluble methane monooxygenase. Compounds that were
Oldenhuis, R.; Vink, Ruud L.J.M.; Janssen, D. B.; Witholt, B.
1989-01-01
Degradation of trichloroethylene (TCE) by the methanotrophic bacterium Methylosinus trichosporium OB3b was studied by using cells grown in continuous culture. TCE degradation was a strictly cometabolic process, requiring the presence of a cosubstrate, preferably formate, and oxygen. M. trichosporium
Gemini Spectra of Star Clusters in the Spiral Galaxy M101
Simanton-Coogan, Lesley A.; Chandar, Rupali; Miller, Bryan; Whitmore, Bradley C.
2017-12-01
We present low resolution, visible light spectra of 41 star clusters in the spiral galaxy M101, taken with the Gemini/GMOS instrument. We measure Lick indices for each cluster and compare with BaSTI models to estimate their ages and metallicities. We also measure the line-of-sight velocities. We find that 25 of the clusters are fairly young massive clusters (YMCs) with ages of hundreds of millions of years, and 16 appear to be older, globular clusters (GCs). There are at least four GCs with best-fit ages of ≈1–3 Gyr and eight with best-fit ages of ≈5–10 Gyr. The mean metallicity of the YMCs is [Fe/H] ≈ ‑0.1 and for the GCs is [Fe/H] ≈ ‑0.9. We find a near-continuous spread in both age and metallicity for our sample, which may indicate that M101 had a more-or-less continuous history of cluster and star formation. From the kinematics, we find that the YMCs rotate with the H I gas fairly well, while the GCs do not. We cannot definitively say whether the GCs sampled here lie in an inner halo, thick disk, or bulge/psuedobulge component, although given the very small bulge in M101, the last seems unlikely. The kinematics and ages of the YMCs suggest that M101 may have undergone heating of its disk or possibly a continuous merger/accretion history for the galaxy.
Directory of Open Access Journals (Sweden)
Betina Joyce Lew
2012-05-01
Full Text Available Objetivou-se com este trabalho avaliar os efeitos de uma dieta de alto nível de energia e proteína combinada com a aplicação de bST no perfil de expressão dos genes da leptina e de seu receptor Ob-Rb no parênquima mamário de novilhas leiteiras. Foram utilizadas amostras de parênquima mamário de 32 novilhas holandesas distribuídas aleatoriamente em quatro tratamentos (n=8: dieta com alto ou baixo teor de energia e proteína combinada ou não com a aplicação de bST. O delineamento utilizado foi em blocos casualizados com arranjo de tratamentos em esquema fatorial 2 × 2. A extração do RNA total das amostras de tecido foi feita e o nível de expressão gênica foi analisado por qRT-PCR utilizando-se o gene da glicuronidase β como controle, pelo método 2-ΔΔCt. Animais que receberam a dieta com alto conteúdo de energia e proteína apresentaram maior expressão de mRNA de leptina, com aumento de 56%, e menor expressão de mRNA do receptor Ob-Rb, com redução de 18%. Por outro lado, a aplicação de bST resultou em diminuição da expressão do mRNA de leptina e do receptor Ob-Rb em 74% e 23%, respectivamente. Não houve interação entre dieta e aplicação de bST. O aumento na expressão de leptina pode explicar, ao menos em parte, os efeitos negativos da dieta de alta energia e proteína, oferecida no período pré-púbere, sobre a produção de leite de novilhas leiteiras.The objective of this study was to examine the effects of a diet with high level of energy and protein, combined with bST injections, on leptin and leptin-receptor (Ob-Rb gene expression profile in the mammary parenchyma of dairy heifers. Mammary parenchyma samples from 32 Holstein heifers, randomly assigned to one of four treatments (n=8, were utilized: high or low energy and protein diet, with or without bST injection. The experiment was designed in randomized blocks and arranged in a 2 × 2 factorial arrangement. Total RNA was extracted from tissue samples
LARGE-SCALE CO MAPS OF THE LUPUS MOLECULAR CLOUD COMPLEX
International Nuclear Information System (INIS)
Tothill, N. F. H.; Loehr, A.; Stark, A. A.; Lane, A. P.; Harnett, J. I.; Bourke, T. L.; Myers, P. C.; Parshley, S. C.; Wright, G. A.; Walker, C. K.
2009-01-01
Fully sampled degree-scale maps of the 13 CO 2-1 and CO 4-3 transitions toward three members of the Lupus Molecular Cloud Complex-Lupus I, III, and IV-trace the column density and temperature of the molecular gas. Comparison with IR extinction maps from the c2d project requires most of the gas to have a temperature of 8-10 K. Estimates of the cloud mass from 13 CO emission are roughly consistent with most previous estimates, while the line widths are higher, around 2 km s -1 . CO 4-3 emission is found throughout Lupus I, indicating widespread dense gas, and toward Lupus III and IV. Enhanced line widths at the NW end and along the edge of the B 228 ridge in Lupus I, and a coherent velocity gradient across the ridge, are consistent with interaction between the molecular cloud and an expanding H I shell from the Upper-Scorpius subgroup of the Sco-Cen OB Association. Lupus III is dominated by the effects of two HAe/Be stars, and shows no sign of external influence. Slightly warmer gas around the core of Lupus IV and a low line width suggest heating by the Upper-Centaurus-Lupus subgroup of Sco-Cen, without the effects of an H I shell.
Masarie, K. A.; Peters, W.; Jacobson, A. R.; Tans, P. P.
2014-01-01
Observation Package (ObsPack) is a framework designed to bring together atmospheric greenhouse gas observations from a variety of sampling platforms, prepare them with specific applications in mind, and package and distribute them in a self-consistent and well-documented product. Data products
Masarie, K. A.; Peters, W.; Jacobson, A. R.; Tans, P. P.
2014-01-01
Observation Package (ObsPack) is a framework designed to bring together atmospheric greenhouse gas observations from a variety of sampling platforms, prepare them with specific applications in mind, and package and distribute them in a self-consistent and well-documented product. Data products
Currie, Thayne; Cloutier, Ryan; Brittain, Sean; Grady, Carol; Burrows, Adam; Muto, Takayuki; Kenyon, Scott J.; Kuchner, Marc J.
2015-01-01
We report Gemini Planet Imager H band high-contrast imaging/integral field spectroscopy and polarimetry of the HD 100546, a 10 $Myr$-old early-type star recently confirmed to host a thermal infrared bright (super)jovian protoplanet at wide separation, HD 100546 b. We resolve the inner disk cavity in polarized light, recover the thermal-infrared (IR) bright arm, and identify one additional spiral arm. We easily recover HD 100546 b and show that much of its emission originates an unresolved, po...
International Nuclear Information System (INIS)
Sayles, F.L.; Kenna, T.C.; Livingston, H.D.
1999-01-01
Studies of sediment cores from lakes on the flood plain of the Ob River, Siberia have been used to develop a history of the release, transport, and deposition of artificial radionuclides related to the development and testing of nuclear weapons over the duration of the nuclear age (∼1950 to the present) in this major Arctic river system. The Ob is of particular importance in this regard as two of the former Soviet Union's major weapons production plants, Mayak and Tomsk-7, and the Semipalatinsk test site are located within the Ob drainage basin. Accidents and intentional releases of radionuclides at both plants have been substantial, raising the issue of transport throughout this extensive river system as well as delivery to the Arctic Ocean. Our studies have included determining sediment profiles of 239,240 Pu, 137 Cs, and the natural nuclide 210 Pb and its parent 226 Ra in a number of cores from the Ob delta, as well as analysis of 239 Pu, 240 Pu, and 237 Np. The latter provide sensitive measures of the presence of non-fallout materials derived from weapons production activities
Lgl1 Is Required for Olfaction and Development of Olfactory Bulb in Mice
Li, Zhenzu; Zhang, Tingting; Lin, Zhuchun; Hou, Congzhe; Zhang, Jian; Men, Yuqin; Li, Huashun
2016-01-01
Lethal giant larvae 1 (Lgl1) was initially identified as a tumor suppressor in Drosophila and functioned as a key regulator of epithelial polarity and asymmetric cell division. In this study, we generated Lgl1 conditional knockout mice mediated by Pax2-Cre, which is expressed in olfactory bulb (OB). Next, we examined the effects of Lgl1 loss in the OB. First, we determined the expression patterns of Lgl1 in the neurogenic regions of the embryonic dorsal region of the LGE (dLGE) and postnatal OB. Furthermore, the Lgl1 conditional mutants exhibited abnormal morphological characteristics of the OB. Our behavioral analysis exhibited greatly impaired olfaction in Lgl1 mutant mice. To elucidate the possible mechanisms of impaired olfaction in Lgl1 mutant mice, we investigated the development of the OB. Interestingly, reduced thickness of the MCL and decreased density of mitral cells (MCs) were observed in Lgl1 mutant mice. Additionally, we observed a dramatic loss in SP8+ interneurons (e.g. calretinin and GABAergic/non-dopaminergic interneurons) in the GL of the OB. Our results demonstrate that Lgl1 is required for the development of the OB and the deletion of Lgl1 results in impaired olfaction in mice. PMID:27603780
New Partner Recruitment to Rural Versus Urban Ob-Gyn Practices
Directory of Open Access Journals (Sweden)
Michael F. Fialkow
2017-09-01
Full Text Available Purpose: The purpose of this pilot study was to investigate the recruitment efforts of practicing obstetrics and gynecology (ob-gyns from rural and urban practices. Method: The authors surveyed practicing ob-gyns from 5 states in the Pacific Northwest in 2016 about their background, practice setting, practice profile, partner recruitment, and retention. Results: Seventy-three patients completed the study (53.2% response rate. Thirty-seven percent of respondents work in an urban practice and 43% have a rural practice, with the remainder in a suburban setting. A majority of the respondents attempted to recruit a new partner in the past 5 years. Respondents were most interested in experience and diversity in new recruits. Urban respondents, however, were more interested in hiring those with specialized skills (χ 2 = 7.842, P = .02 than rural providers who were more interested in partners familiar with their community (χ 2 = 7.153, P = .03. Reasons most often cited to leave their practice were reimbursement, limited social/marital options, and workload, other than rural providers who more often also cited lack of access to specialty care (χ 2 = 13.256, P = .001. Rural providers were more likely to cite marital and family status as an advantage to recruitment, whereas urban and suburban providers were more often neutral. Conclusions: Reduced access to care has led to significant health disparities for women living in rural communities. Understanding which providers are most likely to be successful in these settings might help preserve access as our health-care systems evolves.
Effect of chlorinated ethene conversion on viability and activity of Methylosinus trichosporium OB3b
van Hylckama Vlieg, Johan E.T.; Koning, Wim de; Janssen, Dick B.
1997-01-01
The effect of transformation of chlorinated ethenes on the cell viability of Methylosinus trichosporium OB3b was investigated. A comparison of the loss of viability with the decrease in transformation rates shelved that for the monooxygenase-mediated transformation of all chlorinated ethenes except
Massicotte, Frédéric; Fernandes, Julio Cesar; Martel-Pelletier, Johanne; Pelletier, Jean-Pierre; Lajeunesse, Daniel
2006-03-01
Human osteoarthritis (OA) is characterized by cartilage loss, bone sclerosis, osteophyte formation and inflammation of the synovial membrane. We previously reported that OA osteoblasts (Ob) show abnormal phenotypic characteristics possibly responsible for bone sclerosis and that two subgroups of OA patients can be identified by low or high endogenous production of prostaglandin E2 (PGE2) by OA Ob. Here, we determined that the elevated PGE2 levels in the high OA subgroup were linked with enhanced cyclooxygenase-2 (COX-2) protein levels compared to normal and low OA Ob. A linear relationship was observed between endogenous PGE2 levels and insulin-like growth factor 1 (IGF-1) levels in OA Ob. As parathyroid hormone (PTH) and PGE2 are known stimulators of IGF-1 production in Ob, we next evaluated their effect in OA Ob. Both subgroups increased their IGF-1 production similarly in response to PGE2, while the high OA subgroup showed a blunted response to PTH compared to the low OA group. Conversely, only the high OA group showed a significant inhibition of IGF-1 production when PGE2 synthesis was reduced with Naproxen, a non-steroidal antiinflammatory drug (NSAID) that inhibits cyclooxygenases (COX). The PGE2-dependent stimulation of IGF-1 synthesis was due in part to the cAMP/protein kinase A pathway since both the direct inhibition of this pathway with H-89 and the inhibition of EP2 or EP4 receptors, linked to cAMP production, reduced IGF-1 synthesis. The production of the most abundant IGF-1 binding proteins (IGFBPs) in bone tissue, IGFBP-3, -4, and -5, was lower in OA compared to normal Ob independently of the OA group. Under basal condition, OA Ob expressed similar IGF-1 mRNA to normal Ob; however, PGE2 stimulated IGF-1 mRNA expression more in OA than normal Ob. These data suggest that increased IGF-1 levels correlate with elevated endogenous PGE2 levels in OA Ob and that higher IGF-1 levels in OA Ob could be important for bone sclerosis in OA.
Clarifying the Status of HD 100546 as Observed by the Gemini Planet Imager
Currie, Thayne; Brittain, Sean; Grady, Carol A.; Kenyon, Scott J.; Muto, Takayuki
2017-12-01
HD 100546 is a young, early-type star and key laboratory for studying gas giant planet formation. GPI data taken in 2015 and reported by Currie et al. (2015) recover the previously-identified protoplanet candidate HD 100546 b and identify a second emission source at ~13--14 au: either a disk hot spot or a second protoplanetary candidate (HD 100546 "c"). In this short research note, we update the status of HD 100546 as observed by the Gemini Planet Imager by rereducing our original data using a different PSF subtraction method (KLIP instead of A-LOCI), rereducing recently public GPI Campaign Team (GPIES) data, and comparing the quality of the two data sets. Our results support the original findings in Currie et al. (2015).
Dropping Probability Reduction in OBS Networks: A Simple Approach
Elrasad, Amr
2016-08-01
In this paper, we propose and derive a slotted-time model for analyzing the burst blocking probability in Optical Burst Switched (OBS) networks. We evaluated the immediate and delayed signaling reservation schemes. The proposed model compares the performance of both just-in-time (JIT) and just-enough-time (JET) signaling protocols associated with of void/non-void filling link scheduling schemes. It also considers none and limited range wavelength conversions scenarios. Our model is distinguished by being adaptable to different offset-time and burst length distributions. We observed that applying a limited range of wavelength conversion, burst blocking probability is reduced by several orders of magnitudes and yields a better burst delivery ratio compared with full wavelength conversion.
Gels and gel-derived glasses in the Na2O-B2O3-SiO2 system. [containerless melting in space
Mukherjee, S. P.
1982-01-01
The containerless melting of high-purity multicomponent homogeneous gels and gel-monoliths offers a unique approach to making ultrapure multicomponent optical glasses in the reduced gravity environment of space. Procedures for preparing and characterizing gels and gel-derived glasses in the Na2O-B2O3-SiO2 system are described. Preparation is based on the polymerization reactions of alkoxysilane with trimethyl borate or boric acid and a suitable sodium compound. The chemistry of the gelling process is discussed in terms of process parameters and the gel compositions. The physicochemical nature of gels prepared by three different procedures were found to be significantly different. IR absorption spectra indicate finite differences in the molecular structures of the different gels. The melting of the gel powders and the transformation of porous gel-monoliths to transparent 'glass' without melting are described.
Omentin-1 Stimulates Human Osteoblast Proliferation through PI3K/Akt Signal Pathway
Directory of Open Access Journals (Sweden)
Shan-Shan Wu
2013-01-01
Full Text Available It has been presumed that adipokines deriving from adipose tissue may play important roles in bone metabolism. Omentin-1, a novel adipokine, which is selectively expressed in visceral adipose tissue, has been reported to stimulate proliferation and inhibit differentiation of mouse osteoblast. However, little information refers to the effect of omentin-1 on human osteoblast (hOB proliferation. The current study examined the potential effects of omentin-1 on proliferation in hOB and the signal pathway involved. Omentin-1 promoted hOB proliferation in a dose-dependent manner as determined by [3H]thymidine incorporation. Western blot analysis revealed that omentin-1 induced activation of Akt (phosphatidylinositol-3 kinase downstream effector and such effect was impeded by transfection of hOB with Akt-siRNA. Furthermore, LY294002 (a selective PI3K inhibitor and HIMO (a selective Akt inhibitor abolished the omentin-1-induced hOB proliferation. These findings indicate that omentin-1 induces hOB proliferation via the PI3K/Akt signaling pathway and suggest that osteoblast is a direct target of omentin-1.
WNIN/GR-Ob - an insulin-resistant obese rat model from inbred WNIN strain.
Harishankar, N; Vajreswari, A; Giridharan, N V
2011-09-01
WNIN/GR-Ob is a mutant obese rat strain with impaired glucose tolerance (IGT) developed at the National Institute of Nutrition (NIN), Hyderabad, India, from the existing 80 year old Wistar rat (WNIN) stock colony. The data presented here pertain to its obese nature along with IGT trait as evidenced by physical, physiological and biochemical parameters. The study also explains its existence, in three phenotypes: homozygous lean (+/+), heterozygous carrier (+/-) and homozygous obese (-/-). Thirty animals (15 males and 15 females) from each phenotype (+/+, +/-, -/-) and 24 lean and obese (6 males and 6 females) rats were taken for growth and food intake studies respectively. Twelve adult rats from each phenotype were taken for body composition measurement by total body electrical conductivity (TOBEC); 12 rats of both genders from each phenotype at different ages were taken for clinical chemistry parameters. Physiological indices of insulin resistance were calculated according to the homeostasis model assessment for insulin resistance (HOMA-IR) and also by studying U¹⁴C 2-deoxy glucose uptake (2DG). WNINGR-Ob mutants had high growth, hyperphagia, polydipsia, polyurea, glycosuria, and significantly lower lean body mass, higher fat mass as compared with carrier and lean rats. These mutants, at 50 days of age displayed abnormal response to glucose load (IGT), hyperinsulinaemia, hypertriglyceridaemia, hypercholesterolaemia and hyperleptinaemia. Basal and insulin-stimulated glucose uptakes by diaphragm were significantly decreased in obese rats as compared with lean rats. Obese rats of the designated WNIN/GR-Ob strain showed obesity with IGT, as adjudged by physical, physiological and biochemical indices. These indices varied among the three phenotypes, being lowest in lean, highest in obese and intermediate in carrier phenotypes thereby suggesting that obesity is inherited as autosomal incomplete dominant trait in this strain. This mutant obese rat model is easy to
Fisicaro, Emilia; Compari, Carlotta; Bacciottini, Franco; Contardi, Laura; Pongiluppi, Erika; Barbero, Nadia; Viscardi, Guido; Quagliotto, Pierluigi; Donofrio, Gaetano; Krafft, Marie Pierre
2017-02-01
Biological and thermodynamic properties of a new homologous series of highly fluorinated bispyridinium cationic gemini surfactants, differing in the length of the spacer bridging the pyridinium polar heads in 1,1' position, are reported for the first time. Interestingly, gene delivery ability is closely associated with the spacer length due to a structural change of the molecule in solution. This conformation change is allowed when the spacer reaches the right length, and it is suggested by the trends of the apparent and partial molar enthalpies vs molality. To assess the compounds' biological activity, they were tested with an agarose gel electrophoresis mobility shift assay (EMSA), MTT proliferation assay and Transient Transfection assays on a human rhabdomyosarcoma cell line. Data from atomic force microscopy (AFM) allow for morphological characterization of DNA nanoparticles. Dilution enthalpies, measured at 298K, enabled the determination of apparent and partial molar enthalpies vs molality. All tested compounds (except that with the longest spacer), at different levels, can deliver the plasmid when co-formulated with 1,2-dioleyl-sn-glycero-3-phosphoethanolamine (DOPE). The compound with a spacer formed by eight carbon atoms gives rise to a gene delivery ability that is comparable to that of the commercial reagent. The compound with the longest spacer compacts DNA in loosely condensed structures by forming bows, which are not suitable for transfection. Regarding the compounds' hydrogenated counterparts, the tight relationship between the solution thermodynamics data and their biological performance is amazing, making "old" methods the foundation to deeply understanding "new" applications. Copyright © 2016 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Kobulnicky, Henry A.; Lundquist, Michael J.; Burke, Jamison; Chapman, James; Keller, Erica; Lester, Kathryn; Rolen, Emily K.; Topel, Eric; Bhattacharjee, Anirban; Smullen, Rachel A.; Álvarez, Carlos A. Vargas; Runnoe, Jessie C.; Dale, Daniel A.; Brotherton, Michael M. [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82070 (United States); Kiminki, Daniel C., E-mail: chipk@uwyo.edu, E-mail: jburke2@swarthmore.edu, E-mail: jc6380@mcla.edu, E-mail: kelle22e@mtholyoke.edu, E-mail: kvl214@lehigh.edu, E-mail: emily.k.rolen@vanderbilt.edu, E-mail: topel@stolaf.edu [Department of Astronomy, University of Arizona, Tucson, AZ 85721 (United States)
2014-08-01
We analyze orbital solutions for 48 massive multiple-star systems in the Cygnus OB2 association, 23 of which are newly presented here, to find that the observed distribution of orbital periods is approximately uniform in log P for P < 45 days, but it is not scale-free. Inflections in the cumulative distribution near 6 days, 14 days, and 45 days suggest key physical scales of ≅0.2, ≅0.4, and ≅1 A.U. where yet-to-be-identified phenomena create distinct features. No single power law provides a statistically compelling prescription, but if features are ignored, a power law with exponent β ≅ –0.22 provides a crude approximation over P = 1.4-2000 days, as does a piece-wise linear function with a break near 45 days. The cumulative period distribution flattens at P > 45 days, even after correction for completeness, indicating either a lower binary fraction or a shift toward low-mass companions. A high degree of similarity (91% likelihood) between the Cyg OB2 period distribution and that of other surveys suggests that the binary properties at P ≲ 25 days are determined by local physics of disk/clump fragmentation and are relatively insensitive to environmental and evolutionary factors. Fully 30% of the unbiased parent sample is a binary with period P < 45 days. Completeness corrections imply a binary fraction near 55% for P < 5000 days. The observed distribution of mass ratios 0.2 < q < 1 is consistent with uniform, while the observed distribution of eccentricities 0.1 < e < 0.6 is consistent with uniform plus an excess of e ≅ 0 systems. We identify six stars, all supergiants, that exhibit aperiodic velocity variations of ∼30 km s{sup –1} attributed to atmospheric fluctuations.
Trapeznikov, A V; Korzhavin, A V; Trapeznikova, V N; Nikolkin, V N
2016-01-01
Mathematical models of horizontal distribution and migration of radionuclides are presented in water and floodplain soils of the Samson-Lev-Vandras river system related to the Ob-Irtysh river basin. Integral inventory of radionuclides in the main components of the river ecosystems is calculated. The estimated annual discharge of radionuclides from the Vandras river to the Great Salym river is given. The effect of the removal of man-made radionuclides in the Samson, Lev, Vandras rivers on radioactive contamination of the Ob-Irtysh river system is shown in comparison with the Techa river, that also belongs to the Ob-Irtysh river basin. Despite the presence of an additional radioactive contamination of the Samson floodplain, the transfer of radioactive substances in the Samson, Lev, Vandras rivers has a much smaller impact on the contamination of the Ob-Irtysh river system, compared to the Techa river, prone to a large-scale radioactive contamination.
Analytical model of a burst assembly algorithm for the VBR in the OBS networks
International Nuclear Information System (INIS)
Shargabi, M.A.A.; Mellah, H.; Abid, A.
2008-01-01
This paper presents a proposed analytical model for the number of bursts aggregated in a period of time in OBS networks. The model considers the case of VBR traffic with two different sending rates, which are SCR and PCR. The model is validated using extensive simulations. Where results from simulations are in total agreement with the results obtained by the proposed model. (author)
Testing the Planet-Metallicity Correlation in M-dwarfs with Gemini GNIRS Spectra
Hobson, M. J.; Jofré, E.; García, L.; Petrucci, R.; Gómez, M.
2018-04-01
While the planet-metallicity correlation for FGK main-sequence stars hosting giant planets is well established, it is less clear for M-dwarf stars. We determine stellar parameters and metallicities for 16 M-dwarf stars, 11 of which host planets, with near-infrared spectra from the Gemini Near-Infrared Spectrograph (GNIRS). We find that M-dwarfs with planets are preferentially metal-rich compared to those without planets. This result is supported by the analysis of a larger catalogue of 18 M stars with planets and 213 M stars without known planets T15, and demonstrates the utility of GNIRS spectra to obtain reliable stellar parameters of M stars. We also find that M dwarfs with giant planets are preferentially more metallic than those with low-mass planets, in agreement with previous results for solar-type stars. These results favor the core accretion model of planetary formation.
UNVEILING THE NEW GENERATION OF STARS IN NGC 604 WITH GEMINI-NIRI
Energy Technology Data Exchange (ETDEWEB)
Farina, Cecilia; Bosch, Guillermo L. [Facultad de Ciencias Astronomicas y Geofisicas, Universidad Nacional de La Plata, Paseo de Bosque S/N (B1900FWA), La Plata (Argentina); Barba, Rodolfo H., E-mail: ceciliaf@fcaglp.unlp.edu.ar [Instituto de Ciencias Astronomicas, de la Tierra y del Espacio (ICATE-CONICET), Av. Espana Sur 1512 (J5402DSP), San Juan (Argentina)
2012-02-15
We present a near-infrared study focused on the detection and characterization of the youngest stellar component of the NGC 604 giant star-forming region in the Triangulum galaxy (M 33). By means of color-color diagrams derived from the photometry of JHK{sub s} images taken with the Gemini Near Infrared Imaging and Spectrometer (NIRI), we have found 68 candidate massive young stellar objects. The spatial distribution of these sources matches the areas where previous studies suggested that star formation might be taking place, and the high spatial resolution of our deep NIRI imaging allows us to pinpoint the star-forming knots. An analysis of the fraction of objects that show infrared excess suggests that the star formation is still active, supporting the presence of a second generation of stars being born, although the evidence for or against sequential star formation does not seem to be conclusive.
UNVEILING THE NEW GENERATION OF STARS IN NGC 604 WITH GEMINI-NIRI
International Nuclear Information System (INIS)
Fariña, Cecilia; Bosch, Guillermo L.; Barbá, Rodolfo H.
2012-01-01
We present a near-infrared study focused on the detection and characterization of the youngest stellar component of the NGC 604 giant star-forming region in the Triangulum galaxy (M 33). By means of color-color diagrams derived from the photometry of JHK s images taken with the Gemini Near Infrared Imaging and Spectrometer (NIRI), we have found 68 candidate massive young stellar objects. The spatial distribution of these sources matches the areas where previous studies suggested that star formation might be taking place, and the high spatial resolution of our deep NIRI imaging allows us to pinpoint the star-forming knots. An analysis of the fraction of objects that show infrared excess suggests that the star formation is still active, supporting the presence of a second generation of stars being born, although the evidence for or against sequential star formation does not seem to be conclusive.
Small Galactic H II regions. II. The molecular clouds and star formation
International Nuclear Information System (INIS)
Hunter, D.A.; Thronson, H.A. Jr.; Wilton, C.
1990-01-01
CO maps of molecular clouds associated with 11 small Galactic H II regions are presented and compared with IR images obtained by IRAS. The molecular masses of the clouds are computed and compared with the masses of the stellar content. The mapped clouds have masses of 1000-60,000 solar and are typical of the more numerous, smaller Galactic molecular clouds. All of the clouds have recently made massive OB stars, and many have complex spatial and kinematic structures. The coincidence of IRAS sources and CO peaks suggests that many of the clouds have sites of star formation other than the optically visible H II region. Star-formation efficiencies are uncertain, with values for the clouds ranging from 0.02 to 0.6 with an average value of 0.2. There is no trend of the upper stellar mass limit with Galactic radius and with molecular cloud mass. 53 refs
La binaria LSS 3074 y su entorno: ?`una nueva asociación OB?
Niemela, V.; Morrell, N.; Corti, M.
En este trabajo presentamos un nuevo análisis orbital de LSS~3074, junto con tipos espectrales y velocidades radiales de estrellas que podrían constituir con ella una nueva asociación OB. La estrella O4f LSS3074 fue descubierta como binaria espectroscópica de corto período y líneas dobles por Morrell & Niemela (1990, ASP Conf. Ser. 7, 57). Posteriormente, Haefner et~al.(1994, IBVS 3969) encontraron variaciones fotométricas, estimando una inclinación orbital entre 50o y 55o. Teniendo en cuenta la importancia de obtener valores empíricos para las masas de estrellas O tempranas, y considerando la gran dispersión existente entre los valores observados y su discrepancia con los predichos por los modelos teóricos, hemos obtenido nuevas observaciones espectroscópicas de este sistema, con el propósito de mejorar los elementos orbitales derivados en la solución preliminar. Además, como las estrellas O tempranas suelen formar parte de cúmulos y asociaciones OB, hemos llevado a cabo una investigación espectroscópica de varias estrellas tempranas que podrían estar físicamente relacionadas con LSS~3074.
Johnsson, M; Wagenaar, A; Engberts, JBFN
2003-01-01
A sugar-based (reduced glucose) gemini surfactant forms vesicles in dilute aqueous solution near neutral pH. At lower pH, there is a vesicle-to-micelle transition within a narrow pH region (pH 6.0-5.6). The vesicles are transformed into large cylindrical micelles that in turn are transformed into
Shen, Junyu; Wang, Mei; Gao, Jinsuo; Han, Hongxian; Liu, Hong; Sun, Licheng
2017-11-23
Two copper complexes, [(L1)Cu(OH 2 )](BF 4 ) 2 [1; L1=N,N'-dimethyl-N,N'-bis(pyridin-2-ylmethyl)-1,2-diaminoethane] and [(L2)Cu(OH 2 )](BF 4 ) 2 [2, L2=2,7-bis(2-pyridyl)-3,6-diaza-2,6-octadiene], were prepared as molecular water oxidation catalysts. Complex 1 displayed an overpotential (η) of 1.07 V at 1 mA cm -2 and an observed rate constant (k obs ) of 13.5 s -1 at η 1.0 V in pH 9.0 phosphate buffer solution, whereas 2 exhibited a significantly smaller η (0.70 V) to reach 1 mA cm -2 and a higher k obs (50.4 s -1 ) than 1 under identical test conditions. Additionally, 2 displayed better stability than 1 in controlled potential electrolysis experiments with a faradaic efficiency of 94 % for O 2 evolution at 1.58 V, when a casing tube was used for the Pt cathode. A possible mechanism for 1- and 2-catalyzed O 2 evolution reactions is discussed based on the experimental evidence. These comparative results indicate that fine-tuning the structures of tetradentate N 4 ligands can bring about significant change in the performance of copper complexes for electrochemical water oxidation. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Oskinova, L. M.; Hamann, W.-R.; Shenar, T.; Sander, A. A. C.; Todt, H.; Hainich, R. [Institute for Physics and Astronomy, University Potsdam, D-14476 Potsdam (Germany); Huenemoerder, D. P. [Massachusetts Institute of Technology, Kavli Institute for Astrophysics and Space Research, 70 Vassar St., Cambridge, MA 02139 (United States); Ignace, R., E-mail: lida@astro.physik.uni-potsdam.de [Department of Physics and Astronomy, East Tennessee State University, Johnson City, TN 37663 (United States)
2017-08-10
The blue hypergiant Cyg OB2 12 (B3Ia{sup +}) is a representative member of the class of very massive stars in a poorly understood evolutionary stage. We obtained its high-resolution X-ray spectrum using the Chandra observatory. PoWR model atmospheres were calculated to provide realistic wind opacities and to establish the wind density structure. We find that collisional de-excitation is the dominant mechanism depopulating the metastable upper levels of the forbidden lines of the He-like ions Si xiv and Mg xii. Comparison between the model and observations reveals that X-ray emission is produced in a dense plasma, which could reside only at the photosphere or in a colliding wind zone between binary components. The observed X-ray spectra are well-fitted by thermal plasma models, with average temperatures in excess of 10 MK. The wind speed in Cyg OB2 12 is not high enough to power such high temperatures, but the collision of two winds in a binary system can be sufficient. We used archival data to investigate the X-ray properties of other blue hypergiants. In general, stars of this class are not detected as X-ray sources. We suggest that our new Chandra observations of Cyg OB2 12 can be best explained if Cyg OB2 12 is a colliding wind binary possessing a late O-type companion. This makes Cyg OB2 12 only the second binary system among the 16 known Galactic hypergiants. This low binary fraction indicates that the blue hypergiants are likely products of massive binary evolution during which they either accreted a significant amount of mass or already merged with their companions.
LUMINOSITY FUNCTIONS OF SPITZER-IDENTIFIED PROTOSTARS IN NINE NEARBY MOLECULAR CLOUDS
Energy Technology Data Exchange (ETDEWEB)
Kryukova, E.; Megeath, S. T.; Allen, T. S. [Department of Physics and Astronomy, University of Toledo, Toledo, OH (United States); Gutermuth, R. A. [Department of Astronomy, University of Massachusetts, Amherst, MA (United States); Pipher, J. [Department of Physics and Astronomy, University of Rochester, Rochester, NY (United States); Allen, L. E. [National Optical Astronomy Observatories, Tucson, AZ (United States); Myers, P. C. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Muzerolle, J. [Space Telescope Science Institute, Baltimore, MD (United States)
2012-08-15
We identify protostars in Spitzer surveys of nine star-forming (SF) molecular clouds within 1 kpc: Serpens, Perseus, Ophiuchus, Chamaeleon, Lupus, Taurus, Orion, Cep OB3, and Mon R2, which combined host over 700 protostar candidates. These clouds encompass a variety of SF environments, including both low-mass and high-mass SF regions, as well as dense clusters and regions of sparsely distributed star formation. Our diverse cloud sample allows us to compare protostar luminosity functions in these varied environments. We combine near- and mid-infrared photometry from the Two Micron All Sky Survey and Spitzer to create 1-24 {mu}m spectral energy distributions (SEDs). Using protostars from the c2d survey with well-determined bolometric luminosities, we derive a relationship between bolometric luminosity, mid-IR luminosity (integrated from 1-24 {mu}m), and SED slope. Estimations of the bolometric luminosities for protostar candidates are combined to create luminosity functions for each cloud. Contamination due to edge-on disks, reddened Class II sources, and galaxies is estimated and removed from the luminosity functions. We find that luminosity functions for high-mass SF clouds (Orion, Mon R2, and Cep OB3) peak near 1 L{sub Sun} and show a tail extending toward luminosities above 100 L{sub Sun }. The luminosity functions of the low-mass SF clouds (Serpens, Perseus, Ophiuchus, Taurus, Lupus, and Chamaeleon) do not exhibit a common peak, however the combined luminosity function of these regions peaks below 1 L{sub Sun }. Finally, we examine the luminosity functions as a function of the local surface density of young stellar objects. In the Orion molecular clouds, we find a significant difference between the luminosity functions of protostars in regions of high and low stellar density, the former of which is biased toward more luminous sources. This may be the result of primordial mass segregation, although this interpretation is not unique. We compare our luminosity
LUMINOSITY FUNCTIONS OF SPITZER-IDENTIFIED PROTOSTARS IN NINE NEARBY MOLECULAR CLOUDS
International Nuclear Information System (INIS)
Kryukova, E.; Megeath, S. T.; Allen, T. S.; Gutermuth, R. A.; Pipher, J.; Allen, L. E.; Myers, P. C.; Muzerolle, J.
2012-01-01
We identify protostars in Spitzer surveys of nine star-forming (SF) molecular clouds within 1 kpc: Serpens, Perseus, Ophiuchus, Chamaeleon, Lupus, Taurus, Orion, Cep OB3, and Mon R2, which combined host over 700 protostar candidates. These clouds encompass a variety of SF environments, including both low-mass and high-mass SF regions, as well as dense clusters and regions of sparsely distributed star formation. Our diverse cloud sample allows us to compare protostar luminosity functions in these varied environments. We combine near- and mid-infrared photometry from the Two Micron All Sky Survey and Spitzer to create 1-24 μm spectral energy distributions (SEDs). Using protostars from the c2d survey with well-determined bolometric luminosities, we derive a relationship between bolometric luminosity, mid-IR luminosity (integrated from 1-24 μm), and SED slope. Estimations of the bolometric luminosities for protostar candidates are combined to create luminosity functions for each cloud. Contamination due to edge-on disks, reddened Class II sources, and galaxies is estimated and removed from the luminosity functions. We find that luminosity functions for high-mass SF clouds (Orion, Mon R2, and Cep OB3) peak near 1 L ☉ and show a tail extending toward luminosities above 100 L ☉ . The luminosity functions of the low-mass SF clouds (Serpens, Perseus, Ophiuchus, Taurus, Lupus, and Chamaeleon) do not exhibit a common peak, however the combined luminosity function of these regions peaks below 1 L ☉ . Finally, we examine the luminosity functions as a function of the local surface density of young stellar objects. In the Orion molecular clouds, we find a significant difference between the luminosity functions of protostars in regions of high and low stellar density, the former of which is biased toward more luminous sources. This may be the result of primordial mass segregation, although this interpretation is not unique. We compare our luminosity functions to those
Riffel, R. A.; Storchi-Bergmann, T.; Riffel, R.; Davies, R.; Bianchin, M.; Diniz, M. R.; Schönell, A. J.; Burtscher, L.; Crenshaw, M.; Fischer, T. C.; Dahmer-Hahn, L. G.; Dametto, N. Z.; Rosario, D.
2018-02-01
We present and characterize a sample of 20 nearby Seyfert galaxies selected for having BAT 14-195 keV luminosities LX ≥ 1041.5 erg s-1, redshift z ≤ 0.015, being accessible for observations with the Gemini Near-Infrared Field Spectrograph (NIFS) and showing extended [O III]λ5007 emission. Our goal is to study Active Galactic Nucleus (AGN) feeding and feedback processes from near-infrared integral-field spectra, which include both ionized (H II) and hot molecular (H2) emission. This sample is complemented by other nine Seyfert galaxies previously observed with NIFS. We show that the host galaxy properties (absolute magnitudes MB, MH, central stellar velocity dispersion and axial ratio) show a similar distribution to those of the 69 BAT AGN. For the 20 galaxies already observed, we present surface mass density (Σ) profiles for H II and H2 in their inner ˜500 pc, showing that H II emission presents a steeper radial gradient than H2. This can be attributed to the different excitation mechanisms: ionization by AGN radiation for H II and heating by X-rays for H2. The mean surface mass densities are in the range (0.2 ≤ ΣH II ≤ 35.9) M⊙ pc-2, and (0.2 ≤ ΣH2 ≤ 13.9)× 10-3 M⊙ pc-2, while the ratios between the H II and H2 masses range between ˜200 and 8000. The sample presented here will be used in future papers to map AGN gas excitation and kinematics, providing a census of the mass inflow and outflow rates and power as well as their relation with the AGN luminosity.
SPT-GMOS: A GEMINI/GMOS-SOUTH SPECTROSCOPIC SURVEY OF GALAXY CLUSTERS IN THE SPT-SZ SURVEY
International Nuclear Information System (INIS)
Bayliss, M. B.; Ruel, J.; Stubbs, C. W.; Allen, S. W.; Applegate, D. E.; Ashby, M. L. N.; Bautz, M.; Benson, B. A.; Carlstrom, J. E.; Chang, C. L.; Crawford, T. M.; Bleem, L. E.; Bocquet, S.; Brodwin, M.; Capasso, R.; Chiu, I.; Cho, H-M.; Clocchiatti, A.; Crites, A. T.; Haan, T. de
2016-01-01
We present the results of SPT-GMOS, a spectroscopic survey with the Gemini Multi-Object Spectrograph (GMOS) on Gemini South. The targets of SPT-GMOS are galaxy clusters identified in the SPT-SZ survey, a millimeter-wave survey of 2500 deg 2 of the southern sky using the South Pole Telescope (SPT). Multi-object spectroscopic observations of 62 SPT-selected galaxy clusters were performed between 2011 January and 2015 December, yielding spectra with radial velocity measurements for 2595 sources. We identify 2243 of these sources as galaxies, and 352 as stars. Of the galaxies, we identify 1579 as members of SPT-SZ galaxy clusters. The primary goal of these observations was to obtain spectra of cluster member galaxies to estimate cluster redshifts and velocity dispersions. We describe the full spectroscopic data set and resulting data products, including galaxy redshifts, cluster redshifts, and velocity dispersions, and measurements of several well-known spectral indices for each galaxy: the equivalent width, W , of [O ii] λλ 3727, 3729 and H- δ , and the 4000 Å break strength, D4000. We use the spectral indices to classify galaxies by spectral type (i.e., passive, post-starburst, star-forming), and we match the spectra against photometric catalogs to characterize spectroscopically observed cluster members as a function of brightness (relative to m ⋆ ). Finally, we report several new measurements of redshifts for ten bright, strongly lensed background galaxies in the cores of eight galaxy clusters. Combining the SPT-GMOS data set with previous spectroscopic follow-up of SPT-SZ galaxy clusters results in spectroscopic measurements for >100 clusters, or ∼20% of the full SPT-SZ sample.
SPT-GMOS: A Gemini/GMOS-South Spectroscopic Survey of Galaxy Clusters in the SPT-SZ Survey
Bayliss, M. B.; Ruel, J.; Stubbs, C. W.; Allen, S. W.; Applegate, D. E.; Ashby, M. L. N.; Bautz, M.; Benson, B. A.; Bleem, L. E.; Bocquet, S.; Brodwin, M.; Capasso, R.; Carlstrom, J. E.; Chang, C. L.; Chiu, I.; Cho, H.-M.; Clocchiatti, A.; Crawford, T. M.; Crites, A. T.; de Haan, T.; Desai, S.; Dietrich, J. P.; Dobbs, M. A.; Doucouliagos, A. N.; Foley, R. J.; Forman, W. R.; Garmire, G. P.; George, E. M.; Gladders, M. D.; Gonzalez, A. H.; Gupta, N.; Halverson, N. W.; Hlavacek-Larrondo, J.; Hoekstra, H.; Holder, G. P.; Holzapfel, W. L.; Hou, Z.; Hrubes, J. D.; Huang, N.; Jones, C.; Keisler, R.; Knox, L.; Lee, A. T.; Leitch, E. M.; von der Linden, A.; Luong-Van, D.; Mantz, A.; Marrone, D. P.; McDonald, M.; McMahon, J. J.; Meyer, S. S.; Mocanu, L. M.; Mohr, J. J.; Murray, S. S.; Padin, S.; Pryke, C.; Rapetti, D.; Reichardt, C. L.; Rest, A.; Ruhl, J. E.; Saliwanchik, B. R.; Saro, A.; Sayre, J. T.; Schaffer, K. K.; Schrabback, T.; Shirokoff, E.; Song, J.; Spieler, H. G.; Stalder, B.; Stanford, S. A.; Staniszewski, Z.; Stark, A. A.; Story, K. T.; Vanderlinde, K.; Vieira, J. D.; Vikhlinin, A.; Williamson, R.; Zenteno, A.
2016-11-01
We present the results of SPT-GMOS, a spectroscopic survey with the Gemini Multi-Object Spectrograph (GMOS) on Gemini South. The targets of SPT-GMOS are galaxy clusters identified in the SPT-SZ survey, a millimeter-wave survey of 2500 deg2 of the southern sky using the South Pole Telescope (SPT). Multi-object spectroscopic observations of 62 SPT-selected galaxy clusters were performed between 2011 January and 2015 December, yielding spectra with radial velocity measurements for 2595 sources. We identify 2243 of these sources as galaxies, and 352 as stars. Of the galaxies, we identify 1579 as members of SPT-SZ galaxy clusters. The primary goal of these observations was to obtain spectra of cluster member galaxies to estimate cluster redshifts and velocity dispersions. We describe the full spectroscopic data set and resulting data products, including galaxy redshifts, cluster redshifts, and velocity dispersions, and measurements of several well-known spectral indices for each galaxy: the equivalent width, W, of [O II] λλ3727, 3729 and H-δ, and the 4000 Å break strength, D4000. We use the spectral indices to classify galaxies by spectral type (i.e., passive, post-starburst, star-forming), and we match the spectra against photometric catalogs to characterize spectroscopically observed cluster members as a function of brightness (relative to m⋆). Finally, we report several new measurements of redshifts for ten bright, strongly lensed background galaxies in the cores of eight galaxy clusters. Combining the SPT-GMOS data set with previous spectroscopic follow-up of SPT-SZ galaxy clusters results in spectroscopic measurements for >100 clusters, or ∼20% of the full SPT-SZ sample.
von Essen, C.; Cellone, S.; Mallonn, M.; Albrecht, S.; Miculán, R.; Müller, H. M.
2017-07-01
Till date, only a handful exo-atmospheres have been well characterized, mostly by means of the transit method. Some classic examples are HD 209458b, HD 189733b, GJ-436b, and GJ-1214b. Data show exoplanet atmospheres to be diverse. However, this is based on a small number of cases. Here we focus our study on the exo-atmosphere of Qatar-1b, an exoplanet that looks much like HD 189733b regarding its host star's activity level, their surface gravity, scale height, equilibrium temperature and transit parameters. Thus, our motivation relied on carrying out a comparative study of their atmospheres, and assess if these are regulated by their environment. In this work we present one primary transit of Qatar-1b obtained during September, 2014, using the 8.1 m GEMINI North telescope. The observations were performed using the GMOS-N instrument in multi-object spectroscopic mode. We collected fluxes of Qatar-1 and six more reference stars, covering the wavelength range between 460 and 746 nm. The achieved photometric precision of 0.18 parts-per-thousand in the white light curve, at a cadence of 165 s, makes this one of the most precise datasets obtained from the ground. We created 12 chromatic transit light curves that we computed by integrating fluxes in wavelength bins of different sizes, ranging between 3.5 and 20 nm. Although the data are of excellent quality, the wavelength coverage and the precision of the transmission spectrum are not sufficient to neither rule out or to favor classic atmospheric models. Nonetheless, simple statistical analysis favors the clear atmosphere scenario. A larger wavelength coverage or space-based data is required to characterize the constituents of Qatar-1b's atmosphere and to compare it to the well known HD 189733b. On top of the similarities of the orbital and physical parameters of both exoplanets, from a long Hα photometric follow-up of Qatar-1, presented in this work, we find Qatar-1 to be as active as HD 189733. The white light curve
Directory of Open Access Journals (Sweden)
Maciej Kozak
2013-04-01
Full Text Available Amphiphilic dicationic surfactants, known as gemini surfactants, are currently studied for gene delivery purposes. The gemini surfactant molecule is composed of two hydrophilic “head” groups attached to hydrophobic chains and connected via molecular linker between them. The influence of different concentrations of 1,5-bis (1-imidazolilo-3-decyloxymethyl pentane chloride (gemini surfactant on the thermotropic phase behaviour of 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC bilayers with and without the presence of DNA was investigated using Fourier transformed infrared (FTIR and circular dichroism (CD spectroscopies, small angle scattering of synchrotron radiation and differential scanning calorimetry. With increasing concentration of surfactant in DMPC/DNA systems, a disappearance of pretransition and a decrease in the main phase transition enthalpy and temperature were observed. The increasing intensity of diffraction peaks as a function of surfactant concentration also clearly shows the ability of the surfactant to promote the organisation of lipid bilayers in the multilayer lamellar phase.
Grm, Urša
2017-01-01
Spodbujanje ustvarjalnosti skozi umetnost ima ključni pomen pri snovanju novih in različnih idej, izražanju domišljije, kakovostnem preživljanju časa ter izboljšanju kakovosti življenja (Knoll, 2011). Aktivira otrokove intelektualne, čustvene in motivacijske procese (Kroflič in Gobec, 1995). H kakovostnemu preživljanju časa poletnih počitnic prispeva Mestna občina Ljubljana (MOL), ki sofinancira prostočasne in preventivne programe za otroke od 1.–5. razreda osnovne šole s stalnim prebivališče...
Gemini Planet Imager: Preliminary Design Report
Energy Technology Data Exchange (ETDEWEB)
Macintosh, B
2007-05-10
For the first time in history, direct and indirect detection techniques have enabled the exploration of the environments of nearby stars on scales comparable to the size of our solar system. Precision Doppler measurements have led to the discovery of the first extrasolar planets, while high-contrast imaging has revealed new classes of objects including dusty circumstellar debris disks and brown dwarfs. The ability to recover spectrophotometry for a handful of transiting exoplanets through secondary-eclipse measurements has allowed us to begin to study exoplanets as individual entities rather than points on a mass/semi-major-axis diagram and led to new models of planetary atmospheres and interiors, even though such measurements are only available at low SNR and for a handful of planets that are automatically those most modified by their parent star. These discoveries have galvanized public interest in science and technology and have led to profound new insights into the formation and evolution of planetary systems, and they have set the stage for the next steps--direct detection and characterization of extrasolar Jovian planets with instruments such as the Gemini Planet Imager (GPI). As discussed in Volume 1, the ability to directly detect Jovian planets opens up new regions of extrasolar planet phase space that in turn will inform our understanding of the processes through which these systems form, while near-IR spectra will advance our understanding of planetary physics. Studies of circumstellar debris disks using GPI's polarimetric mode will trace the presence of otherwise-invisible low-mass planets and measure the build-up and destruction of planetesimals. To accomplish the science mission of GPI will require a dedicated instrument capable of achieving contrast of 10{sup -7} or more. This is vastly better than that delivered by existing astronomical AO systems. Currently achievable contrast, about 10{sup -5} at separations of 1 arc second or larger, is
Zhu, Haibo
2016-02-08
A new kind of organosilane (1,6-bis (diethyl(3-trimethoxysilylpropyl)ammonium) hexane bromide) with a gemini-type structure was prepared and used as a mesoporogen for the synthesis of hierarchical porous ZSM-5 zeolite. There are two quaternary ammonium centers along with double hydrolysable -RSi(OMe)3 fragments in the organosilane, which results in a strong interaction between this mesoporogen and silica-alumina gel. The organosilane can be easily incorporated into ZSM-5 zeolite structure during the crystallization process, and it was finally removed by calcination leading to secondary pores in ZSM-5. The synthesized ZSM-5 has been systematically studied by XRD, nitrogen adsorption, SEM, TEM, TG and solid-state one-dimensional (1D) and two-dimensional (2D) NMR, which reveals information on its detailed structure. It has a hierarchical porosity system, which combines the intrinsic micropores coming from the crystalline structure and irregular mesopores created by the organosilane template. Moreover, the mesoposity including pore size and volume within ZSM-5 can be systematically tuned by changing the organosilane/TEOS ratios, which confirms this organosilane has high flexibility of using as template for the synthesis of hierarchical porous zeolite.
Zhu, Haibo; Abou-Hamad, Edy; Chen, Yin; Saih, Youssef; Liu, Weibing; Basset, Jean-Marie; Samal, Akshaya Kumar
2016-01-01
A new kind of organosilane (1,6-bis (diethyl(3-trimethoxysilylpropyl)ammonium) hexane bromide) with a gemini-type structure was prepared and used as a mesoporogen for the synthesis of hierarchical porous ZSM-5 zeolite. There are two quaternary ammonium centers along with double hydrolysable -RSi(OMe)3 fragments in the organosilane, which results in a strong interaction between this mesoporogen and silica-alumina gel. The organosilane can be easily incorporated into ZSM-5 zeolite structure during the crystallization process, and it was finally removed by calcination leading to secondary pores in ZSM-5. The synthesized ZSM-5 has been systematically studied by XRD, nitrogen adsorption, SEM, TEM, TG and solid-state one-dimensional (1D) and two-dimensional (2D) NMR, which reveals information on its detailed structure. It has a hierarchical porosity system, which combines the intrinsic micropores coming from the crystalline structure and irregular mesopores created by the organosilane template. Moreover, the mesoposity including pore size and volume within ZSM-5 can be systematically tuned by changing the organosilane/TEOS ratios, which confirms this organosilane has high flexibility of using as template for the synthesis of hierarchical porous zeolite.
Specific ion effects on the properties of cationic Gemini surfactant monolayers
International Nuclear Information System (INIS)
Alejo, T.; Merchan, M.D.; Velazquez, M.M.
2011-01-01
The effects of some anions of the Hofmeister series and different divalent cations of alkaline earth metals on the properties of Langmuir monolayers of the cationic Gemini surfactant ethyl-bis (dimethyl octadecylammonium bromide) have been investigated. Surface pressure and potential isotherms at the air-water interface were obtained on aqueous subphases containing sodium salts with several anions of the Hofmeister series (Cl - , NO 3 - , Br - , I - , ClO 4 - , and SCN - ). The influence of the investigated anions on the monolayer properties can be ordered according to the Hofmeister series with a change in the order between bromide and nitrate anions. On the other hand, for a given anion, the cation of the salt also influences the surface properties of the Langmuir films. The monolayers can be transferred onto mica by the Langmuir-Blodgett technique and then the Langmuir-Blodgett films were characterized by atomic force microscopy (AFM). The AFM images show that the molecules become more closely packed and nearly vertical to the surface when anions screen the electric charge of the surfactant molecules.
Specific ion effects on the properties of cationic Gemini surfactant monolayers
Energy Technology Data Exchange (ETDEWEB)
Alejo, T.; Merchan, M.D.; Velazquez, M.M., E-mail: mvsal@usal.es
2011-06-01
The effects of some anions of the Hofmeister series and different divalent cations of alkaline earth metals on the properties of Langmuir monolayers of the cationic Gemini surfactant ethyl-bis (dimethyl octadecylammonium bromide) have been investigated. Surface pressure and potential isotherms at the air-water interface were obtained on aqueous subphases containing sodium salts with several anions of the Hofmeister series (Cl{sup -}, NO{sub 3}{sup -}, Br{sup -}, I{sup -}, ClO{sub 4}{sup -}, and SCN{sup -}). The influence of the investigated anions on the monolayer properties can be ordered according to the Hofmeister series with a change in the order between bromide and nitrate anions. On the other hand, for a given anion, the cation of the salt also influences the surface properties of the Langmuir films. The monolayers can be transferred onto mica by the Langmuir-Blodgett technique and then the Langmuir-Blodgett films were characterized by atomic force microscopy (AFM). The AFM images show that the molecules become more closely packed and nearly vertical to the surface when anions screen the electric charge of the surfactant molecules.
Polimorfismos del gen ob en bovinos de raza holstein en la Comarca Lagunera, México
Directory of Open Access Journals (Sweden)
Sarai S. Mendoza-Retana
2017-01-01
Full Text Available La Comarca Lagunera es la cuenca lechera más importante de México. En la actualidad se están utilizando diversas técnicas que permiten evaluar genéticamente el animal a una edad temprana, permitiendo seleccionar futuros reproductores con características deseables. Entre los genes relacionados con la producción de leche, se encuentran el gen Ob también llamado gen Leptina el cual actúa sobre el sistema nervioso central y tejidos periféricos jugando un papel muy importante en la modulación regulación del apetito, ganancia de peso vivo, incremento del metabolismo energético y el anabolismo muscular. Este trabajo se realizó para determinar el polimorfismo de longitud del fragmento de restricción ACI I de gen leptina en el exón 2 y correlacionarlo con los parámetros de producción y calidad de leche. Se recolectaron 100 muestra de sangre de vacas en producción del establo “Lácteos Florida” de Francisco I. Madero municipio de Coahuila, México con tres esta tus de producción: altas, medias y bajas La extracción de ADN se realizó por el método modificado de Salting - Out. Se realizó PCR del gen leptina originando un fragmento de 272 bp de longitud y se realizó PCR - RFLP con la enzima de restricción ACI I y secue nciación, correlacionando los genotipos TT, CT Y CC con tres estatus de producción de leche: altas, medias, bajas. El análisis estadístico indicó que las vacas portadoras del genotipo homocigoto (TT tienen un efecto significativo (P<0.01 con respecto a l as características de producción y calidad de leche ya que tuvieron un mayor consumo de alimento, ganancia de peso, además de una elevada producción de leche en comparación a los genotipos heterocigoto (CT y homocigoto (CC. Los resultados obtenidos muest ran que l a identificación molecular de polimorfismos del gen Ob puede usarse como herramienta de selección genética en bovinos de raza Holstein.
Directory of Open Access Journals (Sweden)
C. Dennison
2011-10-01
Full Text Available Controls on in situ methanotroph activity are not well understood. One potentially important parameter is copper (Cu because it is the metal-centre of particulate methane monooxygenase (pMMO, the most active enzyme for oxidizing methane to methanol. Further, Cu-to-cell ratios influence the relative expression of pMMO versus the alternate soluble MMO (sMMO in some species. However, most methanotroph studies only have assessed readily soluble forms of Cu (e.g. CuCl2 and there is a dearth of Cu-related activity data for Cu sources more common in the environment. Here we quantified sMMO activity (as a practical indicator of Cu availability and growth kinetics in Methylosinus trichosporium OB3b, an organism that expresses both pMMO and sMMO, when grown on Cu-minerals with differing dissolution equilibria to assess how mineral type and methanobactin (mb might influence in situ methanotroph activity. Mb is a molecule produced by M. trichosporium OB3b that has a high affinity for Cu, reduces Cu toxicity, and may influence Cu availability in terrestrial systems. CuCO3.Cu(OH2 and CuO were chosen for study based on modelling data, reflecting more and less soluble minerals, respectively, and were found to affect M. trichosporium OB3b activity differently. Cells grew without growth lag and with active pMMO on CuCO3.Cu(OH2, regardless of the amount of mineral supplied (−1. The organism also grew well on CuO; however, significant sMMO activity was retained up to 50 μmoles Cu-total l−1, although sMMO activity was suppressed by supplemental mb and-or direct cell-mineral contact. Mb addition increased growth rates (p < 0.05 with both minerals. Results show mb broadly stimulates growth, but Cu mineralogy and mb dictate whether sMMO or pMMO is active in the cells. This explains why sMMO activity has been seen in soils with high Cu and also has implications for predicting dominant MMO activity in terrestrial bioremediation applications.
Molecular packing in 1-hexanol-DMPC bilayers studied by molecular dynamics simulation
DEFF Research Database (Denmark)
Pedersen, U.R.; Peters, Günther H.j.; Westh, P.
2007-01-01
The structure and molecular packing density of a “mismatched” solute, 1-hexanol, in lipid membranes of dimyristoyl phosphatidylcholine (DMPC) was studied by molecular dynamics simulations. We found that the average location and orientation of the hexanol molecules matched earlier experimental data...... on comparable systems. The local density or molecular packing in DMPC–hexanol was elucidated through the average Voronoi volumes of all heavy (non-hydrogen) atoms. Analogous analysis was conducted on trajectories from simulations of pure 1-hexanol and pure (hydrated) DMPC bilayers. The results suggested...... of the alcohol upon partitioning and an even stronger loosening in the packing of the lipid. Furthermore, analysis of Voronoi volumes along the membrane normal identifies a distinctive depth dependence of the changes in molecular packing. The outer (interfacial) part of the lipid acyl chains (up to C8...
Trening za razvijanje občutka za števila in količine pri predšolskih otrocih s posebnimi potrebami
Kuplenk, Petra
2017-01-01
Tako otroci kot tudi odrasli se z matematiko srečujemo na vsakem koraku, pa naj bo to na poti v vrtec, službo ali pa pri delu doma. Matematika vsakodnevno vpliva na naše življenje in delo. Na delovnem mestu, v vrtcu, opažam vse večje težave otrok s posebnimi potrebami na področju razvoja občutka za števila in količine. V predšolskem obdobju je namreč nujno, da otroci razvijejo občutek za števila in količine, saj vsa nadaljnja matematična znanja temeljijo na usvojenih spretnostih. V empirič...
Revealing the nebular properties and Wolf-Rayet population of IC10 with Gemini/GMOS
Tehrani, Katie; Crowther, Paul A.; Archer, I.
2017-12-01
We present a deep imaging and spectroscopic survey of the Local Group irregular galaxy IC10 using Gemini North and GMOS to unveil its global Wolf-Rayet (WR) population. We obtain a star formation rate (SFR) of 0.045 ± 0.023 M⊙ yr-1, for IC10 from the nebular H α luminosity, which is comparable to the Small Magellanic Cloud. We also present a revised nebular oxygen abundance of log(O/H) + 12 = 8.40 ± 0.04, comparable to the LMC. It has previously been suggested that for IC10 to follow the WR subtype-metallicity dependance seen in other Local Group galaxies, a large WN population awaits discovery. Our search revealed three new WN stars, and six candidates awaiting confirmation, providing little evidence to support this claim. The new global WR star total of 29 stars is consistent with the Large Magellanic Cloud population when scaled to the reduced SFR of IC10. For spectroscopically confirmed WR stars, the WC/WN ratio is lowered to 1.0; however, including all potential candidates, and assuming those unconfirmed to be WN stars, would reduce the ratio to ∼0.7. We attribute the high WC/WN ratio to the high star formation surface density of IC10 relative to the Magellanic Clouds, which enhances the frequency of high-mass stars capable of producing WC stars.
International Nuclear Information System (INIS)
Silva Junior, Iremar A.; Ramos, Marcio A.G.; Carvalho, Valdir S.; Diniz, Raphael E.; Cescon, Claudinei T.; Vivolo, Vitor; Potiens, Maria da Penha A.
2011-01-01
In order to improve the calibration process of portable detectors of the Instrument Calibration Laboratory of IPEN, an automated system to exchange the attenuators of the OB85/1 irradiator system was developed. This automation was developed following this sequence: (i) development of the device with the cooperation of the IPEN Sector of Projects, using the Solid Edge software to design the mechanical part of the exchanging device of the attenuators, in 3D; (ii) simulation with the Festo's FluidSim software to define the pneumatic components and their respective actuators; (iii) machining and assembly of mechanical parts; (iv) assembly of pneumatic components and their actuators, like magnetic pneumatic cylinders, which allow the use of magnetic sensors, used to confirm the attenuators opened or closed positions: actuators 5/2 each, with double solenoid; (v) assembly of the control panel for operating the device remotely from the operating room. With this automation, the technicians in charge of the detectors calibration and research testing will have no hand contact with lead attenuators, improving the calibration process due to the decrease in time spent with manual shift from the attenuators and avoiding accidents, like the fall of the lead attenuators. It has been a concern of the LCI-IPEN group the decrease in the time spent by the technicians in the calibration room controlled areas should follow the recommendations of the radiological protection rules, which recommend the shortest time possible of workers in these areas. Automated systems have, usually, a better rate of reproducibility, due to the small participation by the system operator, so the LCI-IPEN is following the trend of several laboratories and automating its processes. (author)
Molecular design of flotation collectors: A recent progress.
Liu, Guangyi; Yang, Xianglin; Zhong, Hong
2017-08-01
The nature of froth flotation is to selectively hydrophobize valuable minerals by collector adsorption so that the hydrophobized mineral particles can attach air bubbles. In recent years, the increasing commercial production of refractory complex ores has been urgent to develop special collectors for enhancing flotation separation efficiency of valuable minerals from these ores. Molecular design methods offer an effective way for understanding the structure-property relationship of flotation collectors and developing new ones. The conditional stability constant (CSC), molecular mechanics (MM), quantitative structure-activity relationship (QSAR), and first-principle theory, especially density functional theory (DFT), have been adopted to build the criteria for designing flotation collectors. Azole-thiones, guanidines, acyl thioureas and thionocarbamates, amide-hydroxamates, and double minerophilic-group surfactants such as Gemini, dithiourea and dithionocarbamate molecules have been recently developed as high-performance collectors. To design hydrophobic groups, the hydrophilic-hydrophobic balance parameters have been extensively used as criteria. The replacement of aryl group with aliphatic group or CC single bond(s) with CC double bond(s), reduction of carbon numbers, introduction of oxygen atom(s) and addition of trisiloxane to the tail terminal have been proved to be useful approaches for adjusting the surface activity of collectors. The role of molecular design of collectors in practical flotation applications was also summarized. Based on the critical review, some comments and prospects for further research on molecular design of flotation collectors were also presented in the paper. Copyright © 2017 Elsevier B.V. All rights reserved.
Molecular design of high performance zwitterionic liquids for enhanced heavy-oil recovery processes.
Martínez-Magadán, J M; Cartas-Rosado, A R; Oviedo-Roa, R; Cisneros-Dévora, R; Pons-Jiménez, M; Hernández-Altamirano, R; Zamudio-Rivera, L S
2018-03-01
Branched gemini zwitterionic liquids, which contain two zwitterionic moieties of linked quaternary-ammonium and carboxylate groups, are proposed as chemicals to be applied in the Enhanced Oil Recovery (EOR) from fractured carbonate reservoirs. The zwitterionic moieties are bridged between them through an alkyl chain containing 12 ether groups, and each zwitterionic moiety has attached a long alkyl tail including a CC double bond. A theoretical molecular mechanism over which EOR could rest, consisting on both the disaggregation of heavy oil and the reservoir-rock wettability alteration, was suggested. Results show that chemicals can both reduce the viscosity and remove heavy-oil molecules from the rock surface. Copyright © 2018. Published by Elsevier Inc.
OB Stars and Cepheids From the Gaia TGAS Catalogue: Test of their Distances and Proper Motions
Directory of Open Access Journals (Sweden)
Bobylev Vadim V.
2017-12-01
Full Text Available We consider young distant stars from the Gaia TGAS catalog. These are 250 classical Cepheids and 244 OB stars located at distances up to 4 kpc from the Sun. These stars are used to determine the Galactic rotation parameters using both trigonometric parallaxes and proper motions of the TGAS stars. In this case the considered stars have relative parallax errors less than 200%. Following the well-known statistical approach, we assume that the kinematic parameters found from the line-of-sight velocities Vr are less dependent on errors of distances than the found from the velocity components Vl. From values of the first derivative of the Galactic rotation angular velocity ′0, found from the analysis of velocities Vr and Vl separately, the scale factor of distances is determined.We found that from the sample of Cepheids the scale of distances of the TGAS should be reduced by 3%, and from the sample of OB stars, on the contrary, the scale should be increased by 9%.
Energy Technology Data Exchange (ETDEWEB)
Chen Yang; Zhou Ping [Department of Astronomy, Nanjing University, Nanjing 210093 (China); Chu Youhua [Department of Astronomy, University of Illinois at Urbana-Champaign, 1002 West Green Street, Urbana, IL 61801 (United States)
2013-05-20
We find a linear relationship between the size of a massive star's main-sequence bubble in a molecular environment and the star's initial mass: R{sub b} Almost-Equal-To 1.22 M/M{sub Sun} - 9.16 pc, assuming a constant interclump pressure. Since stars in the mass range of 8 to 25-30 M{sub Sun} will end their evolution in the red supergiant phase without launching a Wolf-Rayet wind, the main-sequence wind-blown bubbles are mainly responsible for the extent of molecular gas cavities, while the effect of the photoionization is comparatively small. This linear relation can thus be used to infer the masses of the massive star progenitors of supernova remnants (SNRs) that are discovered to evolve in molecular cavities, while few other means are available for inferring the properties of SNR progenitors. We have used this method to estimate the initial masses of the progenitors of eight SNRs: Kes 69, Kes 75, Kes 78, 3C 396, 3C 397, HC 40, Vela, and RX J1713-3946.
Réduire l'obésité chez les enfants au Mexique | CRDI - Centre de ...
International Development Research Centre (IDRC) Digital Library (Canada)
27 avr. 2016 ... ... le Mexique connaît une « transition nutritionnelle » sous l'effet des changements qui se sont produits en ce qui concerne le régime alimentaire, la nutrition et l'activité physique. Le surpoids et l'obésité sont des facteurs de risque pour les maladies chroniques comme le diabète et le cancer, sans compter ...
Alejo, T; Merchán, M D; Velázquez, M M
2014-08-26
We used quartz crystal microbalance with dissipation to study the mechanical properties, the kinetics of adsorption, and the amount of CdSe quantum dots (QDs) adsorbed onto a SiO2 sensor, referred as bare sensor, onto the sensor modified with a film of the polymer poly(maleic anhydride-alt-1-octadecene), PMAO, or with a film of the Gemini surfactant ethyl-bis(dimethyl octadecyl ammonium bromide), abbreviated as 18-2-18. Results showed that when the sensor is coated with polymer or surfactant molecules, the coverage increases compared with that obtained for the bare sensor. On the other hand, rheological properties and kinetics of adsorption of QDs are driven by QD nanoparticles. Thus, the QD films present elastic behavior, and the elasticity values are independent of the molecule used as coating and similar to the elasticity value obtained for QDs films on the bare sensor. The QD adsorption is a two-step mechanism in which the fastest process is attributed to the QD adsorption onto the solid substrate and the slowest one is ascribed to rearrangement movements of the nanoparticles adsorbed at the surface.
Plutonium speciation and isotope ratios in Yenisey and Ob river and Yenisey estuary
International Nuclear Information System (INIS)
Skipperud, L.; Oughton, DH.; Fifield, K.; Lind, O.C.; Salbu, B.; Brown, J.
2004-01-01
Plutonium isotope ratios are known to vary with reactor type, nuclear fuel-burn up time, neutron flux, and energy, and for fallout from nuclear detonations, weapon type and yield. Weapons-grade plutonium is characterized by a low content of the 240 Pu isotope, with 240 Pu/ 239 Pu isotope ratio less than 0.05. In contrast, both global weapons fallout and spent nuclear fuel from civil reactors have higher 240 Pu/ 239 Pu isotope ratios (civil nuclear power reactors have 240 Pu/ 239 Pu atom ratios of between about 0.2-1). Thus, different sources often exhibit characteristic plutonium isotope ratios and these ratios can be used to identify the origin of contamination, calculate inventories, or follow the migration of contaminated sediments and waters. Together with activity measurements and isotope ratios, knowledge of plutonium speciation in the Ob and Yenisey rivers and processes controlling its behaviour in estuarine systems is a prerequisite for predicting the transfer and subsequent environmental impact to Arctic Seas. With this in mind, the study had two objectives: first to determine whether discharges from nuclear installations in the river catchment areas are having any influence on Pu levels in the estuaries; and, second, to investigate the transfer and mobility of plutonium in the Yenisey river and estuary. Plutonium 240/239 ratios were determined using accelerator mass spectrometry (AMS). The data indicated a clear influence from a low 240 Pu: 239 Pu source in surface sediments collected from the Yenisey Estuary, whereas plutonium in the Ob Estuary sediments are dominated by global fallout. The results also show an increase in plutonium concentration and a decrease in isotope ratio going upstream from the estuary. Sequential extractions of sediments indicate that up 70% of the Pu in the Yenisey river is easily mobilized with weak oxidizing agents, which indicates that the Pu is organically bound, while the Pu is more strongly irreversible bound further out
Directory of Open Access Journals (Sweden)
Peter E. M. Gibbs
2016-01-01
Full Text Available Insulin’s stimulation of glucose uptake by binding to the IRK extracellular domain is compromised in diabetes. We have recently described an unprecedented approach to stimulating glucose uptake. KYCCSRK (P2 peptide, corresponding to the C-terminal segment of hBVR, was effective in binding to and inducing conformational change in the IRK intracellular kinase domain. Although myristoylated P2, made of L-amino acids, was effective in cell culture, its use for animal studies was unsuitable. We developed a peptidase-resistant formulation of the peptide that was efficient in both mice and cell culture systems. The peptide was constructed of D-amino acids, in reverse order, and blocked at both termini. Delivery of the encapsulated peptide to HepG2 and HSKM cells was confirmed by its prolonged effect on stimulation of glucose uptake (>6 h. The peptide improved glucose clearance in both wild-type and Ob/Ob mice; it lowered blood glucose levels and suppressed glucose-stimulated insulin secretion. IRK activity was stimulated in the liver of treated mice and in cultured cells. The peptide potentiated function of IRK’s downstream effector, Akt-GSK3-(α,β axis. Thus, P2-based approach can be used for improving glucose uptake by cells. Also, it allows for screening peptides in vitro and in animal models for treatment of diabetes.
Olfactory deficits in Niemann-Pick type C1 (NPC1 disease.
Directory of Open Access Journals (Sweden)
Marina Hovakimyan
Full Text Available BACKGROUND: Niemann-Pick type C disease (NPC is a rare autosomal recessive lipid storage disease characterized by progressive neurodegeneration. As only a few studies have been conducted on the impact of NPC on sensory systems, we used a mutant mouse model (NPC1(-/- to examine the effects of this disorder to morphologically distinct regions of the olfactory system, namely the olfactory epithelium (OE and olfactory bulb (OB. METHODOLOGY/PRINCIPAL FINDINGS: For structural and functional analysis immunohistochemistry, electron microscopy, western blotting, and electrophysiology have been applied. For histochemistry and western blotting, we used antibodies against a series of neuronal and glia marker proteins, as well as macrophage markers. NPC1(-/- animals present myelin-like lysosomal deposits in virtually all types of cells of the peripheral and central olfactory system. Especially supporting cells of the OE and central glia cells are affected, resulting in pronounced astrocytosis and microgliosis in the OB and other olfactory cortices. Up-regulation of Galectin-3, Cathepsin D and GFAP in the cortical layers of the OB underlines the critical role and location of the OB as a possible entrance gate for noxious substances. Unmyelinated olfactory afferents of the lamina propria seem less affected than ensheathing cells. Supporting the structural findings, electro-olfactometry of the olfactory mucosa suggests that NPC1(-/- animals exhibit olfactory and trigeminal deficits. CONCLUSIONS/SIGNIFICANCE: Our data demonstrate a pronounced neurodegeneration and glia activation in the olfactory system of NPC1(-/-, which is accompanied by sensory deficits.
Gemini/GNIRS infrared spectroscopy of the Wolf-Rayet stellar wind in Cygnus X-3
Koljonen, K. I. I.; Maccarone, T. J.
2017-12-01
The microquasar Cygnus X-3 was observed several times with the Gemini North Infrared Spectrograph while the source was in the hard X-ray state. We describe the observed 1.0-2.4 μm spectra as arising from the stellar wind of the companion star and suggest its classification as a WN 4-6 Wolf-Rayet star. We attribute the orbital variations of the emission line profiles to the variations in the ionization structure of the stellar wind caused by the intense X-ray emission from the compact object. The strong variability observed in the line profiles will affect the mass function determination. We are unable to reproduce earlier results, from which the mass function for the Wolf-Rayet star was derived. Instead, we suggest that the system parameters are difficult to obtain from the infrared spectra. We find that the near-infrared continuum and the line spectra can be represented with non-LTE Wolf-Rayet atmosphere models if taking into account the effects arising from the peculiar ionization structure of the stellar wind in an approximative manner. From the representative models we infer the properties of the Wolf-Rayet star and discuss possible mass ranges for the binary components.
THE PECULIAR DEBRIS DISK OF HD 111520 AS RESOLVED BY THE GEMINI PLANET IMAGER
Energy Technology Data Exchange (ETDEWEB)
Draper, Zachary H.; Matthews, Brenda C.; Gerard, Benjamin [Department of Physics and Astronomy, University of Victoria, 3800 Finnerty Rd., Victoria, BC V8P 5C2 (Canada); Duchêne, Gaspard; Wang, Jason J.; Kalas, Paul; Graham, James R. [Department of Astronomy, UC Berkeley, Berkeley, CA 94720 (United States); Millar-Blanchaer, Maxwell A. [Department of Astronomy and Astrophysics, University of Toronto, Toronto, ON M5S 3H4 (Canada); Padgett, Deborah [NASA Goddard Space Flight Center, 8800 Greenbelt Rd., Greenbelt, MD 20771 (United States); Ammons, S. Mark [Lawrence Livermore National Lab, 7000 East Ave., Livermore, CA 94551 (United States); Bulger, Joanna [Subaru Telescope, NAOJ, 650 North Aohoku Pl., Hilo, HI 96720 (United States); Chen, Christine; Greenbaum, Alexandra Z. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Chilcote, Jeffrey K. [Dunlap Institute for Astronomy and Astrophysics, University of Toronto, 50 St. George St., Toronto, ON M5S 3H4 (Canada); Doyon, René [Institut de Recherche sur les Exoplanètes, Départment de Physique, Université de Montréal, Montréal, QC H3C 3J7 (Canada); Fitzgerald, Michael P. [Department of Physics and Astronomy, UCLA, Los Angeles, CA 90095 (United States); Follette, Kate B.; Macintosh, Bruce [Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, CA 94305 (United States); Hibon, Pascale [European Southern Observatory, Casilla 19001, Santiago 19 (Chile); Hinkley, Sasha [University of Exeter, Astrophysics Group, Physics Building, Stocker Rd., Exeter, EX4 4QL (United Kingdom); and others
2016-08-01
Using the Gemini Planet Imager, we have resolved the circumstellar debris disk around HD 111520 at a projected range of ∼30–100 AU in both total and polarized H -band intensity. The disk is seen edge-on at a position angle of 165° along the spine of emission. A slight inclination and asymmetric warp are covariant and alter the interpretation of the observed disk emission. We employ three point-spread function subtraction methods to reduce the stellar glare and instrumental artifacts to confirm that there is a roughly 2:1 brightness asymmetry between the NW and SE extension. This specific feature makes HD 111520 the most extreme example of asymmetric debris disks observed in scattered light among similar highly inclined systems, such as HD 15115 and HD 106906. We further identify a tentative localized brightness enhancement and scale height enhancement associated with the disk at ∼40 AU away from the star on the SE extension. We also find that the fractional polarization rises from 10% to 40% from 0.″5 to 0.″8 from the star. The combination of large brightness asymmetry and symmetric polarization fraction leads us to believe that an azimuthal dust density variation is causing the observed asymmetry.
Phantom study for the systemic performance of Gemini PET/CT
International Nuclear Information System (INIS)
Feng Yanlin; He Xiaohong; Huang Kemin; Yu Fengwen; Liu Dejun; Yuan Jianwei; Yuan Baihong; Su Shaodi
2005-01-01
Objective: To develop the methods and parameters for evaluating the systemic performance of Gemini PET/CT. Methods: The spatial resolution, standardized uptake value (SUV), uniformity and accuracy of image registration were selected as the evaluating indexes. The Jaszczak phantom with smaller inserts was filled with 18 F-fluorodeoxyglucose (FDG) solution and imaged with whole body and brain imaging modes, respectively, to evaluate the spatial resolution of the PET/CT; a Philips hollow phantom was filled with 18 F-FDG solution and imaged for calculating the SUV and the uniformity parameters; four 22 Na solid sources were put under the pad of the patient table and imaged synchronously with the patient's data acquisition to evaluate the accuracy of the PET and CT image fusion. Results: The rods of the diameter of 6.4 mm of both the hot and cold inserts were observed with whole body imaging mode, and rods of the diameters of 4.8 mm of both the hot and cold inserts were observed with brain imaging mode. The SUV with X-ray CT attenuation correction (CTAC) was 0.92 ± 0.24, and was 0.99±0.26 with 137 Cs attenuation correction (CsAC), and t=-1.327, P>0.05 between the two groups. The uniformity of the images with both CTAC and CsAC was very nice, no artifacts were seen either. The maximum pixel counts was 3790, the minimum was 1434, the average was 2581.23 and the standard deviation was 728.39 with CTAC; and were 4218, 1073, 2758.19 and 838.79 with CsAC correspondingly, and t=-1.069, P>0.05 between the two groups. The images of PET and CT were registrated better, and also no diversity was detected on the fusion images. Conclusions: These methods and parameters might be used to evaluate the systemic performance of the PET/CT, and could also be used as the supplementary items for the acceptance test and daily quality assurance of the PET/CT. (authors)
The molecular spin filter constructed from 1D organic chain
International Nuclear Information System (INIS)
Chen, Wei; Xu, Ning; Wang, Baolin; Bian, Baoan
2014-01-01
We proposed a molecular spin filter, which is constructed from the 1D metallic organic chain (Fe n+1 (C 6 H 4 ) n ). The spin-polarized transport properties of the molecular spin filter are explored by combining density functional theory with nonequilibrium Green's function formalism. Theoretical results reveal that Fe n+1 (C 6 H 4 ) n molecular chain exhibits robust spin filtering effect, and only the spin-down electrons can transmit through the molecular chain. At the given bias voltage window [−1 eV,1 eV], the calculated spin filter efficiency is close to 100% in the case of n≥3. We find that the effect of spin polarization origin from both Fe n+1 and (C 6 H 4 ) n . In addition, negative difference resistance behavior appears in Fe n+1 (C 6 H 4 ) n molecular chain. The results can help us understand the spin transport properties of organic molecular chain. - Highlights: • Theoretical results reveal that Fe n+1 (C 6 H 4 ) n molecular chain exhibits robust spin filtering effect. • The effect of spin polarization origin from both of Fe n+1 and (C 6 H 4 ) n . • Negative difference resistance behavior appears in Fe n+1 (C 6 H 4 ) n molecular chain
International Nuclear Information System (INIS)
Pauluszkiewicz, T.; Hibler, L.F.; Richmond, M.C.; Bradley, D.J.
1995-01-01
Recent data indicate that there are potentially large sources of radionuclide contamination on the Ob River system. To quantify the existing radionuclide contamination from a possible catastrophic event data and models have been used to quantify scenarios. Using a compilation of Russian data on the radionuclide contamination, hydrologic data and studies on the sediment transport process a conceptual model has been developed of the Ob system, and a numerical model has been applied to estimate the radionuclide flux to the Kara Sea. The initial results of the river modeling in the Mayak region show how important watershed flow from the marshes are to the hydrologic budget of the area. The preliminary analysis of the sediment flux indicates the need to consider the depositional (storage) regions such as the Asanow Marsh. 31 refs., 5 figs
The role of leptin in gastric cancer: Clinicopathologic features and molecular mechanisms
International Nuclear Information System (INIS)
Lee, Kang Nyeong; Choi, Ho Soon; Yang, Sun Young; Park, Hyun Ki; Lee, Young Yiul; Lee, Oh Young; Yoon, Byung Chul; Hahm, Joon Soo; Paik, Seung Sam
2014-01-01
Highlights: • Leptin and Ob-R are expressed in gastric adenoma and early and advanced cancer. • Leptin is more likely associated with differentiated gastric cancer or cardia cancer. • Leptin proliferates gastric cancer cells via activating the STAT3 and ERK1/2 pathways. - Abstract: Obesity is associated with certain types of cancer, including gastric cancer. However, it is still unclear whether obesity-related cytokine, leptin, is implicated in gastric cancer. Therefore, we aimed to investigate the role of leptin in gastric cancer. The expression of leptin and its receptor, Ob-R, was assessed by immunohistochemical staining and was compared in patients with gastric adenoma (n = 38), early gastric cancer (EGC) (n = 38), and advanced gastric cancer (AGC) (n = 38), as a function of their clinicopathological characteristics. Gastric cancer cell lines were studied to investigate the effects of leptin on the signal transducer and activator of transcription-3 (STAT3) and extracellular receptor kinase 1/2 (ERK1/2) signaling pathways using MTT assays, immunoblotting, and inhibition studies. Leptin was expressed in gastric adenomas (42.1%), EGCs (47.4%), and AGCs (43.4%). Ob-R expression tended to increase from gastric adenoma (2%), through EGC (8%), to AGC (18%). Leptin induced the proliferation of gastric cancer cells by activating STAT3 and ERK1/2 and up-regulating the expression of vascular endothelial growth factor (VEGF). Blocking Ob-R with pharmacological inhibitors and by RNAi decreased both the leptin-induced activation of STAT3 and ERK1/2 and the leptin-induced expression of VEGF. Leptin plays a role in gastric cancer by stimulating the proliferation of gastric cancer cells via activating the STAT3 and ERK1/2 pathways
International Nuclear Information System (INIS)
Wang, Jason J.; Graham, James R.; De Rosa, Robert J.; Kalas, Paul; Chiang, Eugene; Duchêne, Gaspard; Pueyo, Laurent; Chen, Christine; Greenbaum, Alexandra Z.; Nielsen, Eric L.; Millar-Blanchaer, Max; Ammons, S. Mark; Bulger, Joanna; Cardwell, Andrew; Goodsell, Stephen J.; Chilcote, Jeffrey K.; Doyon, René; Draper, Zachary H.; Esposito, Thomas M.; Fitzgerald, Michael P.
2015-01-01
We present Gemini Planet Imager (GPI) observations of AU Microscopii, a young M dwarf with an edge-on, dusty debris disk. Integral field spectroscopy and broadband imaging polarimetry were obtained during the commissioning of GPI. In our broadband imaging polarimetry observations, we detect the disk only in total intensity and find asymmetries in the morphology of the disk between the southeast (SE) and northwest (NW) sides. The SE side of the disk exhibits a bump at 1″ (10 AU projected separation) that is three times more vertically extended and three times fainter in peak surface brightness than the NW side at similar separations. This part of the disk is also vertically offset by 69 ± 30 mas to the northeast at 1″ when compared to the established disk midplane and is consistent with prior Atacama Large Millimeter/submillimeter Array and Hubble Space Telescope/Space Telescope Imaging Spectrograph observations. We see hints that the SE bump might be a result of detecting a horizontal sliver feature above the main disk that could be the disk backside. Alternatively, when including the morphology of the NW side, where the disk midplane is offset in the opposite direction ∼50 mas between 0.″4 and 1.″2, the asymmetries suggest a warp-like feature. Using our integral field spectroscopy data to search for planets, we are 50% complete for ∼4 M Jup planets at 4 AU. We detect a source, resolved only along the disk plane, that could either be a candidate planetary mass companion or a compact clump in the disk
THE NON-THERMAL, TIME-VARIABLE RADIO EMISSION FROM Cyg OB2 no. 5: A WIND-COLLISION REGION
International Nuclear Information System (INIS)
Ortiz-Leon, Gisela N.; Loinard, Laurent; RodrIguez, Luis F.; Dzib, Sergio A.; Mioduszewski, Amy J.
2011-01-01
The radio emission from the well-studied massive stellar system Cyg OB2 no. 5 is known to fluctuate with a period of 6.7 years between a low-flux state, when the emission is entirely of free-free origin, and a high-flux state, when an additional non-thermal component (of hitherto unknown nature) appears. In this paper, we demonstrate that the radio flux of that non-thermal component is steady on timescales of hours and that its morphology is arc-like. This shows that the non-thermal emission results from the collision between the strong wind driven by the known contact binary in the system and that of an unseen companion on a somewhat eccentric orbit with a 6.7 year period and a 5-10 mas semimajor axis. Together with the previously reported wind-collision region located about 0.''8 to the northeast of the contact binary, so far Cyg OB2 no. 5 appears to be the only multiple system known to harbor two radio-imaged wind-collision regions.
Energy Technology Data Exchange (ETDEWEB)
Dzib, Sergio A.; Rodriguez, Luis F.; Loinard, Laurent; Ortiz-Leon, Gisela N.; Araudo, Anabella T. [Centro de Radiostronomia y Astrofisica, Universidad Nacional Autonoma de Mexico, Morelia 58089 (Mexico); Mioduszewski, Amy J., E-mail: s.dzib@crya.unam.mx [National Radio Astronomy Observatory, 1003 Lopezville Road, Socorro, NM 87801 (United States)
2013-02-15
We present multi-epoch Very Long Base Array observations of the compact wind-collision region in the Cyg OB2 no. 5 system. These observations confirm the arc-shaped morphology of the emission reported earlier. The total flux as a function of time is roughly constant when the source is 'on', but falls below the detection limit as the wind-collision region approaches periastron in its orbit around the contact binary at the center of the system. In addition, at one of the 'on' epochs, the flux drops to about a fifth of its average value. We suggest that this apparent variation could result from the inhomogeneity of the wind that hides part of the flux rather than from an intrinsic variation. We measured a trigonometrical parallax, for the most compact radio emission of 0.61 {+-} 0.22 mas, corresponding to a distance of 1.65 {sup +0.96} {sub -0.44} kpc, in agreement with recent trigonometrical parallaxes measured for objects in the Cygnus X complex. Using constraints on the total mass of the system and orbital parameters previously reported in the literature, we obtain two independent indirect measurements of the distance to the Cyg OB2 no. 5 system, both consistent with 1.3-1.4 kpc. Finally, we suggest that the companion star responsible for the wind interaction, yet undetected, is of spectral type between B0.5 and O8.
International Nuclear Information System (INIS)
Dzib, Sergio A.; Rodríguez, Luis F.; Loinard, Laurent; Ortiz-León, Gisela N.; Araudo, Anabella T.; Mioduszewski, Amy J.
2013-01-01
We present multi-epoch Very Long Base Array observations of the compact wind-collision region in the Cyg OB2 no. 5 system. These observations confirm the arc-shaped morphology of the emission reported earlier. The total flux as a function of time is roughly constant when the source is 'on', but falls below the detection limit as the wind-collision region approaches periastron in its orbit around the contact binary at the center of the system. In addition, at one of the 'on' epochs, the flux drops to about a fifth of its average value. We suggest that this apparent variation could result from the inhomogeneity of the wind that hides part of the flux rather than from an intrinsic variation. We measured a trigonometrical parallax, for the most compact radio emission of 0.61 ± 0.22 mas, corresponding to a distance of 1.65 +0.96 –0.44 kpc, in agreement with recent trigonometrical parallaxes measured for objects in the Cygnus X complex. Using constraints on the total mass of the system and orbital parameters previously reported in the literature, we obtain two independent indirect measurements of the distance to the Cyg OB2 no. 5 system, both consistent with 1.3-1.4 kpc. Finally, we suggest that the companion star responsible for the wind interaction, yet undetected, is of spectral type between B0.5 and O8.
Growth of yttrium iron garnet single crystals in Na2O-B2O3 flux system in air
International Nuclear Information System (INIS)
Bandyopadhyay, Tarun; Saha, Prasenjit
1977-01-01
Detailed studies of growth of yttrium iron garnet (YIG) in the flux system Na 2 O-B 2 O 3 were made to delineate the phase stability regions of YIG and the neighbouring crystalline phases, and a tentative working diagram of Na 2 O-B 2 O 3 -YIG in air was drawn from the results of small batch crystal growth runs and solubility studies. The occurrence of a rather narrow field of YIG crystallization in this system was explained on the basis of relative solubilities of different oxides constituting YIG. Several long-time growth runs with some typical compositions were carried out in this system to evaluate its suitability for bulk growth of YIG crystals. The system, although possessing some inherent advantages, was found to suffer from limitations because the maximum size of the self-nucleated crystals grown hardly exceeded 2.00 mm. (author)
Lutter contre l'obésité en Afrique du Sud à l'aide des politiques fiscales
International Development Research Centre (IDRC) Digital Library (Canada)
17 nov. 2016 ... En 2008, le fardeau total des maladies non transmissibles en Afrique du Sud était estimé à 40 %, et ne cessait de croître. L'obésité est un facteur de risque de plusieurs maladies non transmissibles, dont les cardiopathies, l'hypertension, le diabète et le cancer.
HII regions in collapsing massive molecular clouds
International Nuclear Information System (INIS)
Yorke, H.W.; Bodenheimer, P.; Tenorio-Tagle, G.
1982-01-01
Results of two-dimensional numerical calculations of the evolution of HII regions associated with self-gravitating, massive molecular clouds are presented. Depending on the location of the exciting star, a champagne flow can occur concurrently with the central collapse of a nonrotating cloud. Partial evaporation of the cloud at a rate of about 0.005 solar masses/yr results. When 100 O-stars are placed at the center of a freely falling cloud of 3x10 5 solar masses no evaporation takes place. Rotating clouds collapse to disks and the champagne flow can evaporate the cloud at a higher rate (0.01 solar masses/yr). It is concluded that massive clouds containing OB-stars have lifetimes of no more than 10 7 yr. (Auth.)
Directory of Open Access Journals (Sweden)
Shanmugam M Jeyakumar
2016-01-01
Full Text Available Background & objectives: Hepatic scavenger receptor class B1 (SR-B1, a high-density lipoprotein (HDL receptor, is involved in the selective uptake of HDL-associated esterified cholesterol (EC, thereby regulates cholesterol homoeostasis and improves reverse cholesterol transport. Previously, we reported in euglycaemic obese rats (WNIN/Ob strain that feeding of vitamin A-enriched diet normalized hypercholesterolaemia, possibly through hepatic SR-B1-mediated pathway. This study was aimed to test whether it would be possible to normalize hypercholesterolaemia in glucose-intolerant obese rat model (WNIN/GR/Ob through similar mechanism by feeding identical vitamin A-enriched diet. Methods: In this study, 30 wk old male lean and obese rats of WNIN/GR-Ob strain were divided into two groups and received either stock diet or vitamin A-enriched diet (2.6 mg or 129 mg vitamin A/kg diet for 14 wk. Blood and other tissues were collected for various biochemical analyses. Results: Chronic vitamin A-enriched diet feeding decreased hypercholesterolaemia and normalized abnormally elevated plasma HDL-cholesterol (HDL-C levels in obese rats as compared to stock diet-fed obese groups. Further, decreased free cholesterol (FC and increased esterified cholesterol (EC contents of plasma cholesterol were observed, which were reflected in higher EC to FC ratio of vitamin A-enriched diet-fed obese rats. However, neither lecithin-cholesterol acyltransferase (LCAT activity of plasma nor its expression (both gene and protein in the liver were altered. On the contrary, hepatic cholesterol levels significantly increased in vitamin A-enriched diet fed obese rats. Hepatic SR-B1 expression (both mRNA and protein remained unaltered among groups. Vitamin A-enriched diet fed obese rats showed a significant increase in hepatic low-density lipoprotein receptor mRNA levels, while the expression of genes involved in HDL synthesis, namely, ATP-binding cassette protein 1 (ABCA1 and
Fossati, L.; Castro, N.; Schöller, M.; Hubrig, S.; Langer, N.; Morel, T.; Briquet, M.; Herrero, A.; Przybilla, N.; Sana, H.; Schneider, F.R.N.; de Koter, A.
2015-01-01
Within the context of the collaboration "B fields in OB stars" (BOB), we used the FORS2 low-resolution spectropolarimeter to search for a magnetic field in 50 massive stars, including two reference magnetic massive stars. Because of the many controversies of magnetic field detections obtained with
DLK1 Regulates Whole-Body Glucose Metabolism
DEFF Research Database (Denmark)
Abdallah, Basem M; Ditzel, Nicholas; Laborda, Jorge
2015-01-01
due to impaired insulin signaling in OB and lowered Glu-OCN serum levels. Furthermore, Dlk1(-/-) mice treated with Glu-OC experienced significantly lower blood glucose levels than Glu-OCN-treated wild-type mice. The data suggest that Glu-OCN-controlled production of DLK1 by pancreatic β-cells acts...... metabolism. We show that Glu-OCN specifically stimulates Dlk1 expression by the pancreas. Conversely, Dlk1-deficient (Dlk1(-/-) ) mice exhibited increased circulating Glu-OCN levels and increased insulin sensitivity, whereas mice overexpressing Dlk1 in OB displayed reduced insulin secretion and sensitivity...
Trojan, Ewa; Głombik, Katarzyna; Ślusarczyk, Joanna; Budziszewska, Bogusława; Kubera, Marta; Roman, Adam; Lasoń, Władysław; Basta-Kaim, Agnieszka
2016-02-01
Insulin-like growth factor-1 (IGF-1) promotes the growth, differentiation, and survival of both neurons and glial cells, and it is believed to exert antidepressant-like activity. Thus, disturbances in the IGF-1 system could be responsible for the course of depression. To date, there have been no papers showing the impact of chronic antidepressant treatment on the IGF-1 network in the olfactory bulb (OB) in an animal model of depression. Prenatal stress was used as model of depression. Twenty-four 3-month-old male offspring of control and stressed mothers were subjected to behavioral testing (forced swim test). The mRNA expression of IGF-1 and IGF-1 receptor (IGF-1R) and the protein level of IGF-1 and its phosphorylation, as well as the concentrations of IGF-binding proteins (IGFBP-2, -4, -3, and -6), were measured in OBs before and after chronic imipramine, fluoxetine, or tianeptine administration. Adult rats exposed prenatally to stressful stimuli displayed not only depression-like behavior but also decreased IGF-1 expression, dysregulation in the IGFBP network, and diminished mRNA expression, as well as IGF-1R phosphorylation, in the OB. The administration of antidepressants normalized most of the changes in the IGF-1 system of the OB evoked by prenatal stress. These results suggested a beneficial effect of chronic antidepressant drug treatment in the alleviation of IGF-1 family malfunction in OBs in an animal model of depression.
International Nuclear Information System (INIS)
Bai, Guangyue; Wang, Yujie; Ding, Yanhong; Zhuo, Kelei; Wang, Jianji; Bastos, Margarida
2016-01-01
Highlights: • ITC provided thermodynamic characterization of self-association of oppositely charged gemini/SDS surfactants. • Phase transitions and corresponding enthalpies were obtained by ITC. • The transitions reflect a change in morphology, supported by Cryo-TEM images. • Conductivity and ITC results show very good agreement. • An asymmetric distribution of surfactants in the aggregates is supported by results. - Abstract: The thermodynamics and phase behavior of mixtures of cationic gemini surfactant decanediyl-α,ω-bis(dodecyldimethylammonium bromide) (12-10-12) and sodium dodecylsulfate (SDS) were studied in the dilute SDS-rich region. The enthalpy of interaction between both surfactant monomers before the critical micelle concentration for the mixture (cmc_m_i_x) was determined by isothermal titration calorimetry (ITC). After the cmc_m_i_x, ITC results exhibited a first process associated with a large endothermic enthalpy change followed by a second one with a very small exothermic enthalpy change. In the same regions, the conductivity curves show an increase in slope after the break, followed by a plateau region, respectively for the two processes. The combined results from the various methodologies used lead us to propose that the first process reflects the formation of non-spherical micelles and the second one the vesicle formation. The area per catanionic complex was obtained through surface pressure measurements, leading to an apparent packing parameter ⩾1. The observed behavior may be rationalized on the basis of the hypothesis that both surfactants distribute asymmetrically in the vesicle bilayers and unevenly in the non-spherical micelle. In order to get structural information Cryo-TEM experiments were performed, which provided images that support this interpretation. From all the information gathered a phase diagram was mapped, including three one-phase regions of spherical micelles, non-spherical micelles and vesicles.
Nelson, Mark; Arastéh, Keikawus; Clotet, Bonaventura; Cooper, David A.; Henry, Keith; Katlama, Christine; Lalezari, Jacob P.; Lazzarin, Adriano; Montaner, Julio S. G.; O'Hearn, Mary; Piliero, Peter J.; Reynes, Jacques; Trottier, Benoit; Walmsley, Sharon L.; Cohen, Calvin; Eron, Joseph J.; Kuritzkes, Daniel R.; Lange, Joep; Stellbrink, Hans-Jürgen; Delfraissy, Jean-François; Buss, Neil E.; Donatacci, Lucille; Wat, Cynthia; Smiley, Lynn; Wilkinson, Martin; Valentine, Adeline; Guimaraes, Denise; DeMasi, Ralph; Chung, Jain; Salgo, Miklos P.
2005-01-01
The T-20 Versus Optimized Background Regimen Only (TORO) 1 and TORO 2 clinical trials are open-label, controlled, parallel-group, phase 3 studies comparing enfuvirtide plus an optimized background (OB) of antiretrovirals (n = 661) with OB alone (n = 334) in treatment-experienced HIV-1-infected
Jiang, Yan; Lu, Xing-Yu; Chen, Hong; Mao, Shi-Zhen; Liu, Mai-Li; Luo, Ping-Ya; Du, You-Ru
2009-06-18
Three kinds of conventional surfactants, namely, two nonionic surfactants [polyethylene glycol (23) lauryl ether (Brij-35) and Triton X-100 (TX-100)], one cationic surfactant [n-tetradecyltrimethyl ammonium bromide (TTAB)], and an anionic surfactant [sodium n-dodecyl sulfate (SDS)}, were mixed into the quaternary ammonium gemini surfactant [C(14)H(29)N(+)(CH(3))(2)](2)(CH(2))(2).2Br(-) (14-2-14) in aqueous solution. The exchange rate constants between 14-2-14 molecules in the mixed micelles and those in the bulk solution were detected using two nuclear magnetic resonance (NMR) methods: one-dimensional (1D) line shape analysis and two-dimensional (2D) exchange spectroscopy (EXSY). The results obtained from these two methods were consistent. Both showed that mixing a nonionic conventional surfactant, either Brij-35 or TX-100, enhanced the exchange process between the 14-2-14 molecules in the mixed micelles and those in the bulk solution. In contrast, the anionic surfactant SDS and the cationic surfactant TTAB slowed the process slightly.
Energy Technology Data Exchange (ETDEWEB)
Wang, Jason J.; Graham, James R.; De Rosa, Robert J.; Kalas, Paul; Chiang, Eugene; Duchêne, Gaspard [Astronomy Department, University of California, Berkeley, Berkeley, CA 94720 (United States); Pueyo, Laurent; Chen, Christine; Greenbaum, Alexandra Z. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Nielsen, Eric L. [SETI Institute, Carl Sagan Center, 189 Bernardo Avenue, Mountain View, CA 94043 (United States); Millar-Blanchaer, Max [Department of Astronomy and Astrophysics, University of Toronto, Toronto, ON M5S 3H4 (Canada); Ammons, S. Mark [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94040 (United States); Bulger, Joanna [School of Earth and Space Exploration, Arizona State University, P.O. Box 871404, Tempe, AZ 85287 (United States); Cardwell, Andrew; Goodsell, Stephen J. [Gemini Observatory, Casilla 603, La Serena (Chile); Chilcote, Jeffrey K. [Dunlap Institute for Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H4 (Canada); Doyon, René [Institut de Recherche sur les Exoplanètes, Départment de Physique, Université de Montréal, Montréal, QC H3C 3J7 (Canada); Draper, Zachary H. [University of Victoria, 3800 Finnerty Road, Victoria, BC V8P 5C2 (Canada); Esposito, Thomas M.; Fitzgerald, Michael P. [Department of Physics and Astronomy, University of California, Los Angeles, Los Angeles, CA 90095 (United States); and others
2015-10-01
We present Gemini Planet Imager (GPI) observations of AU Microscopii, a young M dwarf with an edge-on, dusty debris disk. Integral field spectroscopy and broadband imaging polarimetry were obtained during the commissioning of GPI. In our broadband imaging polarimetry observations, we detect the disk only in total intensity and find asymmetries in the morphology of the disk between the southeast (SE) and northwest (NW) sides. The SE side of the disk exhibits a bump at 1″ (10 AU projected separation) that is three times more vertically extended and three times fainter in peak surface brightness than the NW side at similar separations. This part of the disk is also vertically offset by 69 ± 30 mas to the northeast at 1″ when compared to the established disk midplane and is consistent with prior Atacama Large Millimeter/submillimeter Array and Hubble Space Telescope/Space Telescope Imaging Spectrograph observations. We see hints that the SE bump might be a result of detecting a horizontal sliver feature above the main disk that could be the disk backside. Alternatively, when including the morphology of the NW side, where the disk midplane is offset in the opposite direction ∼50 mas between 0.″4 and 1.″2, the asymmetries suggest a warp-like feature. Using our integral field spectroscopy data to search for planets, we are 50% complete for ∼4 M{sub Jup} planets at 4 AU. We detect a source, resolved only along the disk plane, that could either be a candidate planetary mass companion or a compact clump in the disk.
Directory of Open Access Journals (Sweden)
Jihan Huang
2017-01-01
Full Text Available This study aimed to evaluate the clinical analgesic efficacy and identify the molecular targets of XGDP for treating primary dysmenorrhea (PD by a network pharmacology approach. Analysis of pain disappearance rate of XGDP in PD treatment was conducted based on data from phase II and III randomized, double-blind, double-simulation, and positive parallel controlled clinical trials. The bioactive compounds were obtained by the absorption, distribution, metabolism, and excretion processes with oral bioavailability (OB and drug-likeness (DL evaluation. Subsequently, target prediction, pathway identification, and network construction were employed to clarify the mechanisms of the analgesic effect of XGDP on PD. The pain disappearance rates in phase II and III clinical trials of XGDP in PD treatment were 62.5% and 55.8%, respectively, yielding a significant difference (P<0.05 when compared with the control group using Tongjingbao granules (TJBG. Among 331 compounds, 53 compounds in XGDP were identified as the active compounds related to PD through OB, DL, and target prediction. The active compounds and molecular targets of XGDP were identified, and our study showed that XGDP may exert its therapeutic effects on PD through the regulation of the targets related to anti-inflammation analgesia and central analgesia and relieving smooth muscle contraction.
New Parallaxes for the Upper Scorpius OB Association
Donaldson, J. K.; Weinberger, A. J.; Gagné, J.; Boss, A. P.; Keiser, S. A.
2017-11-01
Upper Scorpius is a subgroup of the nearest OB association, Scorpius-Centaurus. Its young age makes it an important association to study star and planet formation. We present parallaxes to 52 low-mass stars in Upper Scorpius, 28 of which have full kinematics. We measure ages of the individual stars by combining our measured parallaxes with pre-main-sequence evolutionary tracks. We find a significant difference in the ages of stars with and without circumstellar disks. The stars without disks have a mean age of 4.9 ± 0.8 Myr and those with disks have an older mean age of 8.2 ± 0.9 Myr. This somewhat counterintuitive result suggests that evolutionary effects in young stars can dominate their apparent ages. We also attempt to use the 28 stars with full kinematics (I.e., proper motion, radial velocity (RV), and parallax) to trace the stars back in time to their original birthplace to obtain a trackback age. As expected, given the large measurement uncertainties on available RV measurements, we find that measurement uncertainties alone cause the group to diverge after a few Myr.
Nature vs. Nurture: The influence of OB star environments on proto-planetary disk evolution
Bouwman, Jeroen
2006-09-01
We propose a combined IRAC/IRS study of a large, well-defined and unbiased X-ray selected sample of pre-main-sequence stars in three OB associations: Pismis 24 in NGC 6357, NGC 2244 in the Rosette Nebula, and IC 1795 in the W3 complex. The samples are based on recent Chandra X-ray Observatory studies which reliably identify hundreds of cluster members and were carefully chosen to avoid high infrared nebular background. A new Chandra exposure of IC 1795 is requested, and an optical followup to characterise the host stars is planned.
Directory of Open Access Journals (Sweden)
Mohammed A Al-Shargabi
Full Text Available Optical burst switching (OBS networks have been attracting much consideration as a promising approach to build the next generation optical Internet. A solution for enhancing the Quality of Service (QoS for high priority real time traffic over OBS with the fairness among the traffic types is absent in current OBS' QoS schemes. In this paper we present a novel Real Time Quality of Service with Fairness Ratio (RT-QoSFR scheme that can adapt the burst assembly parameters according to the traffic QoS needs in order to enhance the real time traffic QoS requirements and to ensure the fairness for other traffic. The results show that RT-QoSFR scheme is able to fulfill the real time traffic requirements (end to end delay, and loss rate ensuring the fairness for other traffics under various conditions such as the type of real time traffic and traffic load. RT-QoSFR can guarantee that the delay of the real time traffic packets does not exceed the maximum packets transfer delay value. Furthermore, it can reduce the real time traffic packets loss, at the same time guarantee the fairness for non real time traffic packets by determining the ratio of real time traffic inside the burst to be 50-60%, 30-40%, and 10-20% for high, normal, and low traffic loads respectively.
De la ferme à la fourchette – lutte contre l'obésité chez les enfants ...
International Development Research Centre (IDRC) Digital Library (Canada)
26 avr. 2016 ... ... but de combattre l'obésité chez les enfants. La démarche repose sur trois piliers, à savoir augmenter la proportion de fruits et de légumes frais dans les repas servis à l'école, faciliter l'approvisionnement en produits auprès des agriculteurs locaux et favoriser l'augmentation de la production maraîchère.
THANOS, PANAYOTIS K.; RAMALHETE, ROBERTO C.; MICHAELIDES, MICHAEL; PIYIS, YIANNI K.; WANG, GENE-JACK; VOLKOW, NORA D.
2009-01-01
Leptin receptor dysfunction results in overeating and obesity. Leptin regulates hypothalamic signaling that underlies the motivation to hyperphagia, but the interaction between leptin and cannabinoid signaling is poorly understood. We evaluated the role of cannabinoid 1 receptors (CB1R) in overeating and the effects of food deprivation on CB1R in the brain. One-month-old Zucker rats were divided into unrestricted and restricted (fed 70% of unrestricted rats) diet groups and maintained until adulthood (4 months). Levels of relative binding sites of CB1R (CB1R binding levels) were assessed using [3H] SR141716A in vitro autoradiography. These levels were higher (except cerebellum and hypothalamus) at 4 months than at 1 month of age. One month CB1R binding levels for most brain regions did not differ between Ob and Lean (Le) rats (except in frontal and cingulate cortices in Le and in the hypothalamus in Ob). Four month Ob rats had higher CB1R binding levels than Le in most brain regions and food restriction was associated with higher CB1R levels in all brain regions in Ob, but not in Le rats. CB1R binding levels increased between adolescence and young adulthood which we believe was influenced by leptin and food availability. The high levels of CB1R in Ob rats suggest that leptin's inhibition of food-intake is in part mediated by downregulation of CB1R and that leptin interferes with CB1R upregulation under food-deprivation conditions. These results are consistent with prior findings showing increased levels of endogenous cannabinoids in the Ob rats corroborating the regulation of cannabinoid signaling by leptin. PMID:18563836
A Novel Congestion Detection Scheme in TCP Over OBS Networks
Shihada, Basem
2009-02-01
This paper introduces a novel congestion detection scheme for high-bandwidth TCP flows over optical burst switching (OBS) networks, called statistical additive increase multiplicative decrease (SAIMD). SAIMD maintains and analyzes a number of previous round-trip time (RTTs) at the TCP senders in order to identify the confidence with which a packet loss event is due to network congestion. The confidence is derived by positioning short-term RTT in the spectrum of long-term historical RTTs. The derived confidence corresponding to the packet loss is then taken in the developed policy for TCP congestion window adjustment. We will show through extensive simulation that the proposed scheme can effectively solve the false congestion detection problem and significantly outperform the conventional TCP counterparts without losing fairness. The advantages gained in our scheme are at the expense of introducing more overhead in the SAIMD TCP senders. Based on the proposed congestion control algorithm, a throughput model is formulated, and is further verified by simulation results.
Czech Academy of Sciences Publication Activity Database
Pašava, J.; Veselovský, F.; Dobeš, P.; Haluzová, Eva; Ackerman, Lukáš; Tásler, R.
2016-01-01
Roč. 49, č. 1 (2016), s. 47-52 ISSN 0514-8057 R&D Projects: GA ČR GA13-15390S Institutional support: RVO:67985831 Keywords : Obří důl skarn-type deposit * mineralogy * fluid inclusions * sulfur isotopes Subject RIV: DB - Geology ; Mineralogy
International Nuclear Information System (INIS)
Kenna, T.C.; Sayles, F.L.
2002-01-01
Isotopic ratios of Pu and Np measured in sediment cores from 5 locations in the Ob River drainage basin show clear evidence of input from sources other than global fallout (non-fallout sources). Historical contaminant records obtained by combining isotopic ratio information with chronological information indicate that non-fallout inputs are from several sources that have varied significantly over the past 50 years. Unique isotopic signatures observed in sediments from tributaries that drain areas containing known or suspected sources of non-fallout contamination are used to identify the source of materials in sediments collected at downstream locations. These data can lead to a better understanding of the transport behavior, fate, and relative importance of particle reactive, weapons related contaminants originating from the nuclear facilities Mayak, Tomsk-7, and Semipalitinsk, which lie within the drainage basin. From our work to date, we draw the following conclusions: (1) Persistent non-fallout contamination is observed in the Ob River above its confluence with the Irtysh River, indicating contamination from the Tomsk-7 facility. (2) Non-fallout contamination in the Tobol River above its confluence with the Irtysh River indicates contamination from the Mayak facility. (3) Non-fallout contamination in the Irtysh River above its confluence with the Tobol River indicates contamination from the Semipalitinsk weapons test site. (4) The occurrence of isotopic ratios in Ob Delta sediments that are similar to those observed in source tributaries suggests that contamination from at least two sources has been transported along the length of the river system. (5) Global fallout, a result of high-yield atmospheric weapons tests conducted by the FSU and USA primarily, is the dominant source of Pu and Np to the region; however, there have been brief periods when inputs from non-fallout sources exceeded those from global fallout
International Nuclear Information System (INIS)
Sayles, F.L.; Livingston, H.D.; Panteleyev, G.P.
1997-01-01
This paper presents the first results of a project designed to examine the transfer of particle-associated artificial radionuclides down the Ob River in Siberia to its delta over the past 5 decades. The main sources include fallout from atmospheric nuclear weapons tests and weapons complexes and test sites of the Former Soviet Union in or near the Ob watershed. The approach is to measure the accumulation of the radionuclides in undisturbed delta sediments - obtaining a record of their deposition over time. These records were found in sediments of shallow lakes apart from, and connected to, the main channel. Sediment cores were collected in the summer of 1994 using a shallow draft catamaran to reach these lakes from a support ship in the main channel. Measurements are presented on the depth distributions of 137 Cs and Pu isotopes and their inventories in a series of dated sediment cores - including one from a location in the Taz Estuary (which does not receive Ob River sediments). Sediment dating was carried out using the excess 210 Pb technique. The results obtained are compared with known information on the temporal history of releases from the various sources and characteristics of the isotopic composition of the sources. The results show that good records of radionuclide deposition indicate that the major fraction of 137 Cs and Pu isotopes deposited in these delta sediments comes from atmospheric nuclear weapons test fallout - both delivered directly from the atmosphere and from downstream transport of watershed sediments. No more than 25% of the observed inventories could be derived from other sources
Automated data processing architecture for the Gemini Planet Imager Exoplanet Survey
Wang, Jason J.; Perrin, Marshall D.; Savransky, Dmitry; Arriaga, Pauline; Chilcote, Jeffrey K.; De Rosa, Robert J.; Millar-Blanchaer, Maxwell A.; Marois, Christian; Rameau, Julien; Wolff, Schuyler G.; Shapiro, Jacob; Ruffio, Jean-Baptiste; Maire, Jérôme; Marchis, Franck; Graham, James R.; Macintosh, Bruce; Ammons, S. Mark; Bailey, Vanessa P.; Barman, Travis S.; Bruzzone, Sebastian; Bulger, Joanna; Cotten, Tara; Doyon, René; Duchêne, Gaspard; Fitzgerald, Michael P.; Follette, Katherine B.; Goodsell, Stephen; Greenbaum, Alexandra Z.; Hibon, Pascale; Hung, Li-Wei; Ingraham, Patrick; Kalas, Paul; Konopacky, Quinn M.; Larkin, James E.; Marley, Mark S.; Metchev, Stanimir; Nielsen, Eric L.; Oppenheimer, Rebecca; Palmer, David W.; Patience, Jennifer; Poyneer, Lisa A.; Pueyo, Laurent; Rajan, Abhijith; Rantakyrö, Fredrik T.; Schneider, Adam C.; Sivaramakrishnan, Anand; Song, Inseok; Soummer, Remi; Thomas, Sandrine; Wallace, J. Kent; Ward-Duong, Kimberly; Wiktorowicz, Sloane J.
2018-01-01
The Gemini Planet Imager Exoplanet Survey (GPIES) is a multiyear direct imaging survey of 600 stars to discover and characterize young Jovian exoplanets and their environments. We have developed an automated data architecture to process and index all data related to the survey uniformly. An automated and flexible data processing framework, which we term the Data Cruncher, combines multiple data reduction pipelines (DRPs) together to process all spectroscopic, polarimetric, and calibration data taken with GPIES. With no human intervention, fully reduced and calibrated data products are available less than an hour after the data are taken to expedite follow up on potential objects of interest. The Data Cruncher can run on a supercomputer to reprocess all GPIES data in a single day as improvements are made to our DRPs. A backend MySQL database indexes all files, which are synced to the cloud, and a front-end web server allows for easy browsing of all files associated with GPIES. To help observers, quicklook displays show reduced data as they are processed in real time, and chatbots on Slack post observing information as well as reduced data products. Together, the GPIES automated data processing architecture reduces our workload, provides real-time data reduction, optimizes our observing strategy, and maintains a homogeneously reduced dataset to study planet occurrence and instrument performance.
International Nuclear Information System (INIS)
Nikitin, Alexander I.; Chumichev, Vladimir B.; Valetova, Nailia K.; Katrich, Ivan Yu.; Kabanov, Alexander I.; Dunaev, Gennady E.; Shkuro, Valentina N.; Rodin, Victor M.; Mironenko, Alexander N.; Kireeva, Elena V.
2007-01-01
Data on content of 90 Sr, 137 Cs, 239,240 Pu and 3 H in water of the Tobol-Irtysh part of the Techa-Iset-Tobol-Irtysh-Ob river system (through which the 'Mayak' PA radioactive wastes are transported) are presented and discussed. The data were received in 2004-2005 under the ISTC project on radioecological monitoring of the Tobol and Irtysh rivers. Monthly observations of 137 Cs, 90 Sr and 3 H content in water in the area of the Tobol and Irtysh confluence have been conducted starting from May 2004. To obtain information on the investigated river system as a whole, the radioecological survey of the Tobol and Irtysh rivers at the section from the mouth of the Iset River to the confluence with the Ob River was carried out in 2004. It is shown that the impact of 'Mayak' PA waste transport by 90 Sr is distinctly traced as far as the area of the Irtysh and Ob confluence
Zhou, Shutong; Yu, Dongni; Ning, Shangyong; Zhang, Heli; Jiang, Lei; He, Lei; Li, Miao; Sun, Mingxiao
2015-01-01
The aim of this study was to clarify the relationship among Rac1 expression and activation, oxidative stress and β cell dysfunction in obesity. In vivo, serum levels of glucose, insulin, oxidative stress markers and Rac1 expression were compared between ob/ob mice and C57BL/6J controls. Then, these variables were rechecked after the administration of the specific Rac1 inhibitor-NSC23766 in ob/ob mice. In vitro, NIT-1 β cells were cultured in a hyperglycemic and/or hyperlipidemic state with or without NSC23766, and the differences of Rac1 expression and translocation, NADPH oxidase(Nox) enzyme activity, reactive oxygen species (ROS) and insulin mRNA were observed. ob/ob mice displayed abnormal glycometabolism, oxidative stress and excessive expression of Rac1 in the pancreas. NSC23766 injection inhibited the expression of Rac1 in the pancreas, along with amelioration of oxidative stress and glycometabolism in obese mice. Under hyperglycemic and/or hyperlipidemic conditions, Rac1 translocated to the cellular membrane, induced activation of the NADPH oxidase enzyme and oxidative stress, and simultaneously reduced the insulin mRNA expression in NIT-1 β cells. Inhibiting Rac1 activity could alleviate oxidative stress and meliorate the decline of insulin mRNA in β cells. Rac1 might contribute to oxidative stress systemically and locally in the pancreas in obesity. The excessive activation and expression of Rac1 in obesity were associated with β cell dysfunction through ROS production. © 2015 S. Karger AG, Basel.
Sensitivity analysis of P-waves and S-waves to gas hydrate in the Shenhu area using OBS
Xing, Lei; Liu, Xueqin; Zhang, Jin; Liu, Huaishan; Zhang, Jing; Li, Zizheng; Wang, Jianhua
2018-02-01
Compared to towed streamers, ocean-bottom seismometers (OBS) obtain both S-wave data and richer wavefield information. In this paper, the induced polarization method is used to conduct wavefield separation on OBS data obtained from the Shenhu area in the South China Sea. A comparison of the changes in P- and S-waves, and a comprehensive analysis of geological factors within the area, enable analysis and description of the occurrence of natural gas hydrate in the study area. Results show an increase in P-wave velocity when natural gas hydrate exists in the formation, whereas the S-wave velocity remains almost constant, as S-waves can only propagate through the rock skeleton. Therefore, the bottom-simulating reflection (BSR) response of the P-wave is better than that of the S-wave in the frequency analysis profile. In a wide-angle section, the refractive wave of the hydrate layer is evident when using P-wave components but identification is difficult with S-wave components. This velocity model illustrates the sensitivity of P- and S-wave components to gas hydrate. The use of this polarization method and results of analysis provide technical and theoretical support for research on hydrate deposits and other geological features in the Shenhu area.
Polimorfismos del gen ob en bovinos de raza holstein en la Comarca Lagunera, México
Sarai S. Mendoza-Retana; Miguel A. Gallegos-Robles; Uriel González-Salas; José L. García-Hernández; Manuel Fortis-Hernández; Cirilo Vázquez-Vázquez; Héctor I. Trejo-Escareño
2017-01-01
La Comarca Lagunera es la cuenca lechera más importante de México. En la actualidad se están utilizando diversas técnicas que permiten evaluar genéticamente el animal a una edad temprana, permitiendo seleccionar futuros reproductores con características deseables. Entre los genes relacionados con la producción de leche, se encuentran el gen Ob también llamado gen Leptina el cual actúa sobre el sistema nervioso central y tejidos periféricos jugando un papel muy importante ...
Directory of Open Access Journals (Sweden)
Xiaodong Gao
2016-05-01
Full Text Available Checkpoint kinase 1 (Chk1 is an important serine/threonine kinase with a self-protection function. The combination of Chk1 inhibitors and anti-cancer drugs can enhance the selectivity of tumor therapy. In this work, a set of 1,7-diazacarbazole analogs were identified as potent Chk1 inhibitors through a series of computer-aided drug design processes, including three-dimensional quantitative structure–activity relationship (3D-QSAR modeling, molecular docking, and molecular dynamics simulations. The optimal QSAR models showed significant cross-validated correlation q2 values (0.531, 0.726, fitted correlation r2 coefficients (higher than 0.90, and standard error of prediction (less than 0.250. These results suggested that the developed models possess good predictive ability. Moreover, molecular docking and molecular dynamics simulations were applied to highlight the important interactions between the ligand and the Chk1 receptor protein. This study shows that hydrogen bonding and electrostatic forces are key interactions that confer bioactivity.
DEFF Research Database (Denmark)
Chen, Li; Shi, Kaikai; Frary, Charles
2015-01-01
Remodeling of the actin cytoskeleton through actin dynamics is involved in a number of biological processes, but its role in human stromal (skeletal) stem cells (hMSCs) differentiation is poorly understood. In the present study, we demonstrated that stabilizing actin filaments by inhibiting gene...... expression of the two main actin depolymerizing factors (ADFs): Cofilin 1 (CFL1) and Destrin (DSTN) in hMSCs, enhanced cell viability and differentiation into osteoblastic cells (OB) in vitro, as well as heterotopic bone formation in vivo. Similarly, treating hMSC with Phalloidin, which is known to stabilize...... polymerized actin filaments, increased hMSCs viability and OB differentiation. Conversely, Cytocholasin D, an inhibitor of actin polymerization, reduced cell viability and inhibited OB differentiation of hMSC. At a molecular level, preventing Cofilin phosphorylation through inhibition of LIM domain kinase 1...
Yang, HongJiang; Wang, Enliang; Dong, WenXiu; Gong, Maomao; Shen, Zhenjie; Tang, Yaguo; Shan, Xu; Chen, Xiangjun
2018-05-01
The a b i n i t i o molecular dynamics (MD) simulations using an atom-centered density matrix propagation method have been carried out to investigate the fragmentation of the ground-state triply charged carbon dioxide, CO23 +→C+ + Oa+ + Ob+ . Ten thousands of trajectories have been simulated. By analyzing the momentum correlation of the final fragments, it is demonstrated that the sequential fragmentation dominates in the three-body dissociation, consistent with our experimental observations which were performed by electron collision at impact energy of 1500 eV. Furthermore, the MD simulations allow us to have detailed insight into the ultrafast evolution of the molecular bond breakage at a very early stage, within several tens of femtoseconds, and the result shows that the initial nuclear vibrational mode plays a decisive role in switching the dissociation pathways.
Stutzki, J.; Stacey, G. J.; Genzel, R.; Harris, A. I.; Jaffe, d. T.; Lugten, J. B.
1987-01-01
Millimeter, submillimeter, and far infrared spectroscopic observations of the M17 SW star formation region are discussed. The results require the molecular cloud near the interface to be clumpy or filamentary. As a consequence, far ultraviolet radiation from the central OB stellar cluster can penetrate into the dense molecular cloud to a depth of several pc, thus creating bright and extended (CII) emission from the photodissociated surfaces of dense atomic and molecular clumps or sheets. The extended (CII) emission throughout the molecular cloud SW of the M17 complex has a level 20 times higher than expected from a single molecular cloud interface exposed to an ultraviolet radiation field typical of the solar neighborhood. This suggests that the molecular cloud as a whole is penetrated by ultraviolet radiation and has a clumpy or filamentary structure. The number of B stars expected to be embedded in the M17 molecular cloud probably can provide the UV radiation necessary for the extended (CII) emission. Alternatively, the UV radiation could be external, if the interstellar radiation in the vicinity of M17 is higher than in the solar neighborhood.
Design of the science-fold mirrors for the Gemini telescopes
Peschel, Thomas; Damm, Christoph; Heilemann, Wolfgang
2000-07-01
As a part of the Acquisition and Guidance Unit for the Gemini project a light-weight, 50 cm flat mirror has been designed at the Fraunhofer Institute for Applied Optics and Precision Mechanics in Jena as a subcontractor of the Carl Zeiss Jena company. A light-weight design of the mirror and its mount was essential since the total mass of the whole assembly including the positioning system was limited to 50 kg while interferometric quality of the mirror surface was required for arbitrary orientation. The overall surface error was below 54 nm r.m.s. while 27 nm was achieved in the central part. The mirror was fabricated from low-expansion glass ceramics to avoid thermally induced deformations. By milling pockets into its rear surface the mass of the mirror was reduced by 70%. The mirror is mounted cinematically via six solid-state hinges to three steel levers. The levers are connected to the mount frame at their centers via ball-and- sphere joints. This arrangement determines the position of the mirror uniquely while it allows for the thermal expansion of the mount frame. The position of the mirror as well as its tilt around an axis perpendicular to the optical one may be controlled a precision of 20 micrometers and 3 arcsec, respectively. The tilt axis is driven directly by two high- torque motors. To avoid an excessive power consumption of the motors the torque of the mirror head to be compensated for by a counterweight mechanism. The mirror may be deployed into the optical path using spindle driven linear rails.
Ormazabal, Paulina; Scazzocchio, Beatrice; Varì, Rosaria; Santangelo, Carmela; D'Archivio, Massimo; Silecchia, Gianfranco; Iacovelli, Annunziata; Giovannini, Claudio; Masella, Roberta
2018-05-16
The occurrence of chronic inflammation in visceral adipose tissue (VAT) in obese subjects precipitates the development of insulin resistance and type 2 diabetes (T2D). Anthocyanins and their main metabolite protocatechuic acid (PCA) have been demonstrated to stimulate insulin signaling in human adipocytes. The aim of this study was to investigate whether PCA is able to modulate insulin responsiveness and inflammation in VAT from obese (OB) and normal weight (NW) subjects. VATs obtained from NW and OB subjects were incubated or not (control) with 100 μM PCA for 24 h. After incubation, tissues untreated and treated with PCA were acutely stimulated with insulin (20 nM, 20 min). PTP1B, p65 NF-κB, phospho-p65 NF-κB, IRS-1, IRβ, Akt, GLUT4 as well as basal and insulin-stimulated Tyr-IRS-1 and Ser-Akt phosphorylations were assessed by Western blotting in NW- and OB-VAT. Samples were assessed for PTP1B activity and adipocytokine secretion. PCA restored insulin-induced phosphorylation in OB-VAT by increasing phospho-Tyr-IRS-1 and phospho-Ser-Akt after insulin stimulation as observed in NW-VAT (p < 0.05). PTP1B activity was lower in OB-VAT treated with PCA with respect to untreated (p < 0.05). Compared to non-treated tissues, PCA reduced phospho-p65 NF-κB and IL-6 in OB-VAT, and IL-1β in NW-VAT (p < 0.05); and increased adiponectin secretion in NW-VAT (p < 0.05). PCA restores the insulin responsiveness of OB-VAT by increasing IRS-1 and Akt phosphorylation which could be related with the lower PTP1B activity found in PCA-treated OB-VAT. Furthermore, PCA diminishes inflammation in VAT. These results support the beneficial role of an anthocyanin-rich diet against inflammation and insulin resistance in obesity.
Eukaryotic RNA polymerase subunit RPB8 is a new relative of the OB family.
Krapp, S; Kelly, G; Reischl, J; Weinzierl, R O; Matthews, S
1998-02-01
RNA polymerase II subunit RPB8 is an essential subunit that is highly conserved throughout eukaryotic evolution and is present in all three types of nuclear RNA polymerases. We report the first high resolution structural insight into eukaryotic RNA polymerase architecture with the solution structure of RPB8 from Saccharomyces cerevisiae. It consists of an eight stranded, antiparallel beta-barrel, four short helical regions and a large, unstructured omega-loop. The strands are connected in classic Greek-key fashion. The overall topology is unusual and contains a striking C2 rotational symmetry. Furthermore, it is most likely a novel associate of the oligonucleotide/oligosaccharide (OB) binding protein class.
Suresh, D. M.; Amalanathan, M.; Hubert Joe, I.; Bena Jothy, V.; Diao, Yun-Peng
2014-09-01
The molecular structure, vibrational analysis and molecular docking analysis of the 3-Methyl-1,4-dioxo-1,4-dihydronaphthalen-2-yl 4-aminobenzoate (MDDNAB) molecule have been carried out using FT-IR and FT-Raman spectroscopic techniques and DFT method. The equilibrium geometry, harmonic vibrational wave numbers, various bonding features have been computed using density functional method. The calculated molecular geometry has been compared with experimental data. The detailed interpretation of the vibrational spectra has been carried out by using VEDA program. The hyper-conjugative interactions and charge delocalization have been analyzed using natural bond orbital (NBO) analysis. The simulated FT-IR and FT-Raman spectra satisfactorily coincide with the experimental spectra. The PES and charge analysis have been made. The molecular docking was done to identify the binding energy and the Hydrogen bonding with the cancer protein molecule.
Influence of the metabolic syndrome on leptin and leptin receptor in breast cancer.
Carroll, Paul A; Healy, Laura; Lysaght, Joanne; Boyle, Terry; Reynolds, John V; Kennedy, M John; Pidgeon, Graham; Connolly, Elizabeth M
2011-08-01
Obesity and its associated metabolic syndrome (MetS) are recognized risk factors for breast cancer. The molecular basis for this association remains largely unknown. Adipokines, in particular leptin and adiponectin, are thought to form part of the mechanism linking obesity with cancer through their altered expression/production either systemically (endocrine pathway) or locally (paracrine/autocrine pathway). Using quantitative PCR, mRNA expression of adiponectin (AdipoQ) and leptin (Ob) in mammary adipose tissue (MAT), intratumoral leptin and associated ligand receptors (ObR, AdipoR1, and AdipoR2) was examined in 77 patients with complete anthropomorphic and serological data. Expression of Ob in MAT, and ObR in matched tumor tissue was significantly higher in patients with MetS compared to obese only or normal weight cancer patients (P < 0.005). There was no difference in intratumoral leptin adiponectin or its ligand receptors in the same groups. Individual features of MetS correlated with Ob and ObR expression, but not obesity markers (BMI, waist circumference). mRNA expression of leptin (Ob) and ObR, in adipose tissue and matched tumor samples, respectively, appear to be associated with obesity status in breast cancer. Increasing insulin resistance is a predominant feature of this higher Ob/ObR expression observed. These novel data indicate that the MetS may be an amenable risk factor for breast cancer. Copyright © 2011 Wiley-Liss, Inc.
Energy Technology Data Exchange (ETDEWEB)
Nikitin, Alexander I. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation)]. E-mail: nikitin@typhoon.obninsk.ru; Chumichev, Vladimir B. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Valetova, Nailia K. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Katrich, Ivan Yu. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Kabanov, Alexander I. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Dunaev, Gennady E. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Shkuro, Valentina N. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Rodin, Victor M. [Tobolsk Biological Station of RAS, 15, Voikov street, Tobolsk, Tyumen region 626150 (Russian Federation); Mironenko, Alexander N. [Tobolsk Biological Station of RAS, 15, Voikov street, Tobolsk, Tyumen region 626150 (Russian Federation); Kireeva, Elena V. [Tobolsk Biological Station of RAS, 15, Voikov street, Tobolsk, Tyumen region 626150 (Russian Federation)
2007-07-15
Data on content of {sup 90}Sr, {sup 137}Cs, {sup 239,240}Pu and {sup 3}H in water of the Tobol-Irtysh part of the Techa-Iset-Tobol-Irtysh-Ob river system (through which the 'Mayak' PA radioactive wastes are transported) are presented and discussed. The data were received in 2004-2005 under the ISTC project on radioecological monitoring of the Tobol and Irtysh rivers. Monthly observations of {sup 137}Cs, {sup 90}Sr and {sup 3}H content in water in the area of the Tobol and Irtysh confluence have been conducted starting from May 2004. To obtain information on the investigated river system as a whole, the radioecological survey of the Tobol and Irtysh rivers at the section from the mouth of the Iset River to the confluence with the Ob River was carried out in 2004. It is shown that the impact of 'Mayak' PA waste transport by {sup 90}Sr is distinctly traced as far as the area of the Irtysh and Ob confluence.
International Nuclear Information System (INIS)
Chang, J.-K.; Li, C.-J.; Liao, H.-J.; Wang, C.-K.; Wang, G.-J.; Ho, M.-L.
2009-01-01
It has been reported that anti-inflammatory drugs (AIDs) inhibited bone repair in animal studies, and suppressed proliferation and induced cell death in rat osteoblast cultures. In this study, we further investigated the molecular mechanisms of AID effects on proliferation and cell death in human osteoblasts (hOBs). We examined the effects of dexamethasone (10 -7 and 10 -6 M), non-selective non-steroidal anti-inflammatory drugs (NSAIDs): indomethacin, ketorolac, piroxicam and diclofenac (10 -5 and 10 -4 M), and COX-2 inhibitor: celecoxib (10 -6 and 10 -5 M) on proliferation, cytotoxicity, cell death, and mRNA and protein levels of cell cycle and apoptosis-related regulators in hOBs. All the tested AIDs significantly inhibited proliferation and arrested cell cycle at G0/G1 phase in hOBs. Celecoxib and dexamethasone, but not non-selective NSAIDs, were found to have cytotoxic effects on hOB, and further demonstrated to induce apoptosis and necrosis (at higher concentration) in hOBs. We further found that indomethacin, celecoxib and dexamethasone increased the mRNA and protein expressions of p27 kip1 and decreased those of cyclin D2 and p-cdk2 in hOBs. Bak expression was increased by celecoxib and dexamethasone, while Bcl-XL level was declined only by dexamethasone. Furthermore, the replenishment of PGE1, PGE2 or PGF2α did not reverse the effects of AIDs on proliferation and expressions of p27 kip1 and cyclin D2 in hOBs. We conclude that the changes in expressions of regulators of cell cycle (p27 kip1 and cyclin D2) and/or apoptosis (Bak and Bcl-XL) by AIDs may contribute to AIDs caused proliferation suppression and apoptosis in hOBs. This effect might not relate to the blockage of prostaglandin synthesis by AIDs
Directory of Open Access Journals (Sweden)
Philippe Schnurle
2006-01-01
Full Text Available A 2.5-D combined seismic reflection and refraction survey has been conducted in the accretionary complex offshore of southwestern Taiwan where BSRs (Bottom Simulating Reflectors are highly concentrated and geochemical signals for the presence of gas hydrate are strong. In this study, we perform velocity analysis of the 6 4-component OBS (Ocean-Bottom Seismometer records along the southernmost transect of this seismic experiment. We utilize 3 independent methods in order to accurately determine the acoustic and shear-wave velocities of the sediments: 1-D Root Mean Square (RMS analysis of the P-P and P-S reflected events on individual datumed components, 2-D inversion of the P-P and P-S reflected and refracted events along the in-line transect, and 3-D acoustic inversion of the first arrivals. The principal sources of bias in the determination of the velocities are the 3-dimentional nature of the topography and the complexity of the underlying structures. The three methods result in consistent velocity profiles. Rapid lateral and vertical variations of the velocities are observed. We then investigate the large scale gas hydrate content through rock physic modeling: at the vertical of each OBS, shear-waves velocities are utilized to estimate the water-filled porosities, and the acoustic velocities predicted for a set of gas hydrate, quartz and clay contents are compared to the observed profiles.
Directory of Open Access Journals (Sweden)
Photiadou Christiana
2017-01-01
Full Text Available Climate change and climate variability profoundly affect the production of wine. When facing a changing climate, the characteristics of wine produced in each region will change while the natural year-to-year variations in climate will increase variability of income for wine businesses and therefore affect profitability and economic resilience. The challenge posed to the viticulture community is thus to closely monitor these changes to be able to adapt business practices. The European Climate Assessment and Dataset (ECA&D and its gridded version E-OBS are tools to monitor the changing climatic conditions over Europe, with an emphasis on changes in extreme climatic conditions. In this paper, the potential of ECA&D and E-OBS for viticulture is demonstrated by a few examples. The examples include the changing areal suitable for Chardonnay cultivation, showing an expansion to areas which have been too cold only a few decades ago and retraction of optimal conditions from areas which have been suitable in the recent past. Other examples show the change in the diurnal temperature range in the latter stages of the ripening process of grapes and the variability in heavy precipitation events. Finally, first results of a new dataset for South America are presented.
Leishmania replication protein A-1 binds in vivo single-stranded telomeric DNA
International Nuclear Information System (INIS)
Neto, J.L. Siqueira; Lira, C.B.B.; Giardini, M.A.; Khater, L.; Perez, A.M.; Peroni, L.A.; Reis, J.R.R. dos; Freitas-Junior, L.H.; Ramos, C.H.I.; Cano, M.I.N.
2007-01-01
Replication protein A (RPA) is a highly conserved heterotrimeric single-stranded DNA-binding protein involved in different events of DNA metabolism. In yeast, subunits 1 (RPA-1) and 2 (RPA-2) work also as telomerase recruiters and, in humans, the complex unfolds G-quartet structures formed by the 3' G-rich telomeric strand. In most eukaryotes, RPA-1 and RPA-2 bind DNA using multiple OB fold domains. In trypanosomatids, including Leishmania, RPA-1 has a canonical OB fold and a truncated RFA-1 structural domain. In Leishmania amazonensis, RPA-1 alone can form a complex in vitro with the telomeric G-rich strand. In this work, we show that LaRPA-1 is a nuclear protein that associates in vivo with Leishmania telomeres. We mapped the boundaries of the OB fold DNA-binding domain using deletion mutants. Since Leishmania and other trypanosomatids lack homologues of known telomere end binding proteins, our results raise questions about the function of RPA-1 in parasite telomeres
SEARCHING FOR BINARY Y DWARFS WITH THE GEMINI MULTI-CONJUGATE ADAPTIVE OPTICS SYSTEM (GeMS)
International Nuclear Information System (INIS)
Opitz, Daniela; Tinney, C. G.; Faherty, Jacqueline K.; Sweet, Sarah; Gelino, Christopher R.; Kirkpatrick, J. Davy
2016-01-01
The NASA Wide-field Infrared Survey Explorer (WISE) has discovered almost all the known members of the new class of Y-type brown dwarfs. Most of these Y dwarfs have been identified as isolated objects in the field. It is known that binaries with L- and T-type brown dwarf primaries are less prevalent than either M-dwarf or solar-type primaries, they tend to have smaller separations and are more frequently detected in near-equal mass configurations. The binary statistics for Y-type brown dwarfs, however, are sparse, and so it is unclear if the same trends that hold for L- and T-type brown dwarfs also hold for Y-type ones. In addition, the detection of binary companions to very cool Y dwarfs may well be the best means available for discovering even colder objects. We present results for binary properties of a sample of five WISE Y dwarfs with the Gemini Multi-Conjugate Adaptive Optics System. We find no evidence for binary companions in these data, which suggests these systems are not equal-luminosity (or equal-mass) binaries with separations larger than ∼0.5–1.9 AU. For equal-mass binaries at an age of 5 Gyr, we find that the binary binding energies ruled out by our observations (i.e., 10 42 erg) are consistent with those observed in previous studies of hotter ultra-cool dwarfs
Targeting the OB-Folds of Replication Protein A with Small Molecules
Directory of Open Access Journals (Sweden)
Victor J. Anciano Granadillo
2010-01-01
Full Text Available Replication protein A (RPA is the main eukaryotic single-strand (ss DNA-binding protein involved in DNA replication and repair. We have identified and developed two classes of small molecule inhibitors (SMIs that show in vitro inhibition of the RPA-DNA interaction. We present further characterization of these SMIs with respect to their target binding, mechanism of action, and specificity. Both reversible and irreversible modes of inhibition are observed for the different classes of SMIs with one class found to specifically interact with DNA-binding domains A and B (DBD-A/B of RPA. In comparison with other oligonucleotide/oligosaccharide binding-fold (OB-fold containing ssDNA-binding proteins, one class of SMIs displayed specificity for the RPA protein. Together these data demonstrate that the specific targeting of a protein-DNA interaction can be exploited towards interrogating the cellular activity of RPA as well as increasing the efficacy of DNA-damaging chemotherapeutics used in cancer treatment.
White, Christy L.; Whittington, Amy; Barnes, Maria J.; Wang, Zhong; Bray, George A.; Morrison, Christopher D.
2009-01-01
Protein tyrosine phosphatase 1B (PTP1B) contributes to leptin resistance by inhibiting intracellular leptin receptor signaling. Mice with whole body or neuron-specific deletion of PTP1B are hypersensitive to leptin and resistant to diet-induced obesity. Here we report a significant increase in PTP1B protein levels in the mediobasal hypothalamus (P = 0.003) and a concomitant reduction in leptin sensitivity following 28 days of high-fat (HF) feeding in rats. A significant increase in PTP1B mRNA levels was also observed in rats chronically infused with leptin (3 μg/day icv) for 14 days (P = 0.01) and in leptin-deficient ob/ob mice infused with leptin (5 μg/day sc for 14 days; P = 0.003). When saline-infused ob/ob mice were placed on a HF diet for 14 days, an increase in hypothalamic PTP1B mRNA expression was detected (P = 0.001) despite the absence of circulating leptin. In addition, although ob/ob mice were much more sensitive to leptin on a low-fat (LF) diet, a reduction in this sensitivity was still observed following exposure to a HF diet. Taken together, these data indicate that hypothalamic PTP1B is specifically increased during HF diet-induced leptin resistance. This increase in PTP1B is due in part to chronic hyperleptinemia, suggesting that hyperleptinemia is one mechanism contributing to the development of leptin resistance. However, these data also indicate that leptin is not required for the increase in hypothalamic PTP1B or the development of leptin resistance. Therefore, additional, leptin-independent mechanisms must exist that increase hypothalamic PTP1B and contribute to leptin resistance. PMID:19017730
THE PDS 66 CIRCUMSTELLAR DISK AS SEEN IN POLARIZED LIGHT WITH THE GEMINI PLANET IMAGER
International Nuclear Information System (INIS)
Wolff, Schuyler G.; Greenbaum, Alexandra Z.; Perrin, Marshall; Hines, Dean C.; Millar-Blanchaer, Maxwell A.; Nielsen, Eric L.; Wang, Jason; Dong, Ruobing; Duchêne, Gaspard; Graham, James R.; Kalas, Paul; Cardwell, Andrew; Chilcote, Jeffrey; Draper, Zachary H.; Fitzgerald, Michael P.; Hung, Li-Wei; Goodsell, Stephen J.; Grady, Carol A.; Hartung, Markus; Hibon, Pascale
2016-01-01
We present H- and K-band imaging polarimetry for the PDS 66 circumstellar disk obtained during the commissioning of the Gemini Planet Imager (GPI). Polarization images reveal a clear detection of the disk in to the 0.″12 inner working angle (IWA) in the H band, almost three times closer to the star than the previous Hubble Space Telescope (HST) observations with NICMOS and STIS (0.″35 effective IWA). The centro-symmetric polarization vectors confirm that the bright inner disk detection is due to circumstellar scattered light. A more diffuse disk extends to a bright outer ring centered at 80 AU. We discuss several physical mechanisms capable of producing the observed ring + gap structure. GPI data confirm enhanced scattering on the east side of the disk that is inferred to be nearer to us. We also detect a lateral asymmetry in the south possibly due to shadowing from material within the IWA. This likely corresponds to a temporally variable azimuthal asymmetry observed in HST/STIS coronagraphic imaging
THE PDS 66 CIRCUMSTELLAR DISK AS SEEN IN POLARIZED LIGHT WITH THE GEMINI PLANET IMAGER
Energy Technology Data Exchange (ETDEWEB)
Wolff, Schuyler G.; Greenbaum, Alexandra Z. [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD 21218 (United States); Perrin, Marshall; Hines, Dean C. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Millar-Blanchaer, Maxwell A. [Department of Astronomy and Astrophysics, University of Toronto, Toronto, ON M5S 3H4 (Canada); Nielsen, Eric L. [Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, CA 94305 (United States); Wang, Jason; Dong, Ruobing; Duchêne, Gaspard; Graham, James R.; Kalas, Paul [Astronomy Department, University of California, Berkeley, Berkeley, CA 94720 (United States); Cardwell, Andrew [LBT Observatory, University of Arizona, 933 N. Cherry Avenue, Room 552, Tucson, AZ 85721 (United States); Chilcote, Jeffrey [Dunlap Institute for Astronomy and Astrophysics, University of Toronto, Toronto, ON M5S 3H4 (Canada); Draper, Zachary H. [University of Victoria, 3800 Finnerty Road, Victoria, BC V8P 5C2 (Canada); Fitzgerald, Michael P.; Hung, Li-Wei [Department of Physics and Astronomy, University of California, Los Angeles, 430 Portola Plaza, Los Angeles, CA 90095 (United States); Goodsell, Stephen J. [Gemini Observatory, 670 N. A’ohoku Place, Hilo, HI 96720 (United States); Grady, Carol A. [Eureka Scientific, 2452 Delmer, Suite 100, Oakland, CA 96002 (United States); Hartung, Markus; Hibon, Pascale, E-mail: swolff9@jh.edu [Gemini Observatory, Casilla 603, La Serena (Chile); and others
2016-02-10
We present H- and K-band imaging polarimetry for the PDS 66 circumstellar disk obtained during the commissioning of the Gemini Planet Imager (GPI). Polarization images reveal a clear detection of the disk in to the 0.″12 inner working angle (IWA) in the H band, almost three times closer to the star than the previous Hubble Space Telescope (HST) observations with NICMOS and STIS (0.″35 effective IWA). The centro-symmetric polarization vectors confirm that the bright inner disk detection is due to circumstellar scattered light. A more diffuse disk extends to a bright outer ring centered at 80 AU. We discuss several physical mechanisms capable of producing the observed ring + gap structure. GPI data confirm enhanced scattering on the east side of the disk that is inferred to be nearer to us. We also detect a lateral asymmetry in the south possibly due to shadowing from material within the IWA. This likely corresponds to a temporally variable azimuthal asymmetry observed in HST/STIS coronagraphic imaging.
Molecular and phylogenetic analysis of HIV-1 variants circulating in Italy
Directory of Open Access Journals (Sweden)
Sbreglia Costanza
2008-10-01
Full Text Available Abstract Objective The continuous identification of HIV-1 non-B subtypes and recombinant forms in Italy indicates the need of constant molecular epidemiology survey of genetic forms circulating and transmitted in the resident population. Methods The distribution of HIV-1 subtypes has been evaluated in 25 seropositive individuals residing in Italy, most of whom were infected through a sexual route during the 1995–2005 period. Each sample has been characterized by detailed molecular and phylogenetic analyses. Results 18 of the 25 samples were positive at HIV-1 PCR amplification. Three samples showed a nucleotide divergence compatible with a non-B subtype classification. The phylogenetic analysis, performed on both HIV-1 env and gag regions, confirms the molecular sub-typing prediction, given that 1 sample falls into the C subtype and 2 into the G subtype. The B subtype isolates show high levels of intra-subtype nucleotide divergence, compatible with a long-lasting epidemic and a progressive HIV-1 molecular diversification. Conclusion The Italian HIV-1 epidemic is still mostly attributable to the B subtype, regardless the transmission route, which shows an increasing nucleotide heterogeneity. Heterosexual transmission and the interracial blending, however, are slowly introducing novel HIV-1 subtypes. Therefore, a molecular monitoring is needed to follow the constant evolution of the HIV-1 epidemic.
Oda, Reiko; Artzner, Franck; Laguerre, Michel; Huc, Ivan
2008-11-05
A detailed molecular organization of racemic 16-2-16 tartrate self-assembled multi-bilayer ribbons in the hydrated state is proposed where 16-2-16 amphiphiles, tartrate ions, and water molecules are all accurately positioned by comparing experimental X-ray powder diffraction and diffraction patterns derived from modeling studies. X-ray diffuse scattering studies show that molecular organization is not fundamentally altered when comparing the flat ribbons of the racemate to chirally twisted or helical ribbons of the pure tartrate enantiomer. Essential features of the three-dimensional molecular organizations of these structures include interdigitation of alkyl chains within each bilayer and well-defined networks of ionic and hydrogen bonds between cations, anions, and water molecules between bilayers. The detailed study of diffraction patterns also indicated that the gemini headgroups are oriented parallel to the long edge of the ribbons. The structure thus possesses a high cohesion and good crystallinity, and for the first time, we could relate the packing of the chiral molecules to the expression of the chirality at a mesoscopic scale. The organization of the ribbons at the molecular level sheds light on a number of their macroscopic features. Among these are the reason why enantiomerically pure 16-2-16 tartrate forms ribbons that consist of exactly two bilayers, and a plausible mechanism by which a chirally twisted or helical shape may emerge from the packing of chiral tartrate ions. Importantly, the distinction between commonly observed helical and twisted morphologies could be related to a subtle symmetry breaking. These results demonstrate that accurately solving the molecular structure of self-assembled soft materials--a process rarely achieved--is within reach, that it is a valid approach to correlate molecular parameters to macroscopic properties, and thus that it offers opportunities to modulate properties through molecular design.
International Nuclear Information System (INIS)
Dehariya, Harsha; Kumar, R; Polu, A R
2012-01-01
The idea to explore new 'Superionic Electrolytes', 'Fast ionic conductors' is due to their tremendous potential applications in solid state electrochemical devices viz. solid state batteries, fuel cells, sensors, super capacitors. Superionic glasses have attracted great deal of attention due to their several advantageous over their crystalline counterparts such as high ionic conductivity, easy preparation, wide selection of compositions, isotropic properties and high stability etc [4-7]. Large numbers of silver ion based glasses have been reported in the literature for the glassy system of AgI:Ag2O: MxOy (MxOy = B2O3, SiO2, P2O5, GeO2, V2O5, As2O5, CrO3, SeO2, MoO3 and TeO3 etc many of them shows high silver ion conductivity [8]. Ion transport behavior of Silver Boro Tungstate glass system x[0.75AgI:0.25AgCl]: (1-x) [Ag2O(B2O3:WO3)], where 0 ≤ x ≤ 1 in molar wt% prepared by melt quench technique were reported. The new host [0.75AgI:0.25AgCl] was used as a better alternate in place of conventional host salt AgI. Conductivity measurement were carried out on this glass system as a function of frequency from 50 Hz to 5 MHz, over a temperature range of 27 C to 200 C, for different compositions by Impedance spectroscopy. The composition 0.7[0.75AgI:0.25AgCl]: 0.3[Ag2O(B2O3:WO3)] shows the highest conductivity of the order of σrt ∼ 2.76x10-2 S/cm, referred to as the Optimum Conducting Composition (OCC). The enhancement in the conductivity has been obtained by mixed former effect. XRD result shows that the system is completely amorphous. Temperature dependence of conductivity of all compositions were studied and reported. Activation energies (Ea) were also evaluated from the slope of .Log(σ) vs 1000/T, Arrhenius plots.
Dehariya, Harsha; Kumar, R.; Polu, A. R.
2012-05-01
The idea to explore new 'Superionic Electrolytes', "Fast ionic conductors" is due to their tremendous potential applications in solid state electrochemical devices viz. solid state batteries, fuel cells, sensors, super capacitors. Superionic glasses have attracted great deal of attention due to their several advantageous over their crystalline counterparts such as high ionic conductivity, easy preparation, wide selection of compositions, isotropic properties and high stability etc [4-7]. Large numbers of silver ion based glasses have been reported in the literature for the glassy system of AgI:Ag2O: MxOy (MxOy = B2O3, SiO2, P2O5, GeO2, V2O5, As2O5, CrO3, SeO2, MoO3 & TeO3 etc many of them shows high silver ion conductivity [8]. Ion transport behavior of Silver Boro Tungstate glass system x[0.75AgI:0.25AgCl]: (1-x) [Ag2O{B2O3:WO3}], where 0 <= x <= 1 in molar wt% prepared by melt quench technique were reported. The new host [0.75AgI:0.25AgCl] was used as a better alternate in place of conventional host salt AgI. Conductivity measurement were carried out on this glass system as a function of frequency from 50 Hz to 5 MHz, over a temperature range of 27°C to 200°C, for different compositions by Impedance spectroscopy. The composition 0.7[0.75AgI:0.25AgCl]: 0.3[Ag2O{B2O3:WO3}] shows the highest conductivity of the order of σrt ~ 2.76 × 10-2 S/cm, referred to as the Optimum Conducting Composition (OCC). The enhancement in the conductivity has been obtained by mixed former effect. XRD result shows that the system is completely amorphous. Temperature dependence of conductivity of all compositions were studied & reported. Activation energies (Ea) were also evaluated from the slope of .Log(σ) vs 1000/T, Arrhenius plots.
Directory of Open Access Journals (Sweden)
Kerry L. Inder
2014-06-01
Full Text Available Background: Tumour-derived extracellular vesicles (EVs play a role in tumour progression; however, the spectrum of molecular mechanisms regulating EV secretion and cargo selection remain to be fully elucidated. We have reported that cavin-1 expression in prostate cancer PC3 cells reduced the abundance of a subset of EV proteins, concomitant with reduced xenograft tumour growth and metastasis. Methods: We examined the functional outcomes and mechanisms of cavin-1 expression on PC3-derived EVs (PC3-EVs. Results: PC3-EVs were internalized by osteoclast precursor RAW264.7 cells and primary human osteoblasts (hOBs in vitro, stimulating osteoclastogenesis 37-fold and hOB proliferation 1.5-fold, respectively. Strikingly, EVs derived from cavin-1-expressing PC3 cells (cavin-1-PC3-EVs failed to induce multinucleate osteoblasts or hOB proliferation. Cavin-1 was not detected in EVs, indicating an indirect mechanism of action. EV morphology, size and quantity were also not affected by cavin-1 expression, suggesting that cavin-1 modulated EV cargo recruitment rather than release. While cavin-1-EVs had no osteoclastogenic function, they were internalized by RAW264.7 cells but at a reduced efficiency compared to control EVs. EV surface proteins are required for internalization of PC3-EVs by RAW264.7 cells, as proteinase K treatment abolished uptake of both control and cavin-1-PC3-EVs. Removal of sialic acid modifications by neuraminidase treatment increased the amount of control PC3-EVs internalized by RAW264.7 cells, without affecting cavin-1-PC3-EVs. This suggests that cavin-1 expression altered the glycosylation modifications on PC3-EV surface. Finally, cavin-1 expression did not affect EV in vivo tissue targeting as both control and cavin-1-PC3-EVs were predominantly retained in the lung and bone 24 hours after injection into mice. Discussion: Taken together, our results reveal a novel pathway for EV cargo sorting, and highlight the potential of utilizing
Molecular modeling studies of 1,4-dihydro-4-oxoquinoline ribonucleosides with anti-HSV-1 activity
Yoneda, Julliane Diniz; Albuquerque, Magaly Girão; Leal, Kátia Zaccur; Seidl, Peter Rudolf; de Alencastro, Ricardo Bicca
2011-12-01
Eight human herpes viruses ( e.g., herpes simplex, varicella-zoster, Epstein-Barr, cytomegalovirus, Kaposi's sarcoma) are responsible for several diseases from sub-clinic manifestations to fatal infections, mostly in immunocompromised patients. The major limitations of the currently available antiviral drug therapy are drug resistance, host toxicity, and narrow spectrum of activity. However, some non-nucleoside 1,4-dihydro-4-oxoquinoline derivatives ( e.g., PNU-183792) [4] shows broad spectrum antiviral activity. We have developed molecular modeling studies, including molecular docking and molecular dynamics simulations, based on a model proposed by Liu and co-workers [14] in order to understand the mechanism of action of a 6-chloro substituted 1,4-dihydro-4-oxoquinoline ribonucleoside, synthesized by the synthetic group, which showed anti-HSV-1 activity [9]. The molecular docking simulations confirmed the Liu's model showing that the ligand needs to dislocate template residues from the active site in order to interact with the viral DNA polymerase enzyme, reinforcing that the interaction with the Val823 residue is pivotal for the inhibitory activity of non-nucleoside 1,4-dihydro-4-oxoquinoline derivatives, such as PNU-183792, with the HSV-1. The molecular dynamics simulations showed that the 6-chloro-benzyl group of PNU-183792 maintains its interaction with residues of the HSV-1 DNA polymerase hydrophobic pocket, considered important according to the Liu's model, and also showed that the methyl group bounded to the nitrogen atom from PNU-183792 is probably contributing to a push-pull effect with the carbonyl group.
CARINA OB STARS: X-RAY SIGNATURES OF WIND SHOCKS AND MAGNETIC FIELDS
International Nuclear Information System (INIS)
Gagne, Marc; Fehon, Garrett; Savoy, Michael R.; Cohen, David H.; Townsley, Leisa K.; Broos, Patrick S.; Povich, Matthew S.; Corcoran, Michael F.; Walborn, Nolan R.; Remage Evans, Nancy; Moffat, Anthony F. J.; Naze, Yael; Oskinova, Lida M.
2011-01-01
The Chandra Carina Complex contains 200 known O- and B-type stars. The Chandra survey detected 68 of the 70 O stars and 61 of 127 known B0-B3 stars. We have assembled a publicly available optical/X-ray database to identify OB stars that depart from the canonical L X /L bol relation or whose average X-ray temperatures exceed 1 keV. Among the single O stars with high kT we identify two candidate magnetically confined wind shock sources: Tr16-22, O8.5 V, and LS 1865, O8.5 V((f)). The O4 III(fc) star HD 93250 exhibits strong, hard, variable X-rays, suggesting that it may be a massive binary with a period of >30 days. The visual O2 If* binary HD 93129A shows soft 0.6 keV and hard 1.9 keV emission components, suggesting embedded wind shocks close to the O2 If* Aa primary and colliding wind shocks between Aa and Ab. Of the 11 known O-type spectroscopic binaries, the long orbital-period systems HD 93343, HD 93403, and QZ Car have higher shock temperatures than short-period systems such as HD 93205 and FO 15. Although the X-rays from most B stars may be produced in the coronae of unseen, low-mass pre-main-sequence companions, a dozen B stars with high L X cannot be explained by a distribution of unseen companions. One of these, SS73 24 in the Treasure Chest cluster, is a new candidate Herbig Be star.
International Nuclear Information System (INIS)
Chiboucas, Kristin; Joergensen, Inger; Barr, Jordi; Collobert, Maela; Davies, Roger; Flint, Kathleen
2009-01-01
We present the data processing and analysis techniques we are using to determine the structural and photometric properties of galaxies in our Gemini/HST Galaxy Cluster Project sample. The goal of this study is to understand cluster galaxy evolution in terms of scaling relations and structural properties of cluster galaxies at redshifts 0.15 1/4 law and Sersic function two-dimensional surface brightness profiles to each of the galaxies in our sample. Using simulated galaxies, we test how the assumed profile affects the derived parameters and how the uncertainties affect our Fundamental Plane results. We find that while fitting galaxies that have Sersic index n 1/4 law profiles systematically overestimates the galaxy radius and flux, the combination of profile parameters that enter the Fundamental Plane has uncertainties that are small. Average systematic offsets and associated random uncertainties in magnitude and log r e for n>2 galaxies fitted with r 1/4 law profiles are -0.1 ± 0.3 and 0.1 ± 0.2, respectively. The combination of effective radius and surface brightness, log r e - βlog (I) e , that enters the Fundamental Plane produces offsets smaller than -0.02 ± 0.10. This systematic error is insignificant and independent of galaxy magnitude or size. A catalog of photometry and surface brightness profile parameters is presented for three of the clusters in our sample, RX J0142.0+2131, RX J0152.7-1357, and RX J1226.9+3332 at redshifts 0.28, 0.83, and 0.89, respectively.
International Nuclear Information System (INIS)
Megeath, S. T.; Kryukova, E.; Gutermuth, R.; Muzerolle, J.; Hora, J. L.; Myers, P. C.; Fazio, G. G.; Allen, L. E.; Flaherty, K.; Hartmann, L.; Pipher, J. L.; Stauffer, J.; Young, E. T.
2016-01-01
We analyze the spatial distribution of dusty young stellar objects (YSOs) identified in the Spitzer Survey of the Orion Molecular clouds, augmenting these data with Chandra X-ray observations to correct for incompleteness in dense clustered regions. We also devise a scheme to correct for spatially varying incompleteness when X-ray data are not available. The local surface densities of the YSOs range from 1 pc −2 to over 10,000 pc −2 , with protostars tending to be in higher density regions. This range of densities is similar to other surveyed molecular clouds with clusters, but broader than clouds without clusters. By identifying clusters and groups as continuous regions with surface densities ≥10 pc −2 , we find that 59% of the YSOs are in the largest cluster, the Orion Nebula Cluster (ONC), while 13% of the YSOs are found in a distributed population. A lower fraction of protostars in the distributed population is evidence that it is somewhat older than the groups and clusters. An examination of the structural properties of the clusters and groups shows that the peak surface densities of the clusters increase approximately linearly with the number of members. Furthermore, all clusters with more than 70 members exhibit asymmetric and/or highly elongated structures. The ONC becomes azimuthally symmetric in the inner 0.1 pc, suggesting that the cluster is only ∼2 Myr in age. We find that the star formation efficiency (SFE) of the Orion B cloud is unusually low, and that the SFEs of individual groups and clusters are an order of magnitude higher than those of the clouds. Finally, we discuss the relationship between the young low mass stars in the Orion clouds and the Orion OB 1 association, and we determine upper limits to the fraction of disks that may be affected by UV radiation from OB stars or dynamical interactions in dense, clustered regions
Elevated levels of high-molecular-weight adiponectin in type 1 diabetes
DEFF Research Database (Denmark)
Leth, H.; Andersen, K.K.; Frystyk, J.
2008-01-01
BACKGROUND: Several studies have shown that type 1 diabetic patients have elevated total levels of the adipocyte-derived adipocytokine adiponectin. However, adiponectin circulates in three different subforms, and the high-molecular-weight (HMW) subform is believed to be the primary biologically...... active form. The effects of the medium-molecular-weight (MMW) subform and the low-molecular-weight (LMW) subform are still unresolved. PURPOSE: The objective of the study was to investigate the distribution of the three molecular subforms of adiponectin in well-characterized groups of type 1 diabetics...... with varying degrees of nephropathy as well as in healthy control subjects. STUDY POPULATION: Two hundred seven individuals were included: 58 type 1 diabetics with normoalbuminuria, 46 with microalbuminuria, 46 with macroalbuminuria, and 57 matched controls. METHODS: The HMW, MMW, and LMW subforms were...
Measurement of Circumstellar Disk Sizes in the Upper Scorpius OB Association with ALMA
Barenfeld, Scott A.; Carpenter, John M.; Sargent, Anneila I.; Isella, Andrea; Ricci, Luca
2017-12-01
We present detailed modeling of the spatial distributions of gas and dust in 57 circumstellar disks in the Upper Scorpius OB Association observed with ALMA at submillimeter wavelengths. We fit power-law models to the dust surface density and CO J = 3–2 surface brightness to measure the radial extent of dust and gas in these disks. We found that these disks are extremely compact: the 25 highest signal-to-noise disks have a median dust outer radius of 21 au, assuming an {R}-1 dust surface density profile. Our lack of CO detections in the majority of our sample is consistent with these small disk sizes assuming the dust and CO share the same spatial distribution. Of seven disks in our sample with well-constrained dust and CO radii, four appear to be more extended in CO, although this may simply be due to the higher optical depth of the CO. Comparison of the Upper Sco results with recent analyses of disks in Taurus, Ophiuchus, and Lupus suggests that the dust disks in Upper Sco may be approximately three times smaller in size than their younger counterparts, although we caution that a more uniform analysis of the data across all regions is needed. We discuss the implications of these results for disk evolution.
International Nuclear Information System (INIS)
Lilik Harsanti; Mugiono
2004-01-01
Atom ita-4 rice variety was crossed with IR-64 variety in the greenhouse at the Center for Application of Isotopes and Radiation-Batan, Pasar jumat in the wet season of 1994/1995. F 1 Seeds derived from Atomita-4/IR-64 crossing were irradiated by gamma rays at of 0.2 kGy dose. F 1 seeds were grown to obtain F 2 M 2 seed, and then selection of pedigree were carried out at F 2 generation. Six mutants lines were obtained purified and screened on biotypes 1, 2 and 3 brown plant hopper and bacterial leaf blight resistance by IRRI standard screening methods. The six mutant lines were tested for their potential yield at Pusakanegara and then continued tested in yield multi location test at several locations in Indonesia. Results of the screening test to brown plant hopper showed that two mutant lines Obs-1653/PsJ and Obs-1656/PsJ were resistant to biotype 1, biotype 2 and medium resistant to biotype 3. Obs-1653/PsJ and Obs-1656/PsJ also showed resistance to bacterial leaf blight strain 3 and medium resistance to strain 4. Results in the yield multi location test showed that Obs-1653/PsJ and Obs-1656/PsJ have highest yielding potential compared to IR-64 and Memberamo varieties. Those two mutant lines were released as new varieties under the name Merauke and Kahayan in 2001 and 2003 respectively. (author)
Misra, Rajesh Chandra; Maiti, Protiti; Chanotiya, Chandan Singh; Shanker, Karuna; Ghosh, Sumit
2014-01-01
Sweet basil (Ocimum basilicum) is well known for its diverse pharmacological properties and has been widely used in traditional medicine for the treatment of various ailments. Although a variety of secondary metabolites with potent biological activities are identified, our understanding of the biosynthetic pathways that produce them has remained largely incomplete. We studied transcriptional changes in sweet basil after methyl jasmonate (MeJA) treatment, which is considered an elicitor of secondary metabolites, and identified 388 candidate MeJA-responsive unique transcripts. Transcript analysis suggests that in addition to controlling its own biosynthesis and stress responses, MeJA up-regulates transcripts of the various secondary metabolic pathways, including terpenoids and phenylpropanoids/flavonoids. Furthermore, combined transcript and metabolite analysis revealed MeJA-induced biosynthesis of the medicinally important ursane-type and oleanane-type pentacyclic triterpenes. Two MeJA-responsive oxidosqualene cyclases (ObAS1 and ObAS2) that encode for 761- and 765-amino acid proteins, respectively, were identified and characterized. Functional expressions of ObAS1 and ObAS2 in Saccharomyces cerevisiae led to the production of β-amyrin and α-amyrin, the direct precursors of oleanane-type and ursane-type pentacyclic triterpenes, respectively. ObAS1 was identified as a β-amyrin synthase, whereas ObAS2 was a mixed amyrin synthase that produced both α-amyrin and β-amyrin but had a product preference for α-amyrin. Moreover, transcript and metabolite analysis shed light on the spatiotemporal regulation of pentacyclic triterpene biosynthesis in sweet basil. Taken together, these results will be helpful in elucidating the secondary metabolic pathways of sweet basil and developing metabolic engineering strategies for enhanced production of pentacyclic triterpenes. PMID:24367017
THE MAJOR AND MINOR GALAXY MERGER RATES AT z < 1.5
International Nuclear Information System (INIS)
Lotz, Jennifer M.; Jonsson, Patrik; Cox, T. J.; Croton, Darren; Primack, Joel R.; Somerville, Rachel S.; Stewart, Kyle
2011-01-01
Calculating the galaxy merger rate requires both a census of galaxies identified as merger candidates and a cosmologically averaged 'observability' timescale (T obs (z)) for identifying galaxy mergers. While many have counted galaxy mergers using a variety of techniques, (T obs (z)) for these techniques have been poorly constrained. We address this problem by calibrating three merger rate estimators with a suite of hydrodynamic merger simulations and three galaxy formation models. We estimate (T obs (z)) for (1) close galaxy pairs with a range of projected separations, (2) the morphology indicator G – M 20 , and (3) the morphology indicator asymmetry A. Then, we apply these timescales to the observed merger fractions at z +3.0±1.1 ) than samples selected with constant stellar mass or passively evolving luminosity (∝(1 + z) +0.1±0.4 ). We calculate the minor merger rate (1:4 sat /M primary ∼ 20 . The implied minor merger rate is ∼3 times the major merger rate at z ∼ 0.7 and shows little evolution with redshift.
New Version of SeismicHandler (SHX) based on ObsPy
Stammler, Klaus; Walther, Marcus
2016-04-01
The command line version of SeismicHandler (SH), a scientific analysis tool for seismic waveform data developed around 1990, has been redesigned in the recent years, based on a project funded by the Deutsche Forschungsgemeinschaft (DFG). The aim was to address new data access techniques, simplified metadata handling and a modularized software design. As a result the program was rewritten in Python in its main parts, taking advantage of simplicity of this script language and its variety of well developed software libraries, including ObsPy. SHX provides an easy access to waveforms and metadata via arclink and FDSN webservice protocols, also access to event catalogs is implemented. With single commands whole networks or stations within a certain area may be read in, the metadata are retrieved from the servers and stored in a local database. For data processing the large set of SH commands is available, as well as the SH scripting language. Via this SH language scripts or additional Python modules the command set of SHX is easily extendable. The program is open source, tested on Linux operating systems, documentation and download is found at URL "https://www.seismic-handler.org/".
Gemini Planet Imager Exoplanet Survey: Key Results Two Years Into The Survey
Marchis, Franck; Rameau, Julien; Nielsen, Eric L.; De Rosa, Robert J.; Esposito, Thomas; Draper, Zachary H.; Macintosh, Bruce; Graham, James R.; GPIES
2016-10-01
The Gemini Planet Imager Exoplanet Survey (GPIES) is targeting 600 young, nearby stars using the GPI instrument. We report here on recent results obtained with this instrument from our team.Rameau et al. (ApJL, 822 2, L2, 2016) presented astrometric monitoring of the young exoplanet HD 95086 b obtained with GPI between 2013 and 2016. Efficient Monte Carlo techniques place preliminary constraints on the orbital parameters of HD 95086 b. Under the assumption of a coplanar planet-disk system, the periastron of HD 95086 b is beyond 51 AU. Therefore, HD 95086 b cannot carve the entire gap inferred from the measured infrared excess in the SED of HD 95086. Additional photometric and spectroscopic measurements reported by de Rosa et al. (2016, apJ, in press) showed that the spectral energy distribution of HD 95086 b is best fit by low temperature (T~800-1300 K), low surface gravity spectra from models which simulate high photospheric dust content. Its temperature is typical to L/T transition objects, but the spectral type is poorly constrained. HD 95086 b is an important exoplanet to test our models of atmospheric properties of young extrasolar planets.Direct detections of debris disk are keys to infer the collisional past and understand the formation of planetary systems. Two debris disks were recently studied with GPI:- Draper et al. (submitted to ApJ, 2016) show the resolved circumstellar debris disk around HD 111520 at a projected range of ~30-100 AU using both total and polarized H-band intensity. Structures in the disks such as a large brightness asymmetry and symmetric polarization fraction are seen. Additional data would confirm if a large disruption event from a stellar fly-by or planetary perturbations altered the disk density- Esposito et al. (submitted to ApJ, 2016) combined Keck NIRC2 data taken at 1.2-2.3 microns and GPI 1.6 micron total intensity and polarized light detections that probes down to projected separations less than 10 AU to show that the HD
Migahed, M. A.; elgendy, Amr.; EL-Rabiei, M. M.; Nady, H.; Zaki, E. G.
2018-05-01
Two new sequences of Gemini di-quaternary ammonium salts were synthesized characterized by FTIR and 1HNMR spectroscopic techniques and evaluated as corrosion inhibitor for X-65 steel dissolution in deep oil wells formation water saturated with CO2. The anti-corrosion performance of these compounds was studied by different electrochemical techniques i.e. (potentiodynamic polarization and AC impedance methods), Surface morphology (SEM and EDX) analysis and quantum chemical calculations. Results showed that the synthesized compounds were of mixed-type inhibitors and the inhibition capability was influenced by the inhibitor dose and the spacer substitution in their structure as indicated by Tafel plots. Surface active parameters were determined from the surface tension profile. The synthesized compounds adsorbed via Langmuir adsorption model with physiochemical adsorption as inferred from the standard free energy (ΔG°ads) values. Surface morphology (SEM and EDX) data for inhibitor (II) shows the development of adsorbed film on steel specimen. Finally, the experimental results were supported by the quantum chemical calculations using DFT theory.
The Gemini NICI planet-finding campaign: the orbit of the young exoplanet β Pictoris b
Energy Technology Data Exchange (ETDEWEB)
Nielsen, Eric L.; Liu, Michael C.; Chun, Mark; Ftaclas, Christ [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Wahhaj, Zahed [European Southern Observatory, Alonso de Cordova 3107, Vitacura, Casilla 19001, Santiago (Chile); Biller, Beth A. [Institute for Astronomy, The University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Hayward, Thomas L. [Gemini Observatory, Southern Operations Center, c/o AURA, Casilla 603, La Serena (Chile); Males, Jared R.; Close, Laird M.; Morzinski, Katie M.; Skemer, Andrew J.; Hinz, Philip M. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Kuchner, Marc J. [Goddard Space Flight Center, Code 667, Greenbelt, MD 20771 (United States); Rodigas, Timothy J. [Department of Terrestrial Magnetism, Carnegie Institute of Washington, 5241 Broad Branch Road, NW, Washington, DC 20015 (United States); Toomey, Douglas W. [Mauna Kea Infrared, LLC, 21 Pookela Street, Hilo, HI 96720 (United States)
2014-10-20
We present new astrometry for the young (12-21 Myr) exoplanet β Pictoris b taken with the Gemini/NICI and Magellan/MagAO instruments between 2009 and 2012. The high dynamic range of our observations allows us to measure the relative position of β Pic b with respect to its primary star with greater accuracy than previous observations. Based on a Markov Chain Monte Carlo analysis, we find the planet has an orbital semi-major axis of 9.1{sub −0.5}{sup +5.3} AU and orbital eccentricity <0.15 at 68% confidence (with 95% confidence intervals of 8.2-48 AU and 0.00-0.82 for semi-major axis and eccentricity, respectively, due to a long narrow degenerate tail between the two). We find that the planet has reached its maximum projected elongation, enabling higher precision determination of the orbital parameters than previously possible, and that the planet's projected separation is currently decreasing. With unsaturated data of the entire β Pic system (primary star, planet, and disk) obtained thanks to NICI's semi-transparent focal plane mask, we are able to tightly constrain the relative orientation of the circumstellar components. We find the orbital plane of the planet lies between the inner and outer disks: the position angle (P.A.) of nodes for the planet's orbit (211.8 ± 0.°3) is 7.4σ greater than the P.A. of the spine of the outer disk and 3.2σ less than the warped inner disk P.A., indicating the disk is not collisionally relaxed. Finally, for the first time we are able to dynamically constrain the mass of the primary star β Pic to 1.76{sub −0.17}{sup +0.18} M {sub ☉}.
THE GEMINI/NICI PLANET-FINDING CAMPAIGN: THE FREQUENCY OF PLANETS AROUND YOUNG MOVING GROUP STARS
Energy Technology Data Exchange (ETDEWEB)
Biller, Beth A.; Ftaclas, Christ [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69115 Heidelberg (Germany); Liu, Michael C.; Wahhaj, Zahed; Nielsen, Eric L. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Hayward, Thomas L.; Hartung, Markus [Gemini Observatory, Southern Operations Center, c/o AURA, Casilla 603, La Serena (Chile); Males, Jared R.; Skemer, Andrew; Close, Laird M. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Chun, Mark [Institute for Astronomy, 640 North Aohoku Place, 209, Hilo, HI 96720-2700 (United States); Clarke, Fraser; Thatte, Niranjan [Department of Astronomy, University of Oxford, DWB, Keble Road, Oxford OX1 3RH (United Kingdom); Shkolnik, Evgenya L. [Lowell Observatory, 1400 West Mars Hill Road Flagstaff, AZ 86001 (United States); Reid, I. Neill [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Boss, Alan [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road, NW, Washington, DC 20015 (United States); Lin, Douglas [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Alencar, Silvia H. P. [Departamento de Fisica-ICEx-Universidade Federal de Minas Gerais, Av. Antonio Carlos 6627, 30270-901 Belo Horizonte, MG (Brazil); De Gouveia Dal Pino, Elisabete; Gregorio-Hetem, Jane [Universidade de Sao Paulo, IAG/USP, Departamento de Astronomia, Rua do Matao 1226, 05508-900 Sao Paulo, SP (Brazil); and others
2013-11-10
We report results of a direct imaging survey for giant planets around 80 members of the β Pic, TW Hya, Tucana-Horologium, AB Dor, and Hercules-Lyra moving groups, observed as part of the Gemini/NICI Planet-Finding Campaign. For this sample, we obtained median contrasts of ΔH = 13.9 mag at 1'' in combined CH{sub 4} narrowband ADI+SDI mode and median contrasts of ΔH = 15.1 mag at 2'' in H-band ADI mode. We found numerous (>70) candidate companions in our survey images. Some of these candidates were rejected as common-proper motion companions using archival data; we reobserved with Near-Infrared Coronagraphic Imager (NICI) all other candidates that lay within 400 AU of the star and were not in dense stellar fields. The vast majority of candidate companions were confirmed as background objects from archival observations and/or dedicated NICI Campaign followup. Four co-moving companions of brown dwarf or stellar mass were discovered in this moving group sample: PZ Tel B (36 ± 6 M{sub Jup}, 16.4 ± 1.0 AU), CD–35 2722B (31 ± 8 M{sub Jup}, 67 ± 4 AU), HD 12894B (0.46 ± 0.08 M{sub ☉}, 15.7 ± 1.0 AU), and BD+07 1919C (0.20 ± 0.03 M{sub ☉}, 12.5 ± 1.4 AU). From a Bayesian analysis of the achieved H band ADI and ASDI contrasts, using power-law models of planet distributions and hot-start evolutionary models, we restrict the frequency of 1-20 M{sub Jup} companions at semi-major axes from 10-150 AU to <18% at a 95.4% confidence level using DUSTY models and to <6% at a 95.4% using COND models. Our results strongly constrain the frequency of planets within semi-major axes of 50 AU as well. We restrict the frequency of 1-20 M{sub Jup} companions at semi-major axes from 10-50 AU to <21% at a 95.4% confidence level using DUSTY models and to <7% at a 95.4% using COND models. This survey is the deepest search to date for giant planets around young moving group stars.
NMR spectroscopic characterization of β-cyclodextrin inclusion complex with vanillin
International Nuclear Information System (INIS)
Pirnau, Adrian; Bogdan, Mircea; Floare, Calin G
2009-01-01
The inclusion of vanillin by β-cyclodextrin was investigated by 1 H NMR. The continuous variation technique was used to evidence the formation of soluble 1:1 complex in aqueous solution. The association constant of vanillin with β-cyclodextrin has been obtained at 298 K by fitting the experimental chemical shifts differences, Δδ obs δ free - δ obs of the observed guest and host protons, with a non-linear regression method. Besides the effective association constant, the fitting procedure allows a precise determination of all chemical shift parameters characterizing the pure complex. They can by used for an analysis of the geometry of the molecular complex in solution.
Evidence for circumstellar obscuration of OB stars
International Nuclear Information System (INIS)
Bohannan, B.
1975-01-01
Reddish found a strong increase of color excess with increasing stellar luminosity: here referred to as the Reddish Effect: in ten young galactic clusters and associations. New photometric and spectroscopic observations drawn from the literature are combined with data used by Reddish to reconsider the color excess versus intrinsic magnitude diagrams of the same ten stellar groups. The reality of the Effect is questioned in all but one of the systems; this was accomplished by identifying possible foreground stars and by recognizing some of the brightest stars as supergiants, then applying correct intrinsic color indices. After careful reanalysis, the one stellar group to retain an indication of the Reddish Effect is Cygnus OB2. No correlation of reddening with luminosity was found for five additional very young stellar groups in the southern hemisphere; these groups should exhibit the Effect if it is a natural consequence of stellar evolution. Reddish ascribed the correlation to massive circumstellar remnants of material from which the stars formed. However, a peculiar dispersion in color excess could also be attributed to patchy dust within the stellar group. In several stellar systems previously identified as displaying the Reddish Effect, a correlation of observed color excess with dust and gas concentrations is noted on Palomar Sky Survey prints. If present, circumstellar dust clouds should []anifest their existence in modes other than a correlation of color excess with luminosity. The following possibilities are considered and all show negative results: correlation of color excess with spectral type; correlation of reddening slope E/subU//sub -//subB//E/subB//sub -//subV/ with spectral type; observable infrared excess. The preceding astrophysical arguments strongly imply that circumstellar dust remnants from stellar formation do not remain around stars during their main-sequence lifetimes. (auth)
More accurate definition of liquation dome in Na2O-B2O3-SiO2 system
International Nuclear Information System (INIS)
Alekseeva, Z.D.; Mazurin, O.V.; Aver'yanov, V.I.; Galakhov, F.Ya.
1977-01-01
The liquation region in the system Na 2 O-B 2 O 3 -SiO 2 was investigated. The liquation temperatures were determined by the boundary of disappearance of opalescence in specimens with pre-induced opalescence. Extrapolation of the concentration dependences of the liquation temperature along sections with a constant SiO 2 content to a point indicates that with a SiO 2 content of 20-40% the liquation boundary in the system B 2 O 3 -SiO 2 hardly lies above 450 deg C
The Automation and Exoplanet Orbital Characterization from the Gemini Planet Imager Exoplanet Survey
Jinfei Wang, Jason; Graham, James; Perrin, Marshall; Pueyo, Laurent; Savransky, Dmitry; Kalas, Paul; arriaga, Pauline; Chilcote, Jeffrey K.; De Rosa, Robert J.; Ruffio, Jean-Baptiste; Sivaramakrishnan, Anand; Gemini Planet Imager Exoplanet Survey Collaboration
2018-01-01
The Gemini Planet Imager (GPI) Exoplanet Survey (GPIES) is a multi-year 600-star survey to discover and characterize young Jovian exoplanets and their planet forming environments. For large surveys like GPIES, it is critical to have a uniform dataset processed with the latest techniques and calibrations. I will describe the GPI Data Cruncher, an automated data processing framework that is able to generate fully reduced data minutes after the data are taken and can also reprocess the entire campaign in a single day on a supercomputer. The Data Cruncher integrates into a larger automated data processing infrastructure which syncs, logs, and displays the data. I will discuss the benefits of the GPIES data infrastructure, including optimizing observing strategies, finding planets, characterizing instrument performance, and constraining giant planet occurrence. I will also discuss my work in characterizing the exoplanets we have imaged in GPIES through monitoring their orbits. Using advanced data processing algorithms and GPI's precise astrometric calibration, I will show that GPI can achieve one milliarcsecond astrometry on the extensively-studied planet Beta Pic b. With GPI, we can confidently rule out a possible transit of Beta Pic b, but have precise timings on a Hill sphere transit, and I will discuss efforts to search for transiting circumplanetary material this year. I will also discuss the orbital monitoring of other exoplanets as part of GPIES.
ULTRA-DEEP GEMINI NEAR-INFRARED OBSERVATIONS OF THE BULGE GLOBULAR CLUSTER NGC 6624
Energy Technology Data Exchange (ETDEWEB)
Saracino, S.; Dalessandro, E.; Ferraro, F. R.; Lanzoni, B.; Miocchi, P. [Dipartimento di Fisica e Astronomia, Università di Bologna, Viale Berti Pichat 6/2, I-40127 Bologna (Italy); Geisler, D.; Mauro, F.; Cohen, R. E.; Villanova, S. [Departamento de Astronomía, Universidad de Concepción, Casilla 160-C, Concepción (Chile); Origlia, L. [INAF—Osservatorio Astronomico di Bologna, via Ranzani 1, I-40127 Bologna (Italy); Bidin, C. Moni, E-mail: sara.saracino@unibo.it [Instituto de Astronomía, Universidad Católica del Norte, Av. Angamos 0610, Antofagasta (Chile)
2016-11-20
We used ultra-deep J and K {sub s} images secured with the near-infrared (NIR) GSAOI camera assisted by the multi-conjugate adaptive optics system GeMS at the GEMINI South Telescope in Chile, to obtain a ( K {sub s} , J - K {sub s} ) color–magnitude diagram (CMD) for the bulge globular cluster NGC 6624. We obtained the deepest and most accurate NIR CMD from the ground for this cluster, by reaching K {sub s} ∼ 21.5, approximately 8 mag below the horizontal branch level. The entire extension of the Main Sequence (MS) is nicely sampled and at K {sub s} ∼ 20 we detected the so-called MS “knee” in a purely NIR CMD. By taking advantage of the exquisite quality of the data, we estimated the absolute age of NGC 6624 ( t {sub age} = 12.0 ± 0.5 Gyr), which turns out to be in good agreement with previous studies in the literature. We also analyzed the luminosity and mass functions of MS stars down to M ∼ 0.45 M{sub ⊙}, finding evidence of a significant increase of low-mass stars at increasing distances from the cluster center. This is a clear signature of mass segregation, confirming that NGC 6624 is in an advanced stage of dynamical evolution.
International Nuclear Information System (INIS)
Rodriguez Gomez, A; Ortiz Rebollo, A; Sanchez Vergara, M.E
2008-01-01
Molecular materials have been developed recently for their diverse electrical properties, such as insulation, semiconductors, conductors and superconductors and they can also be used in diodes, transistors, solar cells and electronic switches among other things. The molecular materials are formed by condensation and organization of molecular units that can be organic, organometallic, or metal-organic and whose properties are individually characterized later. Because of their true nature, the properties of molecular materials can be derived from the characteristics of the molecular units that form them. For this study molecular materials were synthesized from electronic donors and acceptors: Cu (TAAB) +2 , Ni (TAAB) +2 and the NTrifluoromethanesulfonyl-1-azahexa-1,3,5-trieno derivatives that are especially attractive from the structural point of view, since in their neutral from they have an extensive electronic dislocation which gives them a very specific chemical behavior. The synthesized materials were chemically and structurally characterized by IR spectroscopy, scanning electron microscopy (SEM), energy-dispersive spectroscopy (EDS) and mass spectrometry. Thin films of the different materials were deposited and the optical activation energy was evaluated, using techniques like profilometry and UV-vis spectroscopy
[Detection of psychosocial dysfunction in ob-gyn patients].
González-Forteza, C F; Morales Carmona, F; Gutiérrez Calderon, E
1993-01-01
The human behavior and its social determinants are critical variables for understanding the etiology, treatment, and prevention of many disorders previously attributed to biological substrates. Among the many categories of human behavior to receive special attention from health researchers and practitioners are life events, coping responses and emotional state. The relation between these categories constituted a particular field of investigation. This relationship rather than forcing to focus on disease, distress, disability, and other failures in human functioning, permits to address health, abilities, resources, and other positive aspects of human functioning. On the other hand, the re-organization of health services considers interdisciplinary work as an objective, as it is necessary to care for the patient in an integral manner, with the consequent benefit of a more efficient service. In addition it is known that patients with psychosocial dysfunctions who use general practice care facilities overutilize these services in an unnecessary manner. With this in mind it is clear that is necessary to balance the service's cost-benefit for a more efficient clinical attention. In this paper we present the results of the categories mentioned above: life events, coping responses and its relationship with emotional state in a representative sample of 399 female patients who in 1986 received services at the National Institute of Perinatology-INPer-. Of these patients, 297 were obstetrical patients -OBS- and 102 gynaecological ones -GINE-. All patients answered these instruments: General Health Questionnaire -GHQ-7 of 30 items, a subscale of Health and Daily Living for Coping Responses and Life Events Scale.(ABSTRACT TRUNCATED AT 250 WORDS)
Sixto-López, Yudibeth; Bello, Martiniano; Correa-Basurto, José
2018-03-06
Histone deacetylases (HDACs) are a family of proteins whose main function is the removal of acetyl groups from lysine residues located on histone and non-histone substrates, which regulates gene transcription and other activities in cells. HDAC1 dysfunction has been implicated in cancer development and progression; thus, its inhibition has emerged as a new therapeutic strategy. Two additional metal binding sites (Site 1 and Site 2) in HDACs have been described that are primarily occupied by potassium ions, suggesting a possible structural role that affects HDAC activity. In this work, we explored the structural role of potassium ions in Site 1 and Site 2 and how they affect the interactions of compounds with high affinities for HDAC1 (AC1OCG0B, Chlamydocin, Dacinostat and Quisinostat) and SAHA (a pan-inhibitor) using molecular docking and molecular dynamics (MD) simulations in concert with a Molecular-Mechanics-Generalized-Born-Surface-Area (MMGBSA) approach. Four models were generated: one with a potassium ion (K + ) in both sites (HDAC1 k ), a second with K + only at site 1 (HDAC1 ks1 ), a third with K + only at site 2 (HDAC1 ks2 ) and a fourth with no K + (HDAC1 wk ). We found that the presence or absence of K + not only impacted the structural flexibility of HDAC1, but also its molecular recognition, consistent with experimental findings. These results could therefore be useful for further structure-based drug design studies addressing new HDAC1 inhibitors.
Itteboina, Ramesh; Ballu, Srilata; Sivan, Sree Kanth; Manga, Vijjulatha
2017-10-01
Janus kinase 1 (JAK 1) belongs to the JAK family of intracellular nonreceptor tyrosine kinase. JAK-signal transducer and activator of transcription (JAK-STAT) pathway mediate signaling by cytokines, which control survival, proliferation and differentiation of a variety of cells. Three-dimensional quantitative structure activity relationship (3 D-QSAR), molecular docking and molecular dynamics (MD) methods was carried out on a dataset of Janus kinase 1(JAK 1) inhibitors. Ligands were constructed and docked into the active site of protein using GLIDE 5.6. Best docked poses were selected after analysis for further 3 D-QSAR analysis using comparative molecular field analysis (CoMFA) and comparative molecular similarity indices analysis (CoMSIA) methodology. Employing 60 molecules in the training set, 3 D-QSAR models were generate that showed good statistical reliability, which is clearly observed in terms of r 2 ncv and q 2 loo values. The predictive ability of these models was determined using a test set of 25 molecules that gave acceptable predictive correlation (r 2 Pred ) values. The key amino acid residues were identified by means of molecular docking, and the stability and rationality of the derived molecular conformations were also validated by MD simulation. The good consonance between the docking results and CoMFA/CoMSIA contour maps provides helpful clues about the reasonable modification of molecules in order to design more efficient JAK 1 inhibitors. The developed models are expected to provide some directives for further synthesis of highly effective JAK 1 inhibitors.
Miroshnikov, A; Semenkov, I
2012-11-01
This article provides an assessment of the impact of global fallout on (137)Cs contamination in the bottom sediments of Kara Sea. The erosiveness of 10th-level river basins was estimated by landscape-geochemical and geomorphological characteristics. All 10th-level basins (n=154) were separated into three groups: mountain, mountain-lowland and plain. Four different types of basins were identified depending on the geochemical conditions of the migration of radiocaesium in the plain and mountain-lowland. Classifications of types were carried out using the geographic information systems-based approach. The Ob River's macroarena covers 3.5 million km(2). Internal drainage basins cover 23 % of the macroarena and accumulate whole radiocaesium from the global fallout. The remaining territory is transitional for the (137)Cs. The field research works performed in the three plain first-level basins allow one to estimate the radiocaesium run-off. The calculations show that 7 % of (137)Cs was removed from the first-level basin in arable land. Accumulation of radiocaesium in the first-level basin under undisturbed forest is 99.8 %. The research shows that (137)Cs transfer from the humid basins is in the range of 6.9-25.5 TBq and for semi-humid basins 5.6-285.5 TBq. The areas of these basins cover 40 and 8 % of the Ob River's macroarena, respectively. Drainage lakes and reservoir drainage basins make up 22 % of the macroarena. Mountainous and semi-arid drainage basins cover 7 % of the macroarena.
Oczekiwania klienta pokolenia Y w zakresie sposobu obsługi i oferty biur podróży
Przybylska, Anna
2015-01-01
W pracy scharakteryzowano profil klienta w działalności biura podróży oraz rolę, jaką w niej odgrywa. Wskazano na znaczenie odpowiednich relacji z klientem, które wpływają na jego obsługę i zadowolenie. Krótko opisano zarządzanie relacjami z klientem oraz wytyczne do prawidłowego wprowadzenia tych zasad w firmie w celu maksymalizacji zysków. Badania zostały przeprowadzone na grupie konsumentów z przedziału wiekowego charakteryzującego pokolenie Y oraz pokolenie X – w celach ...
NKCC1 controls GABAergic signaling and neuroblast migration in the postnatal forebrain
Directory of Open Access Journals (Sweden)
Murray Kerren
2011-02-01
Full Text Available Abstract From an early postnatal period and throughout life there is a continuous production of olfactory bulb (OB interneurons originating from neuronal precursors in the subventricular zone. To reach the OB circuits, immature neuroblasts migrate along the rostral migratory stream (RMS. In the present study, we employed cultured postnatal mouse forebrain slices and used lentiviral vectors to label neuronal precursors with GFP and to manipulate the expression levels of the Na-K-2Cl cotransporter NKCC1. We investigated the role of this Cl- transporter in different stages of postnatal neurogenesis, including neuroblast migration and integration in the OB networks once they have reached the granule cell layer (GCL. We report that NKCC1 activity is necessary for maintaining normal migratory speed. Both pharmacological and genetic manipulations revealed that NKCC1 maintains high [Cl-]i and regulates the resting membrane potential of migratory neuroblasts whilst its functional expression is strongly reduced at the time cells reach the GCL. As in other developing systems, NKCC1 shapes GABAA-dependent signaling in the RMS neuroblasts. Also, we show that NKCC1 controls the migration of neuroblasts in the RMS. The present study indeed indicates that the latter effect results from a novel action of NKCC1 on the resting membrane potential, which is independent of GABAA-dependent signaling. All in all, our findings show that early stages of the postnatal recruitment of OB interneurons rely on precise, orchestrated mechanisms that depend on multiple actions of NKCC1.
Kohno, Mikito; Torii, Kazufumi; Tachihara, Kengo; Umemoto, Tomofumi; Minamidani, Tetsuhiro; Nishimura, Atsushi; Fujita, Shinji; Matsuo, Mitsuhiro; Yamagishi, Mitsuyoshi; Tsuda, Yuya; Kuriki, Mika; Kuno, Nario; Ohama, Akio; Hattori, Yusuke; Sano, Hidetoshi; Yamamoto, Hiroaki; Fukui, Yasuo
2018-05-01
We observed molecular clouds in the W 33 high-mass star-forming region associated with compact and extended H II regions using the NANTEN2 telescope as well as the Nobeyama 45 m telescope in the J = 1-0 transitions of 12CO, 13CO, and C18O as part of the FOREST Unbiased Galactic plane Imaging survey with the Nobeyama 45 m telescope (FUGIN) legacy survey. We detected three velocity components at 35 km s-1, 45 km s-1, and 58 km s-1. The 35 km s-1 and 58 km s-1 clouds are likely to be physically associated with W 33 because of the enhanced 12CO J = 3-2 to J = 1-0 intensity ratio as R_3-2/1-0} > 1.0 due to the ultraviolet irradiation by OB stars, and morphological correspondence between the distributions of molecular gas and the infrared and radio continuum emissions excited by high-mass stars. The two clouds show complementary distributions around W 33. The velocity separation is too large to be gravitationally bound, and yet not explained by expanding motion by stellar feedback. Therefore, we discuss whether a cloud-cloud collision scenario likely explains the high-mass star formation in W 33.
An outflow in the Seyfert ESO 362-G18 revealed by Gemini-GMOS/IFU observations
Humire, Pedro K.; Nagar, Neil M.; Finlez, Carolina; Firpo, Verónica; Slater, Roy; Lena, Davide; Soto-Pinto, Pamela; Muñoz-Vergara, Dania; Riffel, Rogemar A.; Schmitt, Henrique R.; Kraemer, Steven B.; Schnorr-Müller, Allan; Fischer, Travis C.; Robinson, Andrew; Storchi-Bergmann, Thaisa; Crenshaw, Mike; Elvis, Martin S.
2018-06-01
We present two-dimensional stellar and gaseous kinematics of the inner 0.7 × 1.2 kpc2 of the Seyfert 1.5 galaxy ESO 362-G18, derived from optical (4092-7338 Å) spectra obtained with the GMOS integral field spectrograph on the Gemini South telescope at a spatial resolution of ≈170 pc and spectral resolution of 36 km s-1. ESO 362-G18 is a strongly perturbed galaxy of morphological type Sa or S0/a, with a minor merger approaching along the NE direction. Previous studies have shown that the [O III] emission shows a fan-shaped extension of ≈10'' to the SE. We detect the [O III] doublet, [N II] and Hα emission lines throughout our field of view. The stellar kinematics is dominated by circular motions in the galaxy plane, with a kinematic position angle of ≈137° and is centred approximately on the continuum peak. The gas kinematics is also dominated by rotation, with kinematic position angles ranging from 122° to 139°, projected velocity amplitudes of the order of 100 km s-1, and a mean velocity dispersion of 100 km s-1. A double-Gaussian fit to the [O III]λ5007 and Hα lines, which have the highest signal to noise ratios of the emission lines, reveal two kinematic components: (1) a component at lower radial velocities which we interpret as gas rotating in the galactic disk; and (2) a component with line of sight velocities 100-250 km s-1 higher than the systemic velocity, interpreted as originating in the outflowing gas within the AGN ionization cone. We estimate a mass outflow rate of 7.4 × 10-2 M⊙ yr-1 in the SE ionization cone (this rate doubles if we assume a biconical configuration), and a mass accretion rate on the supermassive black hole (SMBH) of 2.2 × 10-2 M⊙ yr-1. The total ionized gas mass within 84 pc of the nucleus is 3.3 × 105 M⊙; infall velocities of 34 km s-1 in this gas would be required to feed both the outflow and SMBH accretion. The reduced datacube (FITS file) is only available at the CDS via anonymous ftp to http
Stress-induced alterations in 5-HT1A receptor transcriptional modulators NUDR and Freud-1.
Szewczyk, Bernadeta; Kotarska, Katarzyna; Daigle, Mireille; Misztak, Paulina; Sowa-Kucma, Magdalena; Rafalo, Anna; Curzytek, Katarzyna; Kubera, Marta; Basta-Kaim, Agnieszka; Nowak, Gabriel; Albert, Paul R
2014-11-01
The effect of stress on the mRNA and protein level of the 5-HT1A receptor and two of its key transcriptional modulators, NUDR and Freud-1, was examined in the prefrontal cortex (PFC) and hippocampus (Hp) using rodent models: olfactory bulbectomy (OB) and prenatal stress (PS) in male and female rats; chronic mild stress in male rats (CMS) and pregnancy stress. In PFC, CMS induced the most widespread changes, with significant reduction in both mRNA and protein levels of NUDR, 5-HT1A receptor and in Freud-1 mRNA; while in Hp 5-HT1A receptor and Freud-1 protein levels were also decreased. In male, but not female OB rats PFC Freud-1 and 5-HT1A receptor protein levels were reduced, while in Hp 5-HT1A receptor, Freud-1 and NUDR mRNA's but not protein were reduced. In PS rats PFC 5-HT1A receptor protein was reduced more in females than males; while in Hp Freud-1 protein was increased in females. In pregnancy stress, PFC NUDR, Freud-1 and 5-HT1A protein receptor levels were reduced, and in HP 5-HT1A receptor protein levels were also reduced; in HP only NUDR and Freud-1 mRNA levels were reduced. Overall, CMS and stress during pregnancy produced the most salient changes in 5-HT1A receptor and transcription factor expression, suggesting a primary role for altered transcription factor expression in chronic regulation of 5-HT1A receptor expression. By contrast, OB (in males) and PS (in females) produced gender-specific reductions in PFC 5-HT1A receptor protein levels, suggesting a role for post-transcriptional regulation. These and previous data suggest that chronic stress might be a key regulator of NUDR/Freud-1 gene expression.
Teaching molecular genetics: Chapter 1--Background principles and methods of molecular biology.
Knoers, Nine V A M; Monnens, Leo A H
2006-02-01
In this first chapter of the series "Teaching molecular genetics," an introduction to molecular genetics is presented. We describe the structure of DNA and genes and explain in detail the central dogma of molecular biology, that is, the flow of genetic information from DNA via RNA to polypeptide (protein). In addition, several basic and frequently used general molecular tools, such as restriction enzymes, Southern blotting, DNA amplification and sequencing are discussed, in order to lay the foundations for the forthcoming chapters.
International Nuclear Information System (INIS)
Sarma, R.H.; Sarma, M.H.; Umemoto, K.
1990-01-01
1D/2D NMR studies are reported for a [1:1] complex of d(GA 4 T 4 C) 2 and Dst2 (an analogue of distamycin A). Full- Matrix NOESY Simulations, Molecular Mechanics and Molecular Dynamics Calculations are performed to analyze the NMR data. Results show that drug-DNA complex formation is driven by static features like H-bonding and steric interactions in the minor-groove of DNA. As a consequence of drug binding, a non-linear oscillatory mode is activated. In this mode the molecule samples equilibrium structural states of difference degrees of bending. It is noted that these structures belong to three distinctly different energy wells that satisfy the same NMR data. 14 refs., 4 figs., 2 tabs
Teaching molecular genetics: Chapter 1--Background principles and methods of molecular biology.
Knoers, N.V.A.M.; Monnens, L.A.H.
2006-01-01
In this first chapter of the series "Teaching molecular genetics," an introduction to molecular genetics is presented. We describe the structure of DNA and genes and explain in detail the central dogma of molecular biology, that is, the flow of genetic information from DNA via RNA to polypeptide
Directory of Open Access Journals (Sweden)
Rebeca Carter
Full Text Available OBJECTIVES: Emerging evidence suggests that maternal obesity (MO predisposes offspring to obesity and the recently described non-alcoholic fatty pancreas disease (NAFPD but involved mechanisms remain unclear. Using a pathophysiologically relevant murine model, we here investigated a role for the biological clock--molecular core circadian genes (CCG in the generation of NAFPD. DESIGN: Female C57BL6 mice were fed an obesogenic diet (OD or standard chow (SC for 6 weeks, prior to pregnancy and throughout gestation and lactation: resulting offspring were subsequently weaned onto either OD (Ob_Ob and Con_Ob or standard chow (Ob_Con and Con_Con for 6 months. Biochemical, pro-inflammatory and pro-fibrogenic markers associated with NAFPD were then evaluated and CCG mRNA expression in the pancreas determined. RESULTS: Offspring of obese dams weaned on to OD (Ob_Ob had significantly increased (p≤0.05: bodyweight, pancreatic triglycerides, macrovesicular pancreatic fatty-infiltration, and pancreatic mRNA expression of TNF-α, IL-6, α-SMA, TGF-β and increased collagen compared to offspring of control dams weaned on to control chow (Con_Con. Analyses of CCG expression demonstrated a phase shift in CLOCK (-4.818, p<0.01, REV-ERB-α (-1.4,p<0.05 and Per2 (3.27,p<0.05 in association with decreased amplitude in BMAL-1 (-0.914,p<0.05 and PER2 (1.18,p<0.005 in Ob_Ob compared to Con_Con. 2-way ANOVA revealed significant interaction between MO and post-weaning OD in expression of CLOCK (p<0.005, PER1 (p<0.005 and PER2 (p<0.05 whilst MO alone influenced the observed rhythmic variance in expression of all 5 measured CCG. CONCLUSIONS: Fetal and neonatal exposure to a maternal obesogenic environment interacts with a post-natal hyper-calorific environment to induce offspring NAFPD through mechanisms involving perturbations in CCG expression.
Modulation of olfactory sensitivity and glucose sensing by the feeding state in obese Zucker rats.
Directory of Open Access Journals (Sweden)
Pascaline eAimé
2014-09-01
Full Text Available The Zucker fa/fa rat has been widely used as an animal model to study obesity, since it recapitulates most of its behavioral and metabolic dysfunctions, such as hyperphagia, hyperglycemia and insulin resistance. Although it is well established that olfaction is under nutritional and hormonal influences, little is known about the impact of metabolic dysfunctions on olfactory performances and glucose-sensing in the olfactory system of the obese Zucker rat. In the present study, using a behavioral paradigm based on a conditioned olfactory aversion, we have shown that both obese and lean Zucker rats have a better olfactory sensitivity when they are fasted than when they are satiated. Interestingly, the obese Zucker rats displayed a higher olfactory sensitivity than their lean controls. By investigating the molecular mechanisms involved in glucose-sensing in the olfactory system, we demonstrated that sodium-coupled glucose transporters 1 (SGLT1 and insulin dependent glucose transporters 4 (GLUT4 are both expressed in the olfactory bulb (OB. By comparing the expression of GLUT4 and SGLT1 in OB of obese and lean Zucker rats, we found that only SGLT1 is regulated in genotype-dependent manner. Next, we used glucose oxidase biosensors to simultaneously measure in vivo the extracellular fluid glucose concentrations ([Gluc]ECF in the OB and the cortex. Under metabolic steady state, we have determined that the OB contained twice the amount of glucose found in the cortex. In both regions, the [Gluc]ECF was 2 fold higher in obese rats compared to their lean controls. Under induced dynamic glycemia conditions, insulin injection produced a greater decrease of [Gluc]ECF in the OB than in the cortex. Glucose injection did not affect OB [Gluc]ECF in Zucker fa/fa rats. In conclusion, these results emphasize the importance of glucose for the OB network function and provide strong arguments towards establishing the OB glucose-sensing as a key factor for sensory
Energy Technology Data Exchange (ETDEWEB)
Wolk, Scott J.; Rice, Thomas S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Aspin, Colin A. [Institute for Astronomy, University of Hawaii at Manoa, 640 North Aohoku Place, Hilo, HI 96720 (United States)
2013-04-15
We present a subset of the results of a three-season, 124 night, near-infrared monitoring campaign of the dark clouds Lynds 1003 and Lynds 1004 in the Cygnus OB7 star-forming region. In this paper, we focus on the field star population. Using three seasons of UKIRT J, H, and K-band observations spanning 1.5 years, we obtained high-quality photometry on 9200 stars down to J = 17 mag, with photometric uncertainty better than 0.04 mag. After excluding known disk-bearing stars we identify 149 variables-1.6% of the sample. Of these, about 60 are strictly periodic, with periods predominantly <2 days. We conclude this group is dominated by eclipsing binaries. A few stars have long period signals of between 20 and 60 days. About 25 stars have weak modulated signals, but it was not clear if these were periodic. Some of the stars in this group may be diskless young stellar objects with relatively large variability due to cool starspots. The remaining {approx}60 stars showed variations which appear to be purely stochastic.
NMR spectroscopic characterization of {beta}-cyclodextrin inclusion complex with vanillin
Energy Technology Data Exchange (ETDEWEB)
Pirnau, Adrian; Bogdan, Mircea; Floare, Calin G, E-mail: adrian.pirnau@itim-cj.r [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania)
2009-08-01
The inclusion of vanillin by {beta}-cyclodextrin was investigated by {sup 1}H NMR. The continuous variation technique was used to evidence the formation of soluble 1:1 complex in aqueous solution. The association constant of vanillin with {beta}-cyclodextrin has been obtained at 298 K by fitting the experimental chemical shifts differences, {Delta}{delta}{sub obs} {delta}{sub free} - {delta}{sub obs} of the observed guest and host protons, with a non-linear regression method. Besides the effective association constant, the fitting procedure allows a precise determination of all chemical shift parameters characterizing the pure complex. They can by used for an analysis of the geometry of the molecular complex in solution.
Directory of Open Access Journals (Sweden)
Minh T. Do
2017-01-01
Full Text Available Introduction : Des études chez l’animal ont révélé que l’exposition au bisphénol A (BPA affecte le métabolisme des lipides et favorise la prise de poids. Des études épidémiologiques récentes appuient aussi l’existence d’un lien entre le BPA et l’obésité chez l’humain, mais la plupart d’entre elles se limitent à une seule mesure de l’adiposité ou ne tiennent pas compte des facteurs de confusion alimentaires possibles. Cette étude vise à examiner les associations entre les concentrations urinaires de BPA et les mesures de l’adiposité dans un échantillon national représentatif des adultes canadiens. Méthodologie : Nous avons réalisé des analyses à l’aide de données de biosurveillance et de données anthropométriques mesurées directement auprès de 4 733 adultes de 18 à 79 ans dans le cadre de l’Enquête canadienne sur les mesures de la santé (2007-2011. Nous avons utilisé des modèles de régression logistique multinomiale et binaire pour estimer les associations entre, d’une part, les concentrations urinaires de BPA et, d’autre part, les diverses catégories d’indice de masse corporelle (IMC (embonpoint par opposition à poids insuffisant ou normal; obésité par opposition à poids insuffisant ou normal et un tour de taille élevé (102 cm ou plus pour les hommes; 88 cm ou plus pour les femmes en tenant compte des facteurs de confusion possibles. Des analyses de régression linéaire ont aussi été effectuées pour évaluer les associations entre les concentrations urinaires de BPA et des mesures de l’IMC et du tour de taille. Résultats : On a pu associer positivement la concentration urinaire de BPA et l’obésité (définie par l’IMC. Le rapport de cotes s’est situé à 1,54 (intervalle de confiance [IC] à 95 % : 1,002 à 2,37 dans le quartile de BPA le plus élevé par rapport au plus bas (test de tendance, p = 0,041. La concentration urinaire de BPA n’a pas été associ
INVESTIGAREA METODELOR DE SINTEZĂ PENTRU 3-(ANTRACEN-9-IL-1-(4-IZOTIOCIANATOFENIL-PROP-2-EN-1-ONĂ
Directory of Open Access Journals (Sweden)
Ana POPUŞOI
2017-03-01
Full Text Available Lucrarea prezintă o descriere succintă a izotiocianatochalconelor fluorescente şi redă unele metode de obţinere a lor. În aspect mai detaliat sunt cercetate metodele de obţinere a izotiocianatochalconelor ce conţin fragmentul antracenic. Rezultate bune atestă metoda ce include condensarea 3-(4-acetilfenil-1,1-dimetiltioureei cu antracen-9-carbaldehidă, urmată de eliminarea dimetilaminei din chalconele corespunzătoare la tratare cu anhidridă acetică sau cu clorură de acetil.THE INVESTIGATION OF SYNTHESIS METHODS FOR 3-(ANTHRACEN-9-YL-1-(4-ISOTHIOCYANATOPHENYLPROP-2-EN-1-ONEThe paper presents a review of the isothiocyanatochalcones fluorescents and their methods of synthesis. Various methods were investigated for obtaining anthracene moiety containing isothiocyanatochalcones. Good results give the method which includes condensation of 3-(4-acetylphenyl-1,1-dimethylamine with antracene-9-carbaldehyde flowed by elimination of dimethylamine in the treatment of corresponding chacones with acetyl anhydride or acetyl chloride.
[Wolfram syndrome: clinical features, molecular genetics of WFS1 gene].
Tanabe, Katsuya; Matsunaga, Kimie; Hatanaka, Masayuki; Akiyama, Masaru; Tanizawa, Yukio
2015-02-01
Wolfram syndrome(WFS: OMIM 222300) is a rare recessive neuro-endocrine degenerative disorder, known as DIDMOAD(Diabetes Insipidus, early-onset Diabetes Mellitus, Optic Atrophy and Deafness) syndrome. Most affected individuals carry recessive mutations in the Wolfram syndrome 1 gene(WFS1). The WFS1 protein is an endoplasmic reticulum(ER) embedded protein, which functions in ER calcium homeostasis and unfolded protein responses. Dysregulation of these cellular processes results in the development of ER stress, leading to apoptosis. In addition, abundantly present WFS1 protein in insulin secretory granules plays a role in the intra-granular acidification. However, the phenotypic pleiomorphism and molecular complexity of this disease limit the understanding of WFS. Here we review clinical features, molecular mechanisms and mutations of WFS1 gene that relate to this syndrome.
Han, Bing; Su, Tao; Wu, Hao; Gou, Zhongxuan; Xing, Xin-Hui; Jiang, Hao; Chen, Yin; Li, Xin; Murrell, J Colin
2009-06-01
Slow growth and relatively low cell densities of methanotrophs have limited their uses in industrial applications. In this study, a novel method for rapid cultivation of Methylosinus trichosporium OB3b was studied by adding a water-immiscible organic solvent in the medium. Paraffin oil was the most effective at enhancing cell growth and final cell density. This is at least partially due to the increase of methane gas transfer between gas and medium phases since methane solubility is higher in paraffin than in water/nitrate minimal salt medium. During cultivation with paraffin oil at 5% (v/v) in the medium, M. trichosporium OB3b cells also showed higher concentrations of the intermediary metabolites, such as formic acid and pyruvic acid, and consumed more methane compared with the control. Paraffin as methane vector to improve methanotroph growth was further studied in a 5-L fermentor at three concentrations (i.e., 2.5%, 5%, and 10%). Cell density reached about 14 g dry weight per liter with 5% paraffin, around seven times higher than that of the control (without paraffin). Cells cultivated with paraffin tended to accumulate around the interface between oil droplets and the water phase and could exist in oil phase in the case of 10% (v/v) paraffin. These results indicated that paraffin could enhance methanotroph growth, which is potentially useful in cultivation of methanotrophs in large scale in industry.
A relationship between SNR G109.1-1.0 and the molecular cloud of Sh2-152
International Nuclear Information System (INIS)
Heydari-Malayeri, M.; Kahane, C.; Lucas, R.
1981-01-01
The possible association of the supernova remnant SNR G109.1 - 1.0 and the x-ray source GF2259 + 586 with the molecular cloud of Sh2 - 152 has been investigated by observing the molecular line 13 CO (J = 1 → 0) of the complex Sh2 - 147/Sh2 - 153. The present results are compared with those of previous workers. It is shown that although the various estimates of distance for the SNR, the x-ray source, the H II region Sh2 - 152 and the molecular cloud are in relatively good agreement, because of the uncertainties of distance evaluation in the Perseus arm this cannot be regarded as conclusive proof of the association of these objects. (U.K.)
The molecular orientation of CO on Pd(1 1 1): a polarization-dependent SFG study
Galletto, Paolo; Unterhalt, Holger; Rupprechter, Günther
2003-01-01
The molecular orientation of carbon monoxide adsorbed on Pd(1 1 1) was examined by sum frequency generation (SFG) vibrational spectroscopy utilizing different polarization combinations of the visible and SFG light. This allows to determine the CO tilt angle with respect to the substrate, provided that a proper optical model for the interface can be defined. It is demonstrated that it is essential to invoke the βaac hyperpolarizability into the analysis and that polarization-dependent SFG of CO/Pd(1 1 1) yields information on βaac/ βccc rather than the tilt angle.
Reshef, Ronen; Kreisel, Tirzah; Beroukhim Kay, Dorsa; Yirmiya, Raz
2014-10-01
Recent studies demonstrate that microglia play an important role in cognitive and neuroplasticity processes, at least partly via microglial CX3C receptor 1 (CX3CR1) signaling. Furthermore, microglia are responsive to environmental enrichment (EE), which modulates learning, memory and neurogenesis. In the present study we examined the role of microglial CX3CR1 signaling in hippocampal- and olfactory-bulb (OB)-related memory and neurogenesis in homozygous mice with microglia-specific transgenic expression of GFP under the CX3CR1 promoter (CX3CR1(-/-) mice), in which the CX3CR1 gene is functionally deleted, as well as heterozygous CX3CR1(+/-) and WT controls. We report that the CX3CR1-deficient mice displayed better hippocampal-dependent memory functioning and olfactory recognition, along with increased number and soma size of hippocampal microglia, suggestive of mild activation status, but no changes in OB microglia. A similar increase in hippocampal-dependent memory functioning and microglia number was also induced by pharmacological inhibition of CX3CR1 signaling, using chronic (2weeks) i.c.v. administration of CX3CR1 blocking antibody. In control mice, EE improved hippocampal-dependent memory and neurogenesis, and increased hippocampal microglia number and soma size, whereas odor enrichment (OE) improved olfactory recognition and OB neurogenesis without changing OB microglia status. In CX3CR1-deficient mice, EE and OE did not produce any further improvement in memory functioning or neurogenesis and had no effect on microglial status. These results support the notion that in the hippocampus microglia and their interactions with neurons via the CX3CR1 play an important role in memory functioning and neurogenesis, whereas in the OB microglia do not seem to be involved in these processes. Copyright © 2014 Elsevier Inc. All rights reserved.
Increased lipids in non-lipogenic tissues are indicators of the severity of type 2 diabetes in mice
DEFF Research Database (Denmark)
Campbell-Tofte, J.; Hansen, H.S.; Mu, Huiling
2007-01-01
We hypothesised that the molecular changes triggered in type 2 diabetes might cause phenotypic changes in the lipid fraction of tissues. We compared tissue lipid profiles of inbred lean B6-Bom with those of the obese B6-ob/ob and diabetic BKS-db/db mice and found that genetically diabetic mice...... significantly accumulate fat (especially monounsaturated fatty acids, MUFA) in non-lipogenic tissues such as the eye (MUFA, 2-fold), skeletal muscle (MUFA, 13-fold) and pancreas (MUFA, 16-fold). In contrast, the B6-ob/ob mice which manifest a milder form of type 2 diabetes use the liver as their predominant...
International Nuclear Information System (INIS)
Wang, Jyh-Shyang; Tsai, Yu-Hsuan; Chen, Chang-Wei; Dai, Zi-Yuan; Tong, Shih-Chang; Yang, Chu-Shou; Wu, Chih-Hung; Yuan, Chi-Tsu; Shen, Ji-Lin
2014-01-01
Highlights: • CdTe(1 1 1)A epilayers were grown on Si(1 1 1) substrates by molecular beam epitaxy. • We report an enhanced growth using Mn atoms. • The significant improvements in surface quality and optical properties were found. - Abstract: This work demonstrates an improvement of the molecular beam epitaxial growth of CdTe(1 1 1)A epilayer on Si(1 1 1) substrates using Mn atoms. The reflection high-energy electron diffraction patterns show that the involvement of some Mn atoms in the growth of CdTe(1 1 1)A is even more effective than the use of a buffer layer with a smooth surface for forming good CdTe(1 1 1)A epilayers. 10 K Photoluminescence spectra show that the incorporation of only 2% Mn significantly reduced the intensity of defect-related emissions and considerably increased the integral intensity of exciton-related emissions by a large factor of about 400
HTLV-1 induced molecular mimicry in neurological disease.
Lee, S M; Morcos, Y; Jang, H; Stuart, J M; Levin, M C
2005-01-01
As a model for molecular mimicry, we study patients infected with human T-lymphotropic virus type 1 (HTLV-1) who develop a neurological disease called HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP), a disease with important biological similarities to multiple sclerosis (MS) (Khan et al. 2001; Levin et al. 1998, 2002a; Levin and Jacobson 1997). The study of HAM/TSP, a disease associated with a known environmental agent (HTLV-1), allows for the direct comparison of the infecting agent with host antigens. Neurological disease in HAM/TSP patients is associated with immune responses to HTLV-1-tax (a regulatory and immunodominant protein) and human histocompatibility leukocyte antigen (HLA) DRB1*0101 (Bangham 2000; Jacobson et al. 1990; Jeffery et al. 1999; Lal 1996). Recently, we showed that HAM/TSP patients make antibodies to heterogeneous nuclear ribonuclear protein A1 (hnRNP A1), a neuron-specific autoantigen (Levin et al. 2002a). Monoclonal antibodies to tax cross-reacted with hnRNP A1, indicating molecular mimicry between the two proteins. Infusion of cross-reactive antibodies with an ex vivo system completely inhibited neuronal firing indicative of their pathogenic nature (Kalume et al. 2004; Levin et al. 2002a). These data demonstrate a clear link between chronic viral infection and autoimmune disease of the central nervous system (CNS) in humans and, we believe, in turn will give insight into the pathogenesis of MS.
NEAR-INFRARED VARIABILITY IN YOUNG STARS IN CYGNUS OB7
Energy Technology Data Exchange (ETDEWEB)
Rice, Thomas S. [Department of Astronomy, Harvard University, 60 Garden Street, Cambridge, MA 02138 (United States); Wolk, Scott J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Aspin, Colin [Institute for Astronomy, University of Hawaii at Manoa, 640 N Aohoku Pl, Hilo, HI 96720 (United States)
2012-08-10
We present the first results from a 124 night J, H, K near-infrared monitoring campaign of the dark cloud L 1003 in Cygnus OB7, an active star-forming region. Using three seasons of UKIRT observations spanning 1.5 years, we obtained high-quality photometry on 9200 stars down to J = 17 mag, with photometric uncertainty better than 0.04 mag. On the basis of near-infrared excesses from disks, we identify 30 pre-main-sequence stars, including 24 which are newly discovered. We analyze those stars and find that the NIR excesses are significantly variable. All 9200 stars were monitored for photometric variability; among the field star population, {approx}160 exhibited near-infrared variability (1.7% of the sample). Of the 30 young stellar objects (YSOs), 28 of them (93%) are variable at a significant level. Of the 30 YSOs, twenty-five have near-infrared excess consistent with simple disk-plus-star classical T Tauri models. Nine of these (36%) drift in color space over the course of these observations and/or since Two Micron All Sky Survey observations such that they cross the boundary defining the NIR excess criteria; effectively, they have a transient near-infrared excess. Thus, time-series JHK observations can be used to obtain a more complete sample of disk-bearing stars than single-epoch JHK observations. About half of the YSOs have color-space variations parallel to either the classical T Tauri star locus or a hybrid track which includes the dust reddening trajectory. This indicates that the NIR variability in YSOs that possess accretion disks arises from a combination of variable extinction and changes in the inner accretion disk: either in accretion rate, central hole size, and/or the inclination of the inner disk. While some variability may be due to stellar rotation, the level of variability on the individual stars can exceed a magnitude. This is a strong empirical suggestion that protoplanetary disks are quite dynamic and exhibit more complex activity on short
International Nuclear Information System (INIS)
Wang, J.; Gutierre, M.S.
2010-01-01
This paper presents results of a molecular dynamics simulation study of dehydrated 2:1 clay minerals using the Parrinello-Rahman constant-pressure molecular dynamics method. The method is capable of simulating a system under the most general applied stress conditions by considering the changes of MD cell size and shape. Given the advantage of the method, it is the major goal of the paper to investigate the influence of imposed cell boundary conditions on the molecular structural transformation of 2:1 clay minerals under different normal pressures. Simulation results show that the degrees of freedom of the simulation cell (i.e., whether the cell size or shape change is allowed) determines the final equilibrated crystal structure of clay minerals. Both the MD method and the static method have successfully revealed unforeseen structural transformations of clay minerals upon relaxation under different normal pressures. It is found that large shear distortions of clay minerals occur when full allowance is given to the cell size and shape change. A complete elimination of the interlayer spacing is observed in a static simulation. However, when only the cell size change is allowed, interlayer spacing is retained, but large internal shear stresses also exist.
Ao, Mingqi; Xu, Guiying; Pang, Jinyu; Zhao, Taotao
2009-09-01
The aggregation of ionic liquid-type imidazolium gemini surfactant [C(12)-4-C(12)im]Br(2) on silicon wafer, which is compared with its monomer [C(12)mim]Br, have been studied. AFM morphology images and contact angle measurements suggest that the aggregations of [C(12)-4-C(12)im]Br(2) and [C(12)mim]Br on silicon wafer follow different mechanisms. Below the critical surface aggregation concentrations (CSAC), both surfactant molecules are adsorbed with their hydrophobic tails facing the air. But above the CSAC, [C(12)-4-C(12)im]Br(2) molecules finally form a bilayer structure with hydrophilic head groups facing the air, whereas [C(12)mim]Br molecules form a multilayer structure, and with increasing its concentration, the layer numbers increase with the hydrophobic chains and hydrophilic head groups facing the air by turns. Besides, the watery wettability of [C(12)-4-C(12)im]Br(2)-treated silica surface is lower than that of [C(12)mim]Br at the concentration of 5.0 cmc, and the infrared spectroscopy suggests that the poorer watery wettability of [C(12)-4-C(12)im]Br(2) may be relative to the less-ordered packing of methylene chains inside the aggregate. These different aggregation behaviors for the two surfactants ascribe to the different molecular structures and electrostatic interactions. This work would have certain theoretical guidance meaning on the modification of solid surface.
Directory of Open Access Journals (Sweden)
Favio Faifer
2017-08-01
Full Text Available In this letter, we present preliminary results of the analysis of Flamingos-2 and GMOS-S photometry of the globular cluster (GC system of the elliptical galaxy NGC 1395. This is the first step of a long-term Brazilian–Argentinian collaboration for the study of GC systems in early-type galaxies. In the context of this collaboration, we obtained deep NIR photometric data in two different bands (J and K s, which were later combined with high quality optical Gemini + GMOS photometry previously obtained by the Argentinian team. This allowed us to obtain different color indices, less sensitive to the effect of horizontal branch (HB stars for several hundreds of GC candidates, and to make an initial assessment of the presence or absence of multiple GC populations in colors in NGC 1395.
The Molecular Gas Environment in the 20 km s{sup −1} Cloud in the Central Molecular Zone
Energy Technology Data Exchange (ETDEWEB)
Lu, Xing; Gu, Qiusheng [School of Astronomy and Space Science, Nanjing University, Nanjing, Jiangsu 210093 (China); Zhang, Qizhou; Battersby, Cara [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Kauffmann, Jens; Pillai, Thushara [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Longmore, Steven N. [Astrophysics Research Institute, Liverpool John Moores University, 146 Brownlow Hill, Liverpool L3 5RF (United Kingdom); Kruijssen, J. M. Diederik [Astronomisches Rechen-Institut, Zentrum für Astronomie der Universität Heidelberg, Mönchhofstraße 12-14, D-69120 Heidelberg (Germany); Liu, Hauyu Baobab; Zhang, Zhi-Yu [European Southern Observatory, Karl-Schwarzschild-Straße 2, D-85748 Garching (Germany); Ginsburg, Adam [National Radio Astronomy Observatory, Socorro, NM 87801 (United States); Mills, Elisabeth A. C., E-mail: xinglv.nju@gmail.com [Department of Physics and Astronomy, San Jose State University, One Washington Square, San Jose, CA 95192 (United States)
2017-04-10
We recently reported a population of protostellar candidates in the 20 km s{sup −1} cloud in the Central Molecular Zone of the Milky Way, traced by H{sub 2}O masers in gravitationally bound dense cores. In this paper, we report molecular line studies with high angular resolution (∼3″) of the environment of star formation in this cloud. Maps of various molecular line transitions as well as the continuum at 1.3 mm are obtained using the Submillimeter Array. Five NH{sub 3} inversion lines and the 1.3 cm continuum are observed with the Karl G. Jansky Very Large Array. The interferometric observations are complemented with single-dish data. We find that the CH{sub 3}OH, SO, and HNCO lines, which are usually shock tracers, are better correlated spatially with the compact dust emission from dense cores among the detected lines. These lines also show enhancement in intensities with respect to SiO intensities toward the compact dust emission, suggesting the presence of slow shocks or hot cores in these regions. We find gas temperatures of ≳100 K at 0.1 pc scales based on RADEX modeling of the H{sub 2}CO and NH{sub 3} lines. Although no strong correlations between temperatures and linewidths/H{sub 2}O maser luminosities are found, in high-angular-resolution maps we note several candidate shock-heated regions offset from any dense cores, as well as signatures of localized heating by protostars in several dense cores. Our findings suggest that at 0.1 pc scales in this cloud star formation and strong turbulence may together affect the chemistry and temperature of the molecular gas.
Institute of Scientific and Technical Information of China (English)
Bin-Shuang Pang; Xue-Yong Zhang
2008-01-01
The high molecular weight glutenin subunit (HMW-GS) pair 1Bx13+1Byt6 are recognized to positively correlate with bread-making quality; however, their molecular data remain unknown. In order to reveal the mechanism by which 1By16 and 1Bx13 creates high quality, their open reading frames (ORFs) were amplified from common wheat Atlas66 and Jimai 20 using primers that were designed based on published sequences of HMW glutenin genes. The ORF of 1By16 was 2220bp, deduced into 738 amino acid residues with seven cysteines including 59 hexapeptides and 22 nanopeptides motifs. The ORF of 1Bx13 was 2385bp, deduced into 795 amino acid residues with four cysteines including 68 hexapeptides, 25 nanopeptides and six tripeptides motifs. We found that 1By16 was the largest y-type HMW glutenin gene described to date in common wheat. The 1By16 had 36 amino acid residues inserted in the central repetitive domain compared with 1By15. Expression in bacteria and western-blot tests confirmed that the sequence cloned was the ORF of HMW-GS 1By16, and that 1Bx13 was one of the largest 1Bx genes that have been described so far in common wheat, exhibiting a hexapeptide (PGQGQQ) insertion in the end of central repetitive domain compared with 1Bx7. A phylogenetic tree based on the deduced full-length amino acid sequence alignment of the published HMW-GS genes showed that the 1By16 was clustered with Glu-IB-2, and that the 1Bx13 was clustered with Glu-1B-1 alleles.
An Optical/Near-infrared Investigation of HD 100546 b with the Gemini Planet Imager and MagAO
Rameau, Julien; Follette, Katherine B.; Pueyo, Laurent; Marois, Christian; Macintosh, Bruce; Millar-Blanchaer, Maxwell; Wang, Jason J.; Vega, David; Doyon, René; Lafrenière, David; Nielsen, Eric L.; Bailey, Vanessa; Chilcote, Jeffrey K.; Close, Laird M.; Esposito, Thomas M.; Males, Jared R.; Metchev, Stanimir; Morzinski, Katie M.; Ruffio, Jean-Baptiste; Wolff, Schuyler G.; Ammons, S. M.; Barman, Travis S.; Bulger, Joanna; Cotten, Tara; De Rosa, Robert J.; Duchene, Gaspard; Fitzgerald, Michael P.; Goodsell, Stephen; Graham, James R.; Greenbaum, Alexandra Z.; Hibon, Pascale; Hung, Li-Wei; Ingraham, Patrick; Kalas, Paul; Konopacky, Quinn; Larkin, James E.; Maire, Jérôme; Marchis, Franck; Oppenheimer, Rebecca; Palmer, David; Patience, Jennifer; Perrin, Marshall D.; Poyneer, Lisa; Rajan, Abhijith; Rantakyrö, Fredrik T.; Marley, Mark S.; Savransky, Dmitry; Schneider, Adam C.; Sivaramakrishnan, Anand; Song, Inseok; Soummer, Remi; Thomas, Sandrine; Wallace, J. Kent; Ward-Duong, Kimberly; Wiktorowicz, Sloane
2017-06-01
We present H band spectroscopic and Hα photometric observations of HD 100546 obtained with the Gemini Planet Imager and the Magellan Visible AO camera. We detect H band emission at the location of the protoplanet HD 100546 b, but show that the choice of data processing parameters strongly affects the morphology of this source. It appears point-like in some aggressive reductions, but rejoins an extended disk structure in the majority of the others. Furthermore, we demonstrate that this emission appears stationary on a timescale of 4.6 years, inconsistent at the 2σ level with a Keplerian clockwise orbit at 59 au in the disk plane. The H band spectrum of the emission is inconsistent with any type of low effective temperature object or accreting protoplanetary disk. It strongly suggests a scattered-light origin, as this is consistent with the spectrum of the star and the spectra extracted at other locations in the disk. A non-detection at the 5σ level of HD 100546 b in differential Hα imaging places an upper limit, assuming the protoplanet lies in a gap free of extinction, on the accretion luminosity of 1.7 × 10-4 L ⊙ and M\\dot{M}planetary photosphere or an accreting circumplanetary disk but is a disk feature enhanced by the point-spread function subtraction process. This non-detection is consistent with the non-detection in the K band reported in an earlier study but does not exclude the possibility that HD 100546 b is deeply embedded.
Jürgens, Hella S; Schürmann, Annette; Kluge, Reinhart; Ortmann, Sylvia; Klaus, Susanne; Joost, Hans-Georg; Tschöp, Matthias H
2006-04-13
Among polygenic mouse models of obesity, the New Zealand obese (NZO) mouse exhibits the most severe phenotype, with fat depots exceeding 40% of total body weight at the age of 6 mo. Here we dissected the components of energy balance including feeding behavior, locomotor activity, energy expenditure, and thermogenesis compared with the related lean New Zealand black (NZB) and obese B6.V-Lep(ob)/J (ob/ob) strains (11% and 65% fat at 23 wk, respectively). NZO mice exhibited a significant hyperphagia that, when food intake was expressed per metabolic body mass, was less pronounced than that of the ob/ob strain. Compared with NZB, NZO mice exhibited increased meal frequency, meal duration, and meal size. Body temperature as determined by telemetry with implanted sensors was reduced in NZO mice, but again to a lesser extent than in the ob/ob strain. In striking contrast to ob/ob mice, NZO mice were able to maintain a constant body temperature during a 20-h cold exposure, thus exhibiting a functioning cold-induced thermogenesis. No significant differences in spontaneous home cage activity were observed among NZO, NZB, and ob/ob strains. When mice had access to voluntary running wheels, however, running activity was significantly lower in NZO than NZB mice and even lower in ob/ob mice. These data indicate that obesity in NZO mice, just as in humans, is due to a combination of hyperphagia, reduced energy expenditure, and insufficient physical activity. Because NZO mice differ strikingly from the ob/ob strain in their resistance to cold stress, we suggest that the molecular defects causing hyperphagia in NZO mice are located distal from leptin and its receptor.
Carroll, Gregory T.; London, Gabor; Fernández Landaluce, Tatiana; Rudolf, Petra; Feringa, Ben L.
We report the attachment of altitudinal light-driven molecular motors to surfaces using 1,3-dipolar cycloaddition reactions. Molecular motors were designed containing azide or alkyne groups for attachment to alkyne- or azide-modified surfaces. Surface attachment was characterized by UV-vis, IR, XPS,