Final Report - "CO2 Sequestration in Cell Biomass of Chlorobium Thiosulfatophilum"
Energy Technology Data Exchange (ETDEWEB)
James L. Gaddy, PhD; Ching-Whan Ko, PhD
2009-05-04
World carbon dioxide emissions from the combustion of fossil fuels have increased at a rate of about 3 percent per year during the last 40 years to over 24 billion tons today. While a number of methods have been proposed and are under study for dealing with the carbon dioxide problem, all have advantages as well as disadvantages which limit their application. The anaerobic bacterium Chlorobium thiosulfatophilum uses hydrogen sulfide and carbon dioxide to produce elemental sulfur and cell biomass. The overall objective of this project is to develop a commercial process for the biological sequestration of carbon dioxide and simultaneous conversion of hydrogen sulfide to elemental sulfur. The Phase I study successfully demonstrated the technical feasibility of utilizing this bacterium for carbon dioxide sequestration and hydrogen sulfide conversion to elemental sulfur by utilizing the bacterium in continuous reactor studies. Phase II studies involved an advanced research and development to develop the engineering and scale-up parameters for commercialization of the technology. Tasks include culture isolation and optimization studies, further continuous reactor studies, light delivery systems, high pressure studies, process scale-up, a market analysis and economic projections. A number of anaerobic and aerobic microorgansims, both non-photosynthetic and photosynthetic, were examined to find those with the fastest rates for detailed study to continuous culture experiments. C. thiosulfatophilum was selected for study to anaerobically produce sulfur and Thiomicrospira crunogena waws selected for study to produce sulfate non-photosynthetically. Optimal conditions for growth, H2S and CO2 comparison, supplying light and separating sulfur were defined. The design and economic projections show that light supply for photosynthetic reactions is far too expensive, even when solar systems are considered. However, the aerobic non-photosynthetic reaction to produce sulfate with T
Enriched reaction center preparation from green photosynthetic bacteria. [Chlorobium limicola
Energy Technology Data Exchange (ETDEWEB)
Olson, J M; Giddings, Jr, T H; Shaw, E K
1976-01-01
Bacteriochlorophyll a reaction-center complex I from Chlorobium limicola f. thiosulfatophilum 6230 (Tassajara) was incubated in 2 M guanidine . HCl and then chromatographed on cross-linked dextran or agarose gel. Two principal components were separated: a larger component with photochemical activity (bacteriochlorophyll a reaction-center complex II) and a smaller component without activity (bacteriochlorophyll a protein). Complex II contains carotenoid, bacteriochlorophyll a, reaction center(s), and cytochromes b and c, but lacks the well characterized bacteriochlorophyll a protein contained in Complex I. Complex II carries out a light-induced reduction of cytochrome b along with an oxidation of cytochrome c.
Photoproduction of hydrogen by membranes of green photosynthetic bacteria
Energy Technology Data Exchange (ETDEWEB)
Bernstein, J D; Olson, J M
1980-01-01
Photoproduction of H/sub 2/ from ascorbate by unit-membrane vesicles from Chlorobium limicola f. thiosulfatophilum was achieved with a system containing gramicidin D, tetramethyl-p-phenylenediamine, methyl viologen, dithioerythritol, Clostridium hydrogenase, and an oxygen-scavenging mixture of glucose, glucose oxidase, ethanol, and catalase. Maximum quantum yield was less than one percent. Half maximum rate of H/sub 2/ production occurred at a white-light intensity of approximately 0.15 cm/sup -2/. The reaction was inhibited completely by 0.3% sodium dodecylbenzene sulfonate, 1% Triton X-100, or preheating the vesicles at 100/sup 0/C for 5 minutes. Low concentrations (0.01 and 0.05%) of Triton X-100 about doubled the reaction rate.
DEFF Research Database (Denmark)
Frigaard, N-U; Bryant, D A
2001-01-01
Conditions for inactivating chromosomal genes of Chlorobium tepidum by natural transformation and homologous recombination were established. As a model, mutants unable to perform nitrogen fixation were constructed by interrupting nifD with various antibiotic resistance markers. Growth of wild...
DEFF Research Database (Denmark)
Kjaer, B; Frigaard, N-U; Yang, F
1998-01-01
Photosynthetically active reaction center complexes were prepared from the green sulfur bacterium Chlorobium vibrioforme NCIMB 8327, and the content of quinones was determined by extraction and high-performance liquid chromatography. The analysis showed a stoichiometry of 1.7 molecules of menaqui......Photosynthetically active reaction center complexes were prepared from the green sulfur bacterium Chlorobium vibrioforme NCIMB 8327, and the content of quinones was determined by extraction and high-performance liquid chromatography. The analysis showed a stoichiometry of 1.7 molecules...
A reverse KREBS cycle in photosynthesis: consensus at last
Buchanan, B. B.; Arnon, D. I.
1990-01-01
The Krebs cycle (citric acid or tricarboxylic acid cycle), the final common pathway in aerobic metabolism for the oxidation of carbohydrates, fatty acids and amino acids, is known to be irreversible. It liberates CO2 and generates NADH whose aerobic oxidation yields ATP but it does not operate in reverse as a biosynthetic pathway for CO2 assimilation. In 1966, our laboratory described a cyclic pathway for CO2 assimilation (Evans, Buchanan and Arnon 1966) that was unusual in two respects: (i) it provided the first instance of an obligate photoautotroph that assimilated CO2 by a pathway different from Calvin's reductive pentose phosphate cycle (Calvin 1962) and (ii) in its overall effect the new cycle was a reversal of the Krebs cycle. Named the 'reductive carboxylic acid cycle' (sometimes also called the reductive tricarboxylic acid cycle) the new cycle appeared to be the sole CO2 assimilation pathway in Chlorobium thiosulfatophilum (Evans et al. 1966) (now known as Chlorobium limicola forma thiosulfatophilum). Chlorobium is a photosynthetic green sulfur bacterium that grows anaerobically in an inorganic medium with sulfide and thiosulfate as electron donors and CO2 as an obligatory carbon source. In the ensuing years, the new cycle was viewed with skepticism. Not only was it in conflict with the prevailing doctrine that the 'one important property ... shared by all (our emphasis) autotrophic species is the assimilation of CO2 via the Calvin cycle' (McFadden 1973) but also some of its experimental underpinnings were challenged. It is only now that in the words of one of its early skeptics (Tabita 1988) 'a long and tortuous controversy' has ended with general acceptance of the reductive carboxylic acid cycle as a photosynthetic CO2 assimilation pathway distinct from the pentose cycle. (Henceforth, to minimize repetitiveness, the reductive pentose phosphate cycle will often be referred to as the pentose cycle and the reductive carboxylic acid cycle as the carboxylic
DEFF Research Database (Denmark)
Frigaard, Niels-Ulrik; Chew, Aline Gomez Maqueo; Li, Hui
2003-01-01
Green sulfur bacteria are obligate, anaerobic photolithoautotrophs that synthesize unique bacteriochlorophylls (BChls) and a unique light-harvesting antenna structure, the chlorosome. One organism, Chlorobium tepidum, has emerged as a model for this group of bacteria primarily due to its relative...
Directory of Open Access Journals (Sweden)
A. Aliboni
2015-09-01
Full Text Available Chlorobium limicola belongs to the green sulphur bacteria that has a potential for technological applications such as biogas clean up oxidising hydrogen sulphide to elemental sulphur through photosynthetic process. In the present work, analytical methods are described for the determination of different sulphur species in C. limicola cultures – sulphide by GC-FPD, sulphate by ionic HPLC and elemental sulphur by RP HPLC. The latter method eliminates the need for chloroform extraction of water suspensions of elemental sulphur. Data from sulphide and elemental sulphur analyses have been compared with ones coming from more traditional analytical methodologies.
Genetic manipulation of carotenoid biosynthesis in the green sulfur bacterium Chlorobium tepidum
DEFF Research Database (Denmark)
Frigaard, Niels-Ulrik; Maresca, Julia A; Yunker, Colleen E
2004-01-01
The green sulfur bacterium Chlorobium tepidum is a strict anaerobe and an obligate photoautotroph. On the basis of sequence similarity with known enzymes or sequence motifs, nine open reading frames encoding putative enzymes of carotenoid biosynthesis were identified in the genome sequence of C....... tepidum, and all nine genes were inactivated. Analysis of the carotenoid composition in the resulting mutants allowed the genes encoding the following six enzymes to be identified: phytoene synthase (crtB/CT1386), phytoene desaturase (crtP/CT0807), zeta-carotene desaturase (crtQ/CT1414), gamma......-carotene desaturase (crtU/CT0323), carotenoid 1',2'-hydratase (crtC/CT0301), and carotenoid cis-trans isomerase (crtH/CT0649). Three mutants (CT0180, CT1357, and CT1416 mutants) did not exhibit a discernible phenotype. The carotenoid biosynthetic pathway in C. tepidum is similar to that in cyanobacteria and plants...
DEFF Research Database (Denmark)
Maresca, Julia A; Gomez Maqueo Chew, Aline; Ponsatí, Marta Ros
2004-01-01
that restores the correct reading frame in bchU. The bchU gene was inactivated in C. tepidum, a BChl c-producing species, and the resulting mutant produced only BChl d. Growth rate measurements showed that BChl c- and d-producing strains of the same organism (C. tepidum or C. vibrioforme) have similar growth...... rates at high and intermediate light intensities but that strains producing BChl c grow faster than those with BChl d at low light intensities. Thus, the bchU gene encodes the C-20 methyltransferase for BChl c biosynthesis in Chlorobium species, and methylation at the C-20 position to produce BChl c...
DEFF Research Database (Denmark)
Frigaard, Niels-Ulrik; Li, Hui; Martinsson, Peter
2005-01-01
Chlorosomes are the light-harvesting organelles in photosynthetic green bacteria and typically contain large amounts of bacteriochlorophyll (BChl) c in addition to smaller amounts of BChl a, carotenoids, and several protein species. We have isolated vestigial chlorosomes, denoted carotenosomes......, from a BChl c-less, bchK mutant of the green sulfur bacterium Chlorobium tepidum. The physical shape of the carotenosomes (86 +/- 17 nm x 66 +/- 13 nm x 4.3 +/- 0.8 nm on average) was reminiscent of a flattened chlorosome. The carotenosomes contained carotenoids, BChl a, and the proteins CsmA and Csm...... that the carotenosomes have an intact baseplate made of remarkably stable oligomeric CsmA-BChl a complexes but are flattened in structure due to the absence of BChl c. Carotenosomes thus provide a valuable material for studying the biogenesis, structure, and function of the photosynthetic antennae in green bacteria....
[Metabolism of carbohydrates in the cells of green sulphur bacteria Chlorobium limicola Ya-2002].
Horishnyĭ, M B; Hudz', S P; Hnatush, S O
2009-01-01
The nature of carbohydrates that accumulate in the cells of photosynthetic green sulphur bacteria of Chlorobium limicola Ya-2002 has been investigated. It is shown by infra-red spectrometry, that carbohydrates accumulated in the cells of bacteria are identical (by 90-95%) to glycogen of the bull liver. Exogenous glucose, saccharose, maltose, did not stimulate formation of glycogen. Growth of glycogen level in the cells of bacteria was observed at addition of acetate or piruvate in the conditions of bacteria cultivation in the light and in the presence CO2 and H2S in the environment. Washed cells of C. limicola Ya-2002 did not use glucose of the environment neither in the conditions of illumination nor in darkness, however acetate and piruvate are actively used in the light. During incubation of the washed cells in darkness the level of glycogen fell down approximately three times. Its amount during cells incubation in the light did not change. The decline of glycogen level in cells during their incubation in darkness was accompanied by piling up of carbonic acids in the environment acetate prevailing among them.
Energy Technology Data Exchange (ETDEWEB)
Bernstein, J.D.; Olson, J.M.
1981-01-01
Photohydrogen production, 200-700 ..mu..mol H/sub 2/ h/sup -1/ (mg bacteriochlorophyll a)/sup -1/ has been obtained in a system containing unit membrane vesicles (Complex I) from the green photosynthetic bacterium Chlorobium limicola f. thiosulfatophilum, ascorbate, N,N,N',N'-tetramethyl-p-phenylenediamine, dithioerythritol, an oxygen scavenging mixture, either methyl viologen (MV) or clostridial ferredoxin (CPS Fd) as electron carrier, and either CPS hydrogenase or platinum asbestos as catalyst. All components are necessary for maximum activity, and spinach Fd cannot be substituted for CPS Fd. Higher rates of photohydrogen production are obtained using MV or CPS Fd with hydrogenase than with MV and Pt asbestos. The highest quantum efficiencies (7-10% at 0.2-0.9 mW absorbed light and over 20% at lower light) were obtained with CPS Fd, hydrogenase and non-saturating 812 nm light. With saturating white light, however, rates of photohydrogen production varied relatively little among the various combinations of electron carrier and catalyst tested. The reaction rate is unaffected by 0.03% Triton X-100, and is insensitive to treatment with antimycin a or m-chloro-carbonyl cyanide phenylhydrazone.This indicates that neither electron flow through an endogenous cyclic chain, nor maintenance of a proton gradient are involved in this process.
The evolution of glutathione metabolism in phototrophic microorganisms
Fahey, R. C.; Buschbacher, R. M.; Newton, G. L.
1987-01-01
Of the many roles ascribed to glutathione (GSH) the one most clearly established is its role in the protection of higher eucaryotes against oxygen toxicity through destruction of thiol-reactive oxygen byproducts. If this is the primary function of GSH then GSH metabolism should have evolved during or after the evolution of oxygenic photosynthesis. That many bacteria do not produce GSH is consistent with this view. In the present study we have examined the low-molecular-weight thiol composition of a variety of phototrophic microorganisms to ascertain how evolution of GSH production is related to evolution of oxygenic photosynthesis. Cells were extracted in the presence of monobromobimane (mBBr) to convert thiols to fluorescent derivatives, which were analyzed by high-pressure liquid chromatography. Significant levels of GSH were not found in the green bacteria (Chlorobium thiosulfatophilum and Chloroflexus aurantiacus). Substantial levels of GSH were present in the purple bacteria (Chromatium vinosum, Rhodospirillum rubrum, Rhodobacter sphaeroides, and Rhodocyclus gelatinosa), the cyanobacteria [Anacystis nidulans, Microcoleus chthonoplastes S.G., Nostoc muscorum, Oscillatoria amphigranulata, Oscillatoria limnetica, Oscillatoria sp. (Stinky Spring, Utah), Oscillatoria terebriformis, Plectonema boryanum, and Synechococcus lividus], and eucaryotic algae (Chlorella pyrenoidsa, Chlorella vulgaris, Euglena gracilis, Scenedesmus obliquus, and Chlamydomonas reinhardtii). Other thiols measured included cysteine, gamma-glutamylcysteine, thiosulfate, coenzyme A, and sulfide; several unidentified thiols were also detected. Many of the organisms examined also exhibited a marked ability to reduce mBBr to syn-(methyl,methyl)bimane, an ability that was quenched by treatment with 2-pyridyl disulfide or 5,5'-bisdithio-(2-nitrobenzoic acid) prior to reaction with mBBr. These observations indicate the presence of a reducing system capable of electron transfer to mBBr and reduction of
ORF Sequence: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ase [Chlorobium tepidum TLS] MNILGIETSCDETSAAVLSDGSVRSNIVSSQRCHTDFGGVVPELASREHERLIVSIVDAAITEANIAKNDLDVIAATAG...PGLIGAVMVGLCFAEGLAWALGKPFVPVNHVEAHIFSPFISDEPGHREPKGDFVSLTVSGGHTLLSVVRQDLGYEVIGRTIDDAAGEAFDKTGKMLGLGYPAGPVIDR
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Chlorobium tepidum TLS] ... Length = 101 ... Query: 7 ... TRKELTILKLEEPIFDVRYADCFKATIDSMISTGTSKNIIIDFSQVKAIDS...SGIGSMLLA 66 ... TRKELTILKLEEPIFDVRYADCFKATIDSMISTGTSKNIIIDFSQVKAIDS...SGIGSMLLA Sbjct: 1 ... TRKELTILKLEEPIFDVRYADCFKATIDSMISTGTSKNIIIDFSQVKAIDSSGIGSMLLA 60 ...
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Chlorobium tepidum TLS] ... Length = 114 ... Query: 9 ... DPLKMFEDVFNERLTPFISSMGSMMAPAFKVDISEDEKAIYLS...ADIPGVKKEDVKVSIED 68 ... DPLKMFEDVFNERLTPFISSMGSMMAPAFKVDISEDEKAIYLSADIPGV...KKEDVKVSIED Sbjct: 1 ... DPLKMFEDVFNERLTPFISSMGSMMAPAFKVDISEDEKAIYLSADIPGVKKEDVKVSIED 60 ...
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ytidylate ... deaminase family protein [Chlorobium tepidum TLS] ... Length = 155 ... Query: 30 ... EARMRFV...VGASRKSVEEVSGGPFAAAVFEIESGRLVSLGVNLVLTQNSSILHAEMVAIVL 89 ... EARMRFV...VGASRKSVEEVSGGPFAAAVFEIESGRLVSLGVNLVLTQNSSILHAEMVAIVL Sbjct: 1 ... EARMRFVVGASRKSVEEVSGGPFAAAVFEIESGRLVSLGVNLV
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available nterchange ... protein, thioredoxin family [Chlorobium tepidum TLS] ... Length = 139 ... Query: 41 ... MAPA...FTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCREELPGMVALQKKYAKQGFTFVG 100 ... MAPA...FTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCREELPGMVALQKKYAKQGFTFVG Sbjct: 1 ... MAPAFTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCR
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available orobium tepidum TLS] gb|AAM72447.1| thioredoxin ... [Chlorobium tepidum TLS] ... Length = 99 ... Query: 8 ... DFQNDVI...ERSKTVPVLVDFWAQWCGPCRILAPVLEKLAERHAGKWVLVKVNTEEFPEISA 67 ... DFQNDVIERSKTVPVLVDFWAQ...WCGPCRILAPVLEKLAERHAGKWVLVKVNTEEFPEISA Sbjct: 1 ... DFQNDVIERSKTVPVLVDFWAQWCGPCRILAPVLEKLAERHAGKWVLVKVNTEEFPEISA 60 ...
Gauger, Tina; Byrne, James M.; Konhauser, Kurt O.; Obst, Martin; Crowe, Sean; Kappler, Andreas
2016-06-01
Most studies on microbial phototrophic Fe(II) oxidation (photoferrotrophy) have focused on purple bacteria, but recent evidence points to the importance of green-sulfur bacteria (GSB). Their recovery from modern ferruginous environments suggests that these photoferrotrophs can offer insights into how their ancient counterparts grew in Archean oceans at the time of banded iron formation (BIF) deposition. It is unknown, however, how Fe(II) oxidation rates, cell-mineral aggregate formation, and Fe-mineralogy vary under environmental conditions reminiscent of the geological past. To address this, we studied the Fe(II)-oxidizer Chlorobium ferrooxidans KoFox, a GSB living in co-culture with the heterotrophic Geospirillum strain KoFum. We investigated the mineralogy of Fe(III) metabolic products at low/high light intensity, and in the presence of dissolved silica and/or fumarate. Silica and fumarate influenced the crystallinity and particle size of the produced Fe(III) minerals. The presence of silica also enhanced Fe(II) oxidation rates, especially at high light intensities, potentially by lowering Fe(II)-toxicity to the cells. Electron microscopic imaging showed no encrustation of either KoFox or KoFum cells with Fe(III)-minerals, though weak associations were observed suggesting co-sedimentation of Fe(III) with at least some biomass via these aggregates, which could support diagenetic Fe(III)-reduction. Given that GSB are presumably one of the most ancient photosynthetic organisms, and pre-date cyanobacteria, our findings, on the one hand, strengthen arguments for photoferrotrophic activity as a likely mechanism for BIF deposition on a predominantly anoxic early Earth, but, on the other hand, also suggest that preservation of remnants of Fe(II)-oxidizing GSB as microfossils in the rock record is unlikely.
Czech Academy of Sciences Publication Activity Database
Chappaz-Gillot, C.; Marek, P.L.; Blaive, B.J.; Canard, G.; Burck, J.; Hahn, H.; Jávor fi, T.; Kelemen, L.; Krupke, R.; Mossinger, D.; Ormos, P.; Reddy, C.M.; Roussel, C.; Steinbach, G.; Szabo, M.; Ulrich, A.S.; Vanthuyne, V.N.; Vijayaraghavan, A.; Župčanová, Anita; Balaban, T.S.
2012-01-01
Roč. 134, č. 2 (2012), s. 944-954 ISSN 0002-7863 Institutional support: RVO:60077344 Keywords : Green photosynthetic bacteria * Bacteriochlorophyll-C * Chlorobium-Tepidum Subject RIV: CE - Biochemistry Impact factor: 10.677, year: 2012
Czech Academy of Sciences Publication Activity Database
Furumaki, S.; Vácha, František; Habuchi, S.; Tsukatani, Y.; Bryant, D.A.; Vácha, M.
2011-01-01
Roč. 133, č. 17 (2011), s. 6703-6710 ISSN 0002-7863 R&D Projects: GA ČR GA206/09/0375 Institutional research plan: CEZ:AV0Z50510513 Keywords : CHLOROBIUM-TEPIDUM * BACTERIOCHLOROPHYLL-C * SUPRAMOLECULAR ORGANIZATION Subject RIV: EF - Botanics Impact factor: 9.907, year: 2011
... to produce gas. Often, relatively simple changes in eating habits can lessen bothersome gas. Certain digestive system disorders, ... such as soda and beer, increase stomach gas. Eating habits, such as eating too quickly, drinking through a ...
Gas, gas, gas... discoveries and developments booming worldwide
International Nuclear Information System (INIS)
Maxwell, F.
2000-01-01
Deep water exploration is yielding more than billion barrel oil fields. Unocal's 3 May discovery of 2-3 Tcf of gas in its Kutei block of Indonesia marks the first major discovery of natural gas in the deep water frontier: Wildcats Gula and Gada were drilled in over 1800 m of water as part of an aggressive search for gas instigated by Unocal last year. The author makes a survey of gas exploration and development throughout the world. (author)
Requirements for gas quality and gas appliances
Levinsky, Howard; Gersen, Sander; Kiewiet, Bert
2015-01-01
Introduction The gas transmission network in the Netherlands transports two different qualities of gas, low-calorific gas known as G-gas or L-gas and, high calorific gas (H-gas). These two gas qualities are transported in separate networks, and are connected by means of five blending and conversion
A comparative study of gas-gas miscibility processes in underground gas storage reservoirs
Energy Technology Data Exchange (ETDEWEB)
Rafiee, M.M.; Schmitz, S. [DBI - Gastechnologisches Institut gGmbH, Freiberg (Germany)
2013-08-01
Intermixture of gases in underground gas reservoirs have had great weight for natural gas storage in UGS projects with substitution of cushion gas by inert gases or changing the stored gas quality or origin, as for the replacement of town gas by natural gas. It was also investigated during the last years for Enhanced Gas Recovery (EGR) and Carbon Capture and Storage (CCS) projects. The actual importance of its mechanisms is discussed for the H{sub 2} storage in Power to Gas to Power projects (PGP). In these approaches miscibility of the injected gas with the gas in place in the reservoir plays an important role in the displacement process. The conditions and parameters for the gas-gas displacement and mixing have been investigated in previous projects, as e.g. the miscibility of CO{sub 2} with natural gas (CLEAN). Furthermore the miscibility process of town gas with natural gas and sauer gas with sweet gas were also previously measured and compared in laboratory. The objective of this work is to investigate the miscibility of H{sub 2} injection into natural gas reservoirs using a compositional and a black oil reservoir simulator. Three processes of convection, dispersion and diffusion are considered precisely. The effect of gas miscibility is studied for both simulators and the results are compared to find optimum miscibility parameters. The findings of this work could be helpful for further pilot and field case studies to predict and monitor the changes in gas composition and quality. In future this monitoring might become more important when PGP together with H{sub 2}-UGS, as storage technology, will help to successfully implement the change to an energy supply from more renewable sources. Similarly the method confirms the use of the black oil simulator as an alternative for gas-gas displacement and sequestration reservoir simulation in comparison to the compositional simulator. (orig.)
British Gas plans global gas unit expansion
International Nuclear Information System (INIS)
Vielvoye, R.
1991-01-01
This paper reports on developing a global gas business, a British Gas plc's strategy for evolving a state owned U.K. gas company to a privatized worldwide oil and gas giant. By 2000, BG's global gas business is expected to provide 20% of its revenues, compared with 40% each from its exploration and production operations and its U.K. gas business. The global gas unit (GGU) plans to meet its targets mainly through acquiring holdings in gas transmission and distribution companies around the world. In the 12 months since GGU was established, it has made two such major acquisitions in this area. BG acquired Consumers Gas Co., Ltd., Ontario, Canada's biggest natural gas distribution company, for $943.5 million. It also took a 10% stake in Catalana de Gas SA, Barcelona, the largest privately owned gas utility in Spain and in terms of number of customers, the fourth largest in western Europe. BG also is targeting additional revenues from developing gas fired cogeneration systems in developing countries with gas reserves but no established transmission and distribution systems
Life-cycle greenhouse gas emissions of shale gas, natural gas, coal, and petroleum.
Burnham, Andrew; Han, Jeongwoo; Clark, Corrie E; Wang, Michael; Dunn, Jennifer B; Palou-Rivera, Ignasi
2012-01-17
The technologies and practices that have enabled the recent boom in shale gas production have also brought attention to the environmental impacts of its use. It has been debated whether the fugitive methane emissions during natural gas production and transmission outweigh the lower carbon dioxide emissions during combustion when compared to coal and petroleum. Using the current state of knowledge of methane emissions from shale gas, conventional natural gas, coal, and petroleum, we estimated up-to-date life-cycle greenhouse gas emissions. In addition, we developed distribution functions for key parameters in each pathway to examine uncertainty and identify data gaps such as methane emissions from shale gas well completions and conventional natural gas liquid unloadings that need to be further addressed. Our base case results show that shale gas life-cycle emissions are 6% lower than conventional natural gas, 23% lower than gasoline, and 33% lower than coal. However, the range in values for shale and conventional gas overlap, so there is a statistical uncertainty whether shale gas emissions are indeed lower than conventional gas. Moreover, this life-cycle analysis, among other work in this area, provides insight on critical stages that the natural gas industry and government agencies can work together on to reduce the greenhouse gas footprint of natural gas.
Origin of natural gas; Tennen gas no kigen
Energy Technology Data Exchange (ETDEWEB)
Katayama, Y. [The Institute of Applied Energy, Tokyo (Japan)
1996-03-20
Natural gas, which is a general term of flammable hydrocarbon gases such as methane, is classified by origin into the following categories : (1) oil field gas (oil gas), (2) aquifers (bacteria-fermented methane), (3) coal gas (coal field gas), and (4) abiogenetic gas. The natural gas which has (1-4) origins and is now used as resource in a large quantity is (1) oil field gas. This gas is a hydrocarbon gas recovered in the production process of petroleum and contains components such as ethane, propane and butane. To the contrary, (2) aquifers and (3) coal gas have methane as main component. As (4) abiogenetic methane, there are gas formed in inorganic reaction in activities of submarine volcanos and deep gas (earth origin gas). Oil field gas has kerogen origin. Aquifers were formed by fermentation of organic matters. Coal gas was formed by coalification of vitrinite. As abiogenetic methane, there are inorganic reaction formation gas and deep gas, the latter of which exists little as resource. 7 refs., 11 figs., 1 tab.
International Nuclear Information System (INIS)
2003-01-01
This symposium provided an opportunity for participants to learn from gas industry leaders in both Canada and the United States, different strategies to cost-effectively develop unconventional gas resources. In particular, the representative from EnCana Corporation discussed the results of tight gas drilling in Northeastern British Columbia. The speaker for MGV Energy reported on the outcome of test drilling for coalbed methane (CBM) in Southern Alberta. The economic development of tight gas reservoirs in the United States Permian Basin was discussed by the speaker representing BP America Production Company. The role of unconventional gas in the North American natural gas supply and demand picture was dealt with by TransCanada PipeLines Limited and Canadian Gas Potential Committee. The trend for natural gas prices in North America was examined by Conoco Inc. The Geological Survey of Canada addressed the issue of gas hydrate potential in the Mackenzie Delta Mallik Field. In addition, one presentation by El Paso Production Company discussed the successful drilling for deep, tight gas and CBM in the United States. There were nine presentations at this symposium, of which three were indexed separately for inclusion in this database. refs., tabs., figs
Gas-on-gas competition in Shanghai
International Nuclear Information System (INIS)
Manuhutu, Chassty; Owen, Anthony D.
2010-01-01
In common with other major economic centres in China, Shanghai's energy consumption has been increasing rapidly to support the high growth rate of its economy. To achieve rational, efficient and clean use of energy, together with improved environmental quality within the city, the Shanghai municipal government has decided to expand the supply and utilization of natural gas. Shanghai plans to increase the share of natural gas in its primary energy mix to 7 per cent by 2010, up from 3 per cent in 2005. This increase in natural gas demand has to be matched with a corresponding increase in supply. To date, the Shanghai region has relied on offshore extracted natural gas but this supply is limited due to the size of the reserves. Since 2005, the West-East pipeline has provided an alternative for Shanghai but demands from other regions could reduce the potential for expanding supplies from that source. Since domestic production will not be sufficient to meet demand in the near future, Shanghai is building a liquefied natural gas (LNG) regasification terminal at the Yangshan deep-water port that would allow an additional supply of more than 3 billion cubic meters per year of natural gas. Malaysia has already committed to supply LNG to the Shanghai terminal at a price that is significantly higher than the wholesale 'city-gate' price for natural gas transported via pipeline, but still lower than the gas price to end-use consumers. The presence of both an LNG terminal and a transmission pipeline that connects Shanghai to domestic gas-producing regions will create gas-on-gas competition. This study assesses the benefits of introducing such competition to one of China's most advanced cities under various scenarios for demand growth. In this paper, the impact of imported LNG on market concentration in Shanghai's gas market will be analysed using the Herfindahl-Hirschmann index (HHI) and the residual supply index (RSI). Our results show that Shanghai remains a supply
Reducing the greenhouse gas footprint of shale gas
International Nuclear Information System (INIS)
Wang Jinsheng; Ryan, David; Anthony, Edward J.
2011-01-01
Shale gas is viewed by many as a global energy game-changer. However, serious concerns exist that shale gas generates more greenhouse gas emissions than does coal. In this work the related published data are reviewed and a reassessment is made. It is shown that the greenhouse gas effect of shale gas is less than that of coal over long term if the higher power generation efficiency of shale gas is taken into account. In short term, the greenhouse gas effect of shale gas can be lowered to the level of that of coal if methane emissions are kept low using existing technologies. Further reducing the greenhouse gas effect of shale gas by storing CO 2 in depleted shale gas reservoirs is also discussed, with the conclusion that more CO 2 than the equivalent CO 2 emitted by the extracted shale gas could be stored in the reservoirs at significantly reduced cost. - Highlights: ► The long-term greenhouse gas footprint of shale gas is smaller than that of coal. ► Carbon capture and storage should be considered for fossil fuels including shale gas. ► Depleted shale gas fields could store more CO 2 than the equivalent emissions. ► Linking shale gas development with CO 2 storage could largely reduce the total cost.
Union Gas and Ontario gas production
International Nuclear Information System (INIS)
Cameron, C.
2001-01-01
A step-by-step review of the tie-in process of new production wells into the Union Gas System is described. Requirements of the producer and those of Union Gas are explained. Also described are the choices available to the producer to sell his gas. He can sell either to Union Gas directly at an agreed upon price, or the producer has the option to have what is called an M13 contract which allows him to sell his gas at Dawn, where it can be stored within parameters of the contract, and sold to any buyer at Dawn at a negotiated rate. This arrangement, while entailing a much greater administrative load than direct sale to Union Gas, nevertheless, allows the producer to take advantage of market fluctuations. A third option provided by Union Gas is to make available to the producer storage space greater than the provisions of the M13 contract at current market rate, thereby opening up the opportunity to the producer to capture additional value in later winter months (when gas is in greater demand)
Shale gas. Shale gas formation and extraction
International Nuclear Information System (INIS)
Renard, Francois; Artru, Philippe
2015-10-01
A first article recalls the origin of shale gases and technological breakthroughs which allowed their exploitation, describes the development of shale gas exploitation in the USA during the 2000's and the consequences for the gas and electricity markets, and discusses the various environmental impacts (risks of pollution of aquifers, risks of induced seismicity, use and processing of drilling and production waters). The second article describes the formation of shale gas: presence of organic matter in sediments, early evolution with the biogenic gas, burrowing, diagenesis and oil formation, thermal generation of gas (condensates and methane). The author indicates the location of gas within the rock, and the main sites of shale oils and shale gases in the World. In the next part, the author describes the various phases of shale gas extraction: exploration, oriented drillings, well preparation for hydraulic fracturing, fracturing, processing of fracturing fluids, flow-back, gas production and transport, aquifer protection. He finally gives a brief overview of technical evolution and of shale gas economy
Gas-ion laser with gas pressure maintenance means
International Nuclear Information System (INIS)
Thatcher, J.B.
1975-01-01
A gas-ion laser is described including means to maintain the ionizable gas in the laser cavity at a rather constant pressure over an extended period of time to significantly increase the useful life of the gas-ion laser. The gas laser includes a gas makeup system having a high pressure source or storage container and a regulating valve. The valve has a permeable solid state orifice member through which the gas flows from the high pressure source to the laser cavity to replenish the gas in the laser cavity and maintain the gas pressure in the cavity rather constant. The permeable orifice member is selected from a solid state material having a permeability that is variable in relation to the magnitude of the energy applied to the orifice member. The gas-ion laser has a valve operating means such as a heater for varying the applied energy such as thermal energy to the member to regulate the gas flow. Additionally, the gas-ion laser has a valve control means that is responsive to the gas pressure in the laser cavity for controlling the valve control means to maintain the pressure at a desired level. (U.S.)
Green gas. Gas of natural gas quality from biomass. Update of the 2004 study
International Nuclear Information System (INIS)
Welink, Jan-Henk; Dumont, M.; Kwant, K.
2007-01-01
In 2004 a study was published on green gas. Green gas is defined as a gaseous energy carrier from renewable biomass with a similar quality as natural gas. As a result of new developments in the field of co-digestion/fermentation the Dutch Ministry of Economic Affairs asked it's agency SenterNovem to update the 2004 study. The aim of the update is (1) to gain insight into operational aspects of green gas projects, e.g. reliability, efficiency and maintenance aspects; (2) stimulate the production of green gas, taking into account the economics of green gas projects, calculation of the financial gap of green gas production, efficient use of biogas (conversion to electricity or directly input into the natural gas distribution systems, and aspects with regard to commercialization and the market; and (3) the potential of green gas [nl
International Nuclear Information System (INIS)
Yang, Ok Ryong
2004-01-01
This book introduces gas turbine cycle explaining general thing of gas turbine, full gas turbine cycle, Ericson cycle and Brayton cycle, practical gas turbine cycle without pressure loss, multiaxial type gas turbine cycle and special gas turbine cycle, application of basic theory on a study on suction-cooling gas turbine cycle with turbo-refrigerating machine using the bleed air, and general performance characteristics of the suction-cooling gas turbine cycle combined with absorption-type refrigerating machine.
Gas-controlled dynamic vacuum insulation with gas gate
Benson, D.K.; Potter, T.F.
1994-06-07
Disclosed is a dynamic vacuum insulation comprising sidewalls enclosing an evacuated chamber and gas control means for releasing hydrogen gas into a chamber to increase gas molecule conduction of heat across the chamber and retrieving hydrogen gas from the chamber. The gas control means includes a metal hydride that absorbs and retains hydrogen gas at cooler temperatures and releases hydrogen gas at hotter temperatures; a hydride heating means for selectively heating the metal hydride to temperatures high enough to release hydrogen gas from the metal hydride; and gate means positioned between the metal hydride and the chamber for selectively allowing hydrogen to flow or not to flow between said metal hydride and said chamber. 25 figs.
Acid Gas Removal from Natural Gas with Alkanolamines
DEFF Research Database (Denmark)
Sadegh, Negar
commercially for the removal of acid gas impurities from natural gas. Alkanolamines, simple combinations of alcohols and ammonia, are the most commonly used category of chemical solvents for acid gas capture. This Ph.D. project is aboutthermodynamics of natural gas cleaning process with alkanolamines......Some 40 % of the world’s remaining gas reserves are sour or acid, containing large quantities of CO2 and H2S and other sulfur compounds. Many large oil and gas fields have more than 10 mole % CO2 and H2S content. In the gas processing industry absorption with chemical solvents has been used...... pressure on acid gas solubility was also quantitatively investigated through both experimental and modeling approaches....
Life-cycle analysis of shale gas and natural gas.
Energy Technology Data Exchange (ETDEWEB)
Clark, C.E.; Han, J.; Burnham, A.; Dunn, J.B.; Wang, M. (Energy Systems); ( EVS)
2012-01-27
The technologies and practices that have enabled the recent boom in shale gas production have also brought attention to the environmental impacts of its use. Using the current state of knowledge of the recovery, processing, and distribution of shale gas and conventional natural gas, we have estimated up-to-date, life-cycle greenhouse gas emissions. In addition, we have developed distribution functions for key parameters in each pathway to examine uncertainty and identify data gaps - such as methane emissions from shale gas well completions and conventional natural gas liquid unloadings - that need to be addressed further. Our base case results show that shale gas life-cycle emissions are 6% lower than those of conventional natural gas. However, the range in values for shale and conventional gas overlap, so there is a statistical uncertainty regarding whether shale gas emissions are indeed lower than conventional gas emissions. This life-cycle analysis provides insight into the critical stages in the natural gas industry where emissions occur and where opportunities exist to reduce the greenhouse gas footprint of natural gas.
Identification of a fourth family of lycopene cyclases in photosynthetic bacteria
Maresca, Julia A.; Graham, Joel E.; Wu, Martin; Eisen, Jonathan A.; Bryant, Donald A.
2007-01-01
A fourth and large family of lycopene cyclases was identified in photosynthetic prokaryotes. The first member of this family, encoded by the cruA gene of the green sulfur bacterium Chlorobium tepidum, was identified in a complementation assay with a lycopene-producing strain of Escherichia coli. Orthologs of cruA are found in all available green sulfur bacterial genomes and in all cyanobacterial genomes that lack genes encoding CrtL- or CrtY-type lycopene cyclases. The cyanobacterium Synechoc...
2010-07-21
... Natural Gas Company, Southern Natural Gas Company, Florida Gas Transmission Company, LLC, Transcontinental... abandonment of facilities by Northern Natural Gas Company, Southern Natural Gas Company, Florida Gas... resources, fisheries, and wetlands; Cultural resources; Vegetation and wildlife; Endangered and threatened...
Natural gas is more than gas power plants
International Nuclear Information System (INIS)
Lind, Oddvar
2000-01-01
Through the Statpipe gas line at Karmoey, Norway supplies 20% of the natural gas on the European market. The pipeline is 'leaking' a little bit of gas to the local communities at Karmoey and Haugesund. These communities have replaced 65% of their oil consumption with natural gas, which is a fine contribution to a better environment. The supplier of the natural gas, Gasnor ASA in this case, claims an energy efficiency of 90% at the end user because the gas burns directly and the loss in the pipeline is minimal. The efficiency of natural gas utilisation is twice that of the planned gas power stations in West-Norway, subtracting the losses in the electrical network. Gasnor ASA competes with oil suppliers and, if necessary, with electric utilities. The county hospital at Haugesund is quoted as an example. The hospital has two large boilers with dual fuel burners. They have been using natural gas since 1998 because it was worth while both economically and environmentally. The use of natural gas in the transport sector would be very important, but the necessary infrastructure is very little developed. For instance, five diesel-powered ferries on the Boknafjord emit as much NOx as the planned gas power plant at Kaarstoe
Alaska gas pipeline and the global natural gas market
International Nuclear Information System (INIS)
Slutz, J.
2006-01-01
The global natural gas market was discussed in relation to the Alaska natural gas pipeline project. Natural gas supply forecasts to the year 2025 were presented. Details of the global liquefied natural gas (LNG) market were discussed. Charts were included for United States natural gas production, consumption, and net imports up to the year 2030. The impact of high natural gas prices on the manufacturing sector and the chemicals industry, agricultural, and ethanol industries were discussed. Natural gas costs around the world were also reviewed. The LNG global market was discussed. A chart of world gas reserves was presented, and global LNG facilities were outlined. Issues related to the globalization of the natural gas trade were discussed. Natural gas imports and exports in the global natural gas market were reviewed. A chart of historical annual United States annual LNG imports was presented. tabs., figs
Green gas in the natural gas network
International Nuclear Information System (INIS)
Bruinsma, B.
2007-09-01
The aim of this study is to map the technical, economic and organizational options and limitations of feeding biogas back into the natural gas grid by means of regional co-digestion. Emphasis is put on feeding back into the natural gas grid, analogous to a comparable situation in a number of landfill gas projects. This report first provides insight into the energetic potential of co-digestion. Next several landfill gas projects are examined that feed back into the natural gas grid. After that the political and policy-related issues and preconditions for feeding back biogas from co-digestion are discussed, including the technical and economic aspects. Finally, a picture is painted of the future potential of green gas. [mk] [nl
Role of stranded gas in increasing global gas supplies
Attanasi, E.D.; Freeman, P.A.
2013-01-01
This report synthesizes the findings of three regional studies in order to evaluate, at the global scale, the contribution that stranded gas resources can make to global natural gas supplies. Stranded gas, as defined for this study, is natural gas in discovered conventional gas and oil fields that is currently not commercially producible for either physical or economic reasons. The regional studies evaluated the cost of bringing the large volumes of undeveloped gas in stranded gas fields to selected markets. In particular, stranded gas fields of selected Atlantic Basin countries, north Africa, Russia, and central Asia are screened to determine whether the volumes are sufficient to meet Europe’s increasing demand for gas imports. Stranded gas fields in Russia, central Asia, Southeast Asia, and Australia are also screened to estimate development, production, and transport costs and corresponding gas volumes that could be supplied to Asian markets in China, India, Japan, and South Korea. The data and cost analysis presented here suggest that for the European market and the markets examined in Asia, the development of stranded gas provides a way to meet projected gas import demands for the 2020-to-2040 period. Although this is a reconnaissance-type appraisal, it is based on volumes of gas that are associated with individual identified fields. Individual field data were carefully examined. Some fields were not evaluated because current technology was insufficient or it appeared the gas was likely to be held off the export market. Most of the evaluated stranded gas can be produced and delivered to markets at costs comparable to historical prices. Moreover, the associated volumes of gas are sufficient to provide an interim supply while additional technologies are developed to unlock gas diffused in shale and hydrates or while countries transition to making a greater use of renewable energy sources.
Assessment of greenhouse gas emissions from natural gas
International Nuclear Information System (INIS)
Anon
2000-01-01
The study, 'Assesment of greenhouse gas emission from natural gas' by independent consultants Energetics Pty Ltd, shows that natural gas has significantly fewer greenhouses gas emissions than either black or brown cola for the defined life cycle stages. The life cycle emissions from natural gas use by an Australian Major User are approximately 50% less than the emissions from Victorian brown coal and approximately 38% less than the emissions from Australian average black coal. Australian Best Practice gas fired electricity generation is estimated to emit between 514 and 658 kg CO 2 e/MWh. By comparison, Australian Best Practice coal-fired electricity generation is estimated to emit between 907 and 1,246 kg CO 2 e/MWh for black and brown coal respectively. Greenhouse gas emissions from Australian Best Practice gas-fired electricity generation using combined cycle gas turbines (including full fuel cycle emissions) vary from 41% to 46% of the emissions from brown coal-fired electricity generation and 57% to 64% of emissions from black coal-fired electricity generation. Greenhouse gas emissions from direct gas supply water heating range from 1,470 to 2,042 kilograms per annum. This compares with emissions of 1,922 to 2,499 kg for electric heating from gas-fired electricity generation and 3,975 to 5,393 kg for coal-fired electricity generation. The implications for greenhouse policy nationally are also discussed, emphasising the need to review national energy policy, currently tied to 'fuel neutrality' doctrine
Luebke, Ryan
2015-01-22
A gas sensor using a metal organic framework material can be fully integrated with related circuitry on a single substrate. In an on-chip application, the gas sensor can result in an area-efficient fully integrated gas sensor solution. In one aspect, a gas sensor can include a first gas sensing region including a first pair of electrodes, and a first gas sensitive material proximate to the first pair of electrodes, wherein the first gas sensitive material includes a first metal organic framework material.
Luebke, Ryan; Eddaoudi, Mohamed; Omran, Hesham; Belmabkhout, Youssef; Shekhah, Osama; Salama, Khaled N.
2015-01-01
A gas sensor using a metal organic framework material can be fully integrated with related circuitry on a single substrate. In an on-chip application, the gas sensor can result in an area-efficient fully integrated gas sensor solution. In one aspect, a gas sensor can include a first gas sensing region including a first pair of electrodes, and a first gas sensitive material proximate to the first pair of electrodes, wherein the first gas sensitive material includes a first metal organic framework material.
A Gas Chromatographic System for the Detection of Ethylene Gas Using Ambient Air as a Carrier Gas.
Zaidi, Nayyer Abbas; Tahir, Muhammad Waseem; Vellekoop, Michael J; Lang, Walter
2017-10-07
Ethylene gas is a naturally occurring gas that has an influence on the shelf life of fruit during their transportation in cargo ships. An unintentional exposure of ethylene gas during transportation results in a loss of fruit. A gas chromatographic system is presented here for the detection of ethylene gas. The gas chromatographic system was assembled using a preconcentrator, a printed 3D printed gas chromatographic column, a humidity sensor, solenoid valves, and an electrochemical ethylene gas sensor. Ambient air was used as a carrier gas in the gas chromatographic system. The flow rate was fixed to 10 sccm. It was generated through a mini-pump connected in series with a mass flow controller. The metal oxide gas sensor is discussed with its limitation in ambient air. The results show the chromatogram obtained from metal oxide gas sensor has low stability, drifts, and has uncertain peaks, while the chromatogram from the electrochemical sensor is stable and precise. Furthermore, ethylene gas measurements at higher ppb concentration and at lower ppb concentration were demonstrated with the electrochemical ethylene gas sensor. The system separates ethylene gas and humidity. The chromatograms obtained from the system are stable, and the results are 1.2% repeatable in five similar measurements. The statistical calculation of the gas chromatographic system shows that a concentration of 2.3 ppb of ethylene gas can be detected through this system.
Gas exploitation and gas conversion; Gassutnyttelse og gasskonvertering
Energy Technology Data Exchange (ETDEWEB)
Laading, Gjert
1998-07-01
This presentation deals with some of the challenges and possibilities connected with ''stranded'' gas. These are offshore gas reserves, especially associated gas, that is not connected with the market and that cannot be piped onshore, and where reinjection is not profitable, and where flaring off is not an option. There is increasing interest all over the world to find economical and environmentally friendly solutions to this problem. A good solution will render such fields economically developable and will to a high degree increase the total volume of the world's exploitable gas reserves. Since synthesis gas is a dominating cost element in most chemical conversion processes for gas, the synthesis gases are discussed in some detail. There is also a discussion of the conversion of the gas to Methanol, Synthetic oil (Syncrude and Synfuels) and to DME (Di-methyl-ether). Two methods for gas transport from the field are discussed; LNG on floating production storage and off loading (FPSO), and Gas hydrates. Principles, limitations and conditions for placing those processes on a FPSO. Finally, the presentation discusses the most important economic factors related to the exploitation of offshore gas, and suggests some possibilities for future development.11 figs.
Feasibility of flare gas reformation to practical energy in Farashband gas refinery: no gas flaring.
Rahimpour, Mohammad Reaza; Jokar, Seyyed Mohammad
2012-03-30
A suggested method for controlling the level of hazardous materials in the atmosphere is prevention of combustion in flare. In this work, three methods are proposed to recover flare gas instead of conventional gas-burning in flare at the Farashband gas refinery. These methods aim to minimize environmental and economical disadvantages of burning flare gas. The proposed methods are: (1) gas to liquid (GTL) production, (2) electricity generation with a gas turbine and, (3) compression and injection into the refinery pipelines. To find the most suitable method, the refinery units that send gas to the flare as well as the required equipment for the three aforementioned methods are simulated. These simulations determine the amount of flare gas, the number of GTL barrels, the power generated by the gas turbine and the required compression horsepower. The results of simulation show that 563 barrels/day of valuable GTL products is produced by the first method. The second method provides 25 MW electricity and the third method provides a compressed natural gas with 129 bar pressure for injection to the refinery pipelines. In addition, the economics of flare gas recovery methods are studied and compared. The results show that for the 4.176MMSCFD of gas flared from the Farashband gas refinery, the electricity production gives the highest rate of return (ROR), the lowest payback period, the highest annual profit and mild capital investment. Therefore, the electricity production is the superior method economically. Copyright © 2012 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Welink, Jan-Henk; Dumont, M.; Kwant, K. Datum januari 2007
2007-01-15
In 2004 a study was published on green gas. Green gas is defined as a gaseous energy carrier from renewable biomass with a similar quality as natural gas. As a result of new developments in the field of co-digestion/fermentation the Dutch Ministry of Economic Affairs asked it's agency SenterNovem to update the 2004 study. The aim of the update is (1) to gain insight into operational aspects of green gas projects, e.g. reliability, efficiency and maintenance aspects; (2) stimulate the production of green gas, taking into account the economics of green gas projects, calculation of the financial gap of green gas production, efficient use of biogas (conversion to electricity or directly input into the natural gas distribution systems, and aspects with regard to commercialization and the market; and (3) the potential of green gas. [Dutch] De laatste jaren wordt er gewerkt aan initiatieven om groen gas te produceren. Een recent initiatief is het opwaarderen van biogas tot aardgaskwaliteit door Biogast, wat er toe zal leiden dat al deze zomer Eneco op kleinschalig niveau duurzaam gas levert aan eindverbruikers. Het potentieel aan groen gas dat mogelijk gemaakt zou kunnen worden, is de laatste jaren ook veranderd. Met name de voorspoedige ontwikkelingen op het gebied van co-vergisting met mest zorgen voor een toename van het potentieel. In 2004 is een studie gemaakt over groen gas. Vanwege de voorspoedige ontwikkelingen op het gebied van co-vergisting is de situatie die gold voor het rapport uit 2004 veranderd. Het ministerie van Economische Zaken heeft SenterNovem gevraagd om een update te maken van de studie over groen gas uit 2004. De doelstelling van de update van deze studie Groen Gas is (1) het verkrijgen van inzicht op basis van de huidige ontwikkelingen, in: de bedrijfstechnische aspecten van dergelijke projecten, zoals betrouwbaarheid, rendement en onderhoudsaspecten; (2) aspecten voor het mogelijk stimuleren van de productie van groen gas. Hierbij hoort: (a
US crude oil, natural gas, and natural gas liquids reserves
International Nuclear Information System (INIS)
1992-01-01
This report presents estimates of proved reserves of crude oil, natural gas, and natural gas liquids as of December 31, 1991, as well as production volumes for the United States, and selected States and State subdivisions for the year 1991. Estimates are presented for the following four categories of natural gas: total gas (wet after lease separation), its two major components (nonassociated and associated-dissolved gas), and total dry gas (wet gas adjusted for the removal of liquids at natural gas processing plants). In addition, two components of natural gas liquids, lease condensate and natural gas plant liquids, have their reserves and production data presented. Also included is information on indicated additional crude oil reserves and crude oil, natural gas, and lease condensate reserves in nonproducing reservoirs. A discussion of notable oil and gas exploration and development activities during 1991 is also presented
2010-03-22
... Natural Gas Company, Southern Natural Gas Company, Florida Gas Transmission Company, LLC, Transcontinental... notice that on March 5, 2010, Northern Natural Gas Company (Northern Natural), 1111 South 103rd Street, Omaha, Nebraska 68124- 1000, filed on behalf of itself and other owners, Southern Natural Gas Company...
Safety regulation on high-pressure gas and gas business
International Nuclear Information System (INIS)
Kim, Du Yeoung; An, Dae Jun
1978-09-01
This book is divided into two parts. The first part introduces safety regulation on high-pressure gas, enforcement ordinance on safety regulation about high-pressure gas and enforcement regulation on safety regulation about high-pressure gas. The second part indicates regulations on gas business such as general rules, gas business gas supplies, using land, supervision, supple mentary rules and penalty. It has two appendixes on expected questions and questions during last years.
Energy Technology Data Exchange (ETDEWEB)
Fraser, J W
1967-08-01
This report on the natural gas industry of Canada includes: composition and uses of natural gas, production statistics, exploration and development, reserve estimates, natural gas processing, transportation, and marketing. For the Canadian natural gas industry, 1966 was a year of moderate expansion in all phases, with a strong demand continuing for sulfur and liquid hydrocarbons produced as by-products of gas processing. Value of natural gas production increased to $199 million and ranked sixth in terms of value of mineral ouput in Canada. Currently, natural gas provides over 70% of Canada's energy requirements. Proved remaining marketable reserves are estimated to be in excess of a 29-yr supply.
Energy Technology Data Exchange (ETDEWEB)
Dumont, M.
2012-07-15
Early 2010, the interdepartmental Accelerator Team Green Gas was established which deals with policy issues in the field of Green Gas. This working document reflects the current state of affairs. Via the website www.groengas.nl new versions will be made available on a regular basis [Dutch] Begin 2010 is het interdepartementale Versnellerteam Groen Gas opgericht dat zich bezighoudt met vraagstukken op het gebied van Groen Gas die op het terrein van de rijksoverheid liggen. Dit werkdocument geeft de huidige stand van zaken weer. Via www.groengas.nl komen geregeld nieuwe versies beschikbaar.
Improved gas mixtures for gas-filled particle detectors
Christophorou, L.G.; McCorkle, D.L.; Maxey, D.V.; Carter, J.G.
Improved binary and tertiary gas mixture for gas-filled particle detectors are provided. The components are chosen on the basis of the principle that the first component is one gas or mixture of two gases having a large electron scattering cross section at energies of about 0.5 eV and higher, and the second component is a gas (Ar) having a very small cross section at and below about 0.5 eV; whereby fast electrons in the gaseous mixture are slowed into the energy range of about 0.5 eV where the cross section for the mixture is small and hence the electron mean free path is large. The reduction in both the cross section and the electron energy results in an increase in the drift velocity of the electrons in the gas mixtures over that for the separate components for a range of E/P (pressure-reduced electron field) values. Several gas mixtures are provided that provide faster response in gas-filled detectors for convenient E/P ranges as compared with conventional gas mixtures.
Rio Vista gas leak study: Belleaire Gas Field, California
International Nuclear Information System (INIS)
Wilkey, P.L.
1992-08-01
The Rio Vista gas leak study evaluated methods for remotely sensing gas leaks from buried pipelines and developed methods to elucidate methane transport and microbial oxidation in soils. Remote-sensing methods were evaluated by singing gas leaks along an abandoned Pacific Gas and Electric (PG ampersand E) gas field collection line in northern California and applying surface-based and airborne remote-sensing techniques in the field, including thermal imaging, laser imaging, and multispectral imagery. The remote-sensing techniques exhibited limitations in range and in their ability to correlate with ground truth data. To elucidate methane transport and microbial oxidation in soils, a study of a controlled leak permitted field testing of methods so that such processes could be monitored and evaluated. Monitoring and evaluation techniques included (1) field measurement of soil-gas concentrations, temperatures, and pressures; (2) laboratory measurement of soil physical/chemical properties and activity of methane-oxidizing microorganisms by means of field samples; and (3) development of a preliminary numerical analysis technique for combined soil-gas transport/methane oxidation. Soil-gas concentrations at various depths responded rapidly to the high rate of gas leakage. The number of methane-oxidizing microorganisms in site soils rapidly increased when the gas leak was initiated and decreased after the leak was terminated. The preliminary field, laboratory, and numerical analysis techniques tested for this study of a controlled gas leak could be successfully applied to future studies of gas leaks. Because soil-gas movement is rapid and temporally variable, the use of several complementary techniques that permit generalization of site-specific results is favored
Gas Hydrate Storage of Natural Gas
Energy Technology Data Exchange (ETDEWEB)
Rudy Rogers; John Etheridge
2006-03-31
Environmental and economic benefits could accrue from a safe, above-ground, natural-gas storage process allowing electric power plants to utilize natural gas for peak load demands; numerous other applications of a gas storage process exist. A laboratory study conducted in 1999 to determine the feasibility of a gas-hydrates storage process looked promising. The subsequent scale-up of the process was designed to preserve important features of the laboratory apparatus: (1) symmetry of hydrate accumulation, (2) favorable surface area to volume ratio, (3) heat exchanger surfaces serving as hydrate adsorption surfaces, (4) refrigeration system to remove heat liberated from bulk hydrate formation, (5) rapid hydrate formation in a non-stirred system, (6) hydrate self-packing, and (7) heat-exchanger/adsorption plates serving dual purposes to add or extract energy for hydrate formation or decomposition. The hydrate formation/storage/decomposition Proof-of-Concept (POC) pressure vessel and supporting equipment were designed, constructed, and tested. This final report details the design of the scaled POC gas-hydrate storage process, some comments on its fabrication and installation, checkout of the equipment, procedures for conducting the experimental tests, and the test results. The design, construction, and installation of the equipment were on budget target, as was the tests that were subsequently conducted. The budget proposed was met. The primary goal of storing 5000-scf of natural gas in the gas hydrates was exceeded in the final test, as 5289-scf of gas storage was achieved in 54.33 hours. After this 54.33-hour period, as pressure in the formation vessel declined, additional gas went into the hydrates until equilibrium pressure/temperature was reached, so that ultimately more than the 5289-scf storage was achieved. The time required to store the 5000-scf (48.1 hours of operating time) was longer than designed. The lower gas hydrate formation rate is attributed to a
Wilding, Bruce M; Turner, Terry D
2014-12-02
A method of natural gas liquefaction may include cooling a gaseous NG process stream to form a liquid NG process stream. The method may further include directing the first tail gas stream out of a plant at a first pressure and directing a second tail gas stream out of the plant at a second pressure. An additional method of natural gas liquefaction may include separating CO.sub.2 from a liquid NG process stream and processing the CO.sub.2 to provide a CO.sub.2 product stream. Another method of natural gas liquefaction may include combining a marginal gaseous NG process stream with a secondary substantially pure NG stream to provide an improved gaseous NG process stream. Additionally, a NG liquefaction plant may include a first tail gas outlet, and at least a second tail gas outlet, the at least a second tail gas outlet separate from the first tail gas outlet.
The UK and British Gas: Any future for Norwegian gas
International Nuclear Information System (INIS)
Jungles, P.
1996-01-01
The paper deals with the UK natural gas market and the future for Norwegian gas in the UK. The role of the British Gas in the domestic and European markets is discussed. Topics are: The UK gas supply market; the UK upstream gas market and the Interconnector; the European market, competition and deregulation; the prospects for Norwegian gas
Gas migration from oil and gas fields and associated hazards
International Nuclear Information System (INIS)
Gurevich, A.E.; Endres, B.L.; Robertson Jr, J.O.; Chilingar, G.V.
1993-01-01
The migration of gas from oil and gas formations to the surface is a problem that greatly affects those surface areas where human activity exists. Underground gas storage facilities and oil fields have demonstrated a long history of gas migration problems. Experience has shown that the migration of gas to the surface creates a serious potential risk of explosion, fires, noxious odors and potential emissions of carcinogenic chemicals. These risks must be seriously examined for all oil and gas operations located in urban areas. This paper presents the mechanics of gas migration, paths of migration and a review of a few of the risks that should be considered when operating a gas facility in an urban area. The gas can migrate in a continuous or discontinuous stream through porous, water-filled media to the surface. The primary force in this migration of gas is the difference between specific weights of gas and water
Hot fuel gas dedusting after sorbent-based gas cleaning
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-07-01
Advanced power generation technologies, such as Air Blown Gasification Cycle (ABGC), require gas cleaning at high temperatures in order to meet environmental standards and to achieve high thermal efficiencies. The primary hot gas filtration process, which removes particulates from the cooled raw fuel gas at up to 600{degree}C is the first stage of gas cleaning prior to desulphurization and ammonia removal processes. The dust concentration in the fuel gas downstream of the sorbent processes would be much lower than for the hot gas filtration stage and would have a lower sulphur content and possibly reduced chlorine concentration. The main aim of this project is to define the requirements for a hot gas filter for dedusting fuel gas under these conditions, and to identify a substantially simpler and more cost effective solution using ceramic or metal barrier filters.
Solid gas reaction phase diagram under high gas pressure
International Nuclear Information System (INIS)
Ishizaki, K.
1992-01-01
This paper reports that to evaluate which are the stable phases under high gas pressure conditions, a solid-gas reaction phase diagram under high gas pressure (HIP phase diagram) has been proposed by the author. The variables of the diagram are temperature, reactant gas partial pressure and total gas pressure. Up to the present time the diagrams have been constructed using isobaric conditions. In this work, the stable phases for a real HIP process were evaluated assuming an isochoric condition. To understand the effect of the total gas pressure on stability is of primary importance. Two possibilities were considered and evaluated, those are: the total gas pressure acts as an independent variable, or it only affects the fugacity values. The results of this work indicate that the total gas pressure acts as an independent variable, and in turn also affects the fugacity values
Northwest Asia - gas market outlook: LNG vs. pipeline gas
International Nuclear Information System (INIS)
Keun Wook Paik
1996-01-01
The share of natural gas in Northeast Asia's energy mix is quite low despite that the region currently dominates the world LNG trade. In the long term, the region's rapid expansion of gas demand in the coming decades looks very likely, but the LNG dominance in the region's gas market will collapse in parallel with the introduction of a long distance pipeline gas. The most likely timing of pipeline gas introduction in Northeast Asian gas market seems to be during the second half of the next decade. (Author)
Energy Technology Data Exchange (ETDEWEB)
Fell, J W
1915-05-03
Retorts for the distillation of shale or coal for the production of oil or illuminating-gas are heated by gas from a generator or a gas-holder, and a portion of the gas from the flue leading to the heating-flues is forced by a steam jet through a by-pass and is injected into the bottom of the retorts. If the gas to be admitted to the retort is cold, it is first heated.
... Funding IFFGD Symposium reports Industry Council Contact Us Treatment of Gas You are here: Home Symptoms & Causes Intestinal Gas ... Controlling Intestinal Gas Foods That May Cause Gas Treatment of Gas Tips on Controlling Gas Adapted from IFFGD Publication # ...
2013-02-19
... corporate name change from MichCon to DTE Gas, and pursuant to section 284.123 of the Commissions... Gas Company (DTE Gas) filed to institute a name change to both itself from MichCon to DTE Gas and to...
Bakar, Wan Azelee Wan Abu; Ali, Rusmidah
2010-01-01
Natural gas fuel is a green fuel and becoming very demanding because it is environmental safe and clean. Furthermore, this fuel emits lower levels of potentially harmful by-products into the atmosphere. Most of the explored crude natural gas is of sour gas and yet, very viable and cost effective technology is still need to be developed. Above all, methanation technology is considered a future potential treatment method for converting the sour natural gas to sweet natural gas.
2013-06-26
... Natural Gas Company; Southern Natural Gas Company, L.L.C.; Florida Gas Transmission Company, LLC; Notice of Application Take notice that on June 4, 2013, Northern Natural Gas Company (Northern), 1111 South 103rd Street, Omaha, Nebraska 68124; on behalf of itself, Southern Natural Gas Company, L.L.C., and...
Gas engine supplied with fermentation gas
Energy Technology Data Exchange (ETDEWEB)
Cupial, K
1978-01-01
A CH/sub 4/-rich fermentation gas from the waste-treatment plant at Czestochowa is used as fuel to drive the generating set composed of an electric generator and a piston diesel engine adapted to operation with the fermentation gas. The adaption involved the use of a classical car ignition installation instead of the injection pumps and injector. The gas contains approximately CH/sub 4/ 60, CO/sub 2/ 32, N 5, and H 3 volume%.
Gas retorts: gas manufacture, process for distillation, destructive
Energy Technology Data Exchange (ETDEWEB)
Bell, J
1874-05-23
In apparatus for distilling shale, coal, etc. for making oil and gas, tubular retorts are supported horizontally in a chamber by plates from a brick setting and are heated partly by jets of gas from a pipe supplied through a cock from a gas holder, and partly by the waste gases from a furnace, which heats gas retorts placed in a chamber, air being supplied beneath the grate by a fan.
Gas supply planning for new gas-fired electricity generation facilities
International Nuclear Information System (INIS)
Slocum, J.C.
1990-01-01
This paper explores several key issues in gas supply planning for new gas fired electric generation facilities. This paper will have two main sections, as follows: developing the gas supply plan for a gas-fired electricity generation facility and exploring key gas supply contract pricing issues
Gas-particle interactions in dense gas-fluidised beds
Li, J.; Kuipers, J.A.M.
2003-01-01
The occurrence of heterogeneous flow structures in gas-particle flows seriously affects gas¿solid contacting and transport processes in dense gas-fluidized beds. A computational study, using a discrete particle method based on Molecular Dynamics techniques, has been carried out to explore the
Inefficient charging for delivered gas by local gas distributors
Directory of Open Access Journals (Sweden)
Siniša Bikić
2005-10-01
Full Text Available In this region, especially in Serbia, common belief is that local distributors of gas used by households don’t charge for gas properly. It is suspected that there are two sources for improper ways of gas charging. Local distributors charge for delivered gas only, according to flow rat but not according to gas quality. It is usual that local distributors deliver gas of different quality than one signed in contract. In this work will be considered only one of aspects inefficient charging for delivered gas by local gas distributors, which is connected to variable atmospheric pressure. There is doubt, that local distributors make mistakes during accounting for delivered gas to costumers in regard atmospheric pressure. At the beginning of every investigation, problem has to be located and recognized. Authors are going to collect as much as possible available data, to elaborate and analyze data by scientific methods and to represent conclusions. So, the aim of this work is to diagnose current state and to approve or disapprove above mentioned suspicions. In our region this theme is very interesting, both because of energy efficiency and air pollution control. In this way both consumer and distributor will know, how mush energy they have really spent.
International Nuclear Information System (INIS)
Anderson, A.
1991-01-01
This book provides data on many facets of the natural gas industry. Topics include: Canadian, Mexican; US natural gas reserves and production; Mexican and US natural gas consumption; market conditions for natural gas in the US; and Canadian natural gas exports
Gas production strategy of underground coal gasification based on multiple gas sources.
Tianhong, Duan; Zuotang, Wang; Limin, Zhou; Dongdong, Li
2014-01-01
To lower stability requirement of gas production in UCG (underground coal gasification), create better space and opportunities of development for UCG, an emerging sunrise industry, in its initial stage, and reduce the emission of blast furnace gas, converter gas, and coke oven gas, this paper, for the first time, puts forward a new mode of utilization of multiple gas sources mainly including ground gasifier gas, UCG gas, blast furnace gas, converter gas, and coke oven gas and the new mode was demonstrated by field tests. According to the field tests, the existing power generation technology can fully adapt to situation of high hydrogen, low calorific value, and gas output fluctuation in the gas production in UCG in multiple-gas-sources power generation; there are large fluctuations and air can serve as a gasifying agent; the gas production of UCG in the mode of both power and methanol based on multiple gas sources has a strict requirement for stability. It was demonstrated by the field tests that the fluctuations in gas production in UCG can be well monitored through a quality control chart method.
Current gas storage R and D programmes at Gas Research Institute
International Nuclear Information System (INIS)
Shikari, Y.A.
1990-01-01
The Gas Research Institute (GRI) is currently involved in the development of concepts aimed at an enhancement of natural gas service to the consumer. In order to maintain the attractiveness of the gas options to industrial consumers and to reinforce the ''value-in-use'' of natural gas to residential as well as commercial customers, it is essential to develop efficient, economical, and safe means of reducing the ''cost-of-service'', including that of natural gas storage in underground formations. Specifically, research and development (R and D) is needed to explore ways to better utilize existing storage fields and also to develop new storage facilities at minimum cost. GRI is currently sponsoring research projects aimed at controlling gas migration in underground gas storage reservoirs, reducing base (or cushion) gas requirements, understanding the gas-gas phase mixing behaviour via laboratory experiments and reservoir models, developing cost-effective gas separation processes using membranes, and optimizing the operation and maintenance (O and M) costs of underground gas storage operations. This paper provides an overview of the GRI's Gas Storage R and D Programme and highlights key results achieved to date for selected research projects. (author). 16 refs, 6 figs, 3 tabs
Energy Technology Data Exchange (ETDEWEB)
Sakurai, M
1970-03-27
A centrifugal gas separator of a highly endurable construction and with improved gas sealing qualities utilizes a cylincrical elastic bellows or similar system in cooperation with a system of dynamic pressure operable gas seals as means for removing separated gases from the interior of the rotor drum, collecting the separated gases in their respective separated gas chambers defined by the corresponding bellows and their supporting stationary wall members, gas seals and rotor end caps, and means for discharging to the exterior of the surrounding cylindrical wall member the gaseous components from their respective separated gas chambers. In the vicinity of the rotary drum motor is a mixed gas chamber and means for providing the gas mixture along a co-axial passage into the rotary drum chamber. Orifices are bored into the end caps of the rotary drum to direct the separated gases into the aforementioned separated gas chambers which, through the action of the gas seals, freely slide upon the rotating drum to collect and thereafter discharge the thus separated gases. Therefore, according to the present invention, helium gas used to prevent separated gas remixture is unnecessary and, furthermore, the gas seals and elastic bellows means provide an air-tight seal superior to that of the contact sealing system of the former art.
Gas Composition Sensor for Natural Gas and Biogas
Boersma, A.; Sweelsen, J.; Blokland, H.
2016-01-01
The calorific value of energetic gasses is an important parameter in the quality assessment of gas steams, and can be calculated from the chemical composition of the gas. An array of capacitive sensor electrodes was developed, each functionalized with a gas responsive coating to measure the
International Nuclear Information System (INIS)
Chourasiya, G.; Pradhan, S.M.; Kher, R.K.; Bhatt, B.C
2003-01-01
Full text: New improvised hot gas based Auto TLD badge reader has several advantages over the earlier contact heating based manual badge reader. It requires constant supply of N 2 gas for its operation; The gas supplied using replaceable individual gas cylinders may have some safety hazards in their handling. It was therefore considered worthwhile to setup a N 2 gas assembly/ station outside the lab area and to bring regulated gas supply through network of tubes with proper regulation to the individual readers. The paper presents detailed description of the gas station and distribution system. The system is quite useful and offers several practical advantages for readout of TLD badges on the semiautomatic badge readers based on gas heating. Important advantage from dosimetric point of view is avoidance of gas flow rate fluctuations and corresponding variations in TL readouts
Life cycle water consumption for shale gas and conventional natural gas.
Clark, Corrie E; Horner, Robert M; Harto, Christopher B
2013-10-15
Shale gas production represents a large potential source of natural gas for the nation. The scale and rapid growth in shale gas development underscore the need to better understand its environmental implications, including water consumption. This study estimates the water consumed over the life cycle of conventional and shale gas production, accounting for the different stages of production and for flowback water reuse (in the case of shale gas). This study finds that shale gas consumes more water over its life cycle (13-37 L/GJ) than conventional natural gas consumes (9.3-9.6 L/GJ). However, when used as a transportation fuel, shale gas consumes significantly less water than other transportation fuels. When used for electricity generation, the combustion of shale gas adds incrementally to the overall water consumption compared to conventional natural gas. The impact of fuel production, however, is small relative to that of power plant operations. The type of power plant where the natural gas is utilized is far more important than the source of the natural gas.
International Nuclear Information System (INIS)
Anon.
1992-01-01
This book includes: Overview of coalbed gas development; Coalbed gas development in the West Coalbed gas development on Indian lands; Multi-mineral development conflicts; Statutory solutions to ownership disputes; State and local regulation; Environmental regulations; Status of the section 29 tax credit extension; Using the section 29 credit; Leasing coalbed gas prospects; Coalbed gas joint operating agreements and Purchase and sale agreements for coalbed gas properties
Norwegian Natural Gas. Liberalization of the European Gas Market
International Nuclear Information System (INIS)
Austvik, Ole Gunnar
2003-01-01
Leading abstract. This book focuses on issues that are important for Norway as a major gas exporter and to the development of a liberalized European market. Chapter 2 explains main features of the European gas market. Natural gas is sold in regional markets with independent pricing structure and particularities. In Europe, this has led to large investments for the producers and long-term contracts. The strong market growth and EU's actions to liberalize the market may change this. The organization of the Norwegian gas production and sale is discussed, as well as the reorganization taking place in 2001. Pricing mechanisms are discussed in Chapter 3, both in the ''old'' / existing structure and how a liberalization of the market may change price formation. The increased importance of energy taxation in EU countries is covered in Chapter 4. Even though natural gas is the most environmentally friendly of the fossil fuels, the use of natural gas may be taxed far harder in the future. The report discusses price effects of such a development. Chapter 5 discusses whether or not a gas producer, like Norway, necessarily must earn a resource rent. With the use of economic theory for exhaustible resources it is shown how prices to consumers may increase at the same time as prices to producers drop, where the difference is made up by higher gas taxes to the consuming countries. Transportation of natural gas involves considerable scale advantages and there are often scope advantages from production, storage and sale, as well. Chapter 6 discusses how competition and regulation may influence the functioning and social efficiency of the market, and the concentration of market power. When companies become large, they may exploit market power, supported by the authorities of their respective countries. Chapter 7 focuses on regulatory challenges for the EU, and how the transporters may change between conflicting and cooperation with the EU. Chapter 8 focuses on schedules for
Agricultural demands for natural gas and liquified petroleum gas in the USA
International Nuclear Information System (INIS)
Uri, N.D.; Gill, M.
1992-01-01
This study endeavours to determine whether farmers adjust their consumption of natural gas and liquefied petroleum gas in response to changes in the unit price of energy. A demand model is specified and estimated. The conclusions suggest that the unit price of natural gas (liquefied petroleum gas) is a factor impacting the quantity of natural gas (liquefied petroleum gas) demanded by farmers, but there is no indication that other types of energy are substitutes for natural gas or liquefied petroleum gas. Additionally, the number of acres irrigated is an important factor driving the demand for natural gas and liquefied petroleum gas. Finally, the estimated models of natural gas and liquefied petroleum gas demand were structurally stable over the period 1971-1989. (author)
Gas Production Strategy of Underground Coal Gasification Based on Multiple Gas Sources
Directory of Open Access Journals (Sweden)
Duan Tianhong
2014-01-01
Full Text Available To lower stability requirement of gas production in UCG (underground coal gasification, create better space and opportunities of development for UCG, an emerging sunrise industry, in its initial stage, and reduce the emission of blast furnace gas, converter gas, and coke oven gas, this paper, for the first time, puts forward a new mode of utilization of multiple gas sources mainly including ground gasifier gas, UCG gas, blast furnace gas, converter gas, and coke oven gas and the new mode was demonstrated by field tests. According to the field tests, the existing power generation technology can fully adapt to situation of high hydrogen, low calorific value, and gas output fluctuation in the gas production in UCG in multiple-gas-sources power generation; there are large fluctuations and air can serve as a gasifying agent; the gas production of UCG in the mode of both power and methanol based on multiple gas sources has a strict requirement for stability. It was demonstrated by the field tests that the fluctuations in gas production in UCG can be well monitored through a quality control chart method.
International Nuclear Information System (INIS)
Forbes, A.; Widdershoven, C.; Nicola, S.; Cragg, C.
2009-01-01
Two articles and two columns in this section on the future of natural gas. In the first article attention is paid to the possibility that large natural gas producers are setting up a cartel a la OPEC. Most experts argue that the structure of gas markets makes the gas business much less amenable to cartelisation than the oil business. If that is true, why are so many people in the gas industry afraid of a gas cartel? The second article focuses on the future role of North Africa in the supply of natural gas
International Nuclear Information System (INIS)
Sakurai, Mitsuo.
1970-01-01
A centrifugal gas separator of a highly endurable construction and with improved gas sealing qualities utilizes a cylincrical elastic bellows or similar system in cooperation with a system of dynamic pressure operable gas seals as means for removing separated gases from the interior of the rotor drum, collecting the separated gases in their respective separated gas chambers defined by the corresponding bellows and their supporting stationary wall members, gas seals and rotor end caps, and means for discharging to the exterior of the surrounding cylindrical wall member the gaseous components from their respective separated gas chambers. In the vicinity of the rotary drum motor is a mixed gas chamber and means for providing the gas mixture along a co-axial passage into the rotary drum chamber. Orifices are bored into the end caps of the rotary drum to direct the separated gases into the aforementioned separated gas chambers which, through the action of the gas seals, freely slide upon the rotating drum to collect and thereafter discharge the thus separated gases. Therefore, according to the present invention, helium gas used to prevent separated gas remixture is unnecessary and, furthermore, the gas seals and elastic bellows means provide an air-tight seal superior to that of the contact sealing system of the former art. (K.J. Owens)
Van De Ven, C. J. C.; Mumford, Kevin G.
2018-05-01
The study of gas-water mass transfer in porous media is important in many applications, including unconventional resource extraction, carbon storage, deep geological waste storage, and remediation of contaminated groundwater, all of which rely on an understanding of the fate and transport of free and dissolved gas. The novel visual technique developed in this study provided both quantitative and qualitative observations of gas-water mass transfer. Findings included interaction between free gas architecture and dissolved plume migration, plume geometry and longevity. The technique was applied to the injection of CO2 in source patterns expected for stray gas originating from oil and gas operations to measure dissolved phase concentrations of CO2 at high spatial and temporal resolutions. The data set is the first of its kind to provide high resolution quantification of gas-water dissolution, and will facilitate an improved understanding of the fundamental processes of gas movement and fate in these complex systems.
Flue gas emissions from gas-fired cogeneration units <25 MWe
International Nuclear Information System (INIS)
Nielsen, M.; Wit, J. de
1997-01-01
A total of 900 MW e gas driven combined heat and power (CHP) has now been established in Denmark based on gas engines and gas turbine units less than 25 MW e each. Of the 900 MW e approx. 750 MW e are based on gas engines. Biogas is used as fuel for some 32 MW e of these. Emission limits for NO x and CO are 650 mg/nm 3 (ref. 5% O 2 and electrical efficiency 30% LCV). There is at present no limit for unburned hydrocarbons (UHC) for gas engines or gas turbines. The average emission of unburned hydrocarbons for the Danish gas engine driven CHP units is equal to approx. 3,5% of the fuel used. It is the target of this report to provide the basis for evaluating the planned UHC limit and possible adjustments of the present limit for NO x emission. The average NO x emission from gas turbines slightly exceeds the NO x emission from gas engines. This is due to a number of older gas turbines. Modern gas turbines can achieve significantly lower NO x emission compared to engines. The NO x emission from biogas driven engines is significantly higher than that of natural gas driven units. This is mainly due to NO x -unfavourable engine settings and the use of older units, as there are no legislation concerning NO x emission for the majority of these biogas driven units. The emission of CO and UHC is lower from gas turbines than from gas engines. The NO x emission can be reduced by SCR Catalyst systems. In Denmark 3 gas engine installations use this commercially available technology. Oxidation catalyst for UHC reduction at modern gas engine installations has proven relatively unsuccesful in Denmark until now. Only limited reductions are achieved and many catalysts are toxificated in less than 100 hours of operation. However, long-term field testing of promising UHC reducing catalysts is now being made. UHC reduction by incineration is at the prototype stage. No such plant has yet been set up in Denmark. (Abstract Truncated)
Lorenson, Thomas; Collett, Timothy S.
2018-01-01
The National Gas Hydrate Program Expedition 01 (NGHP-01) targeted gas hydrate accumulations offshore of the Indian Peninsula and along the Andaman convergent margin. The primary objectives of coring were to understand the geologic and geochemical controls on the accumulation of methane hydrate and their linkages to underlying petroleum systems. Four areas were investigated: 1) the Kerala-Konkan Basin in the eastern Arabian Sea, 2) the Mahanadi and 3) Krishna-Godavari Basins in the western Bay of Bengal, and 4) the Andaman forearc Basin in the Andaman Sea.Upward flux of methane at three of the four of the sites cored during NGHP-01 is apparent from the presence of seafloor mounds, seismic evidence for upward gas migration, shallow sub-seafloor geochemical evidence of methane oxidation, and near-seafloor gas composition that resembles gas from depth.The Kerala-Konkan Basin well contained only CO2 with no detectable hydrocarbons suggesting there is no gas hydrate system here. Gas and gas hydrate from the Krishna-Godavari Basin is mainly microbial methane with δ13C values ranging from −58.9 to −78.9‰, with small contributions from microbial ethane (−52.1‰) and CO2. Gas from the Mahanadi Basin was mainly methane with lower concentrations of C2-C5 hydrocarbons (C1/C2 ratios typically >1000) and CO2. Carbon isotopic compositions that ranged from −70.7 to −86.6‰ for methane and −62.9 to −63.7‰ for ethane are consistent with a microbial gas source; however deeper cores contained higher molecular weight hydrocarbon gases suggesting a small contribution from a thermogenic gas source. Gas composition in the Andaman Basin was mainly methane with lower concentrations of ethane to isopentane and CO2, C1/C2 ratios were mainly >1000 although deeper samples were compositions range from −65.2 to −80.7‰ for methane, −53.1 to −55.2‰ for ethane is consistent with mainly microbial gas sources, although one value recorded of −35.4‰ for propane
International Nuclear Information System (INIS)
Masuda, T.
1990-01-01
This paper reports on natural gas which now appears ready to take a leading role on the world energy stage. Demand for natural gas, and specifically LNG, will be strong throughout the world, particularly in Asia. Indonesia and Malaysia will become much more dependent on natural gas in the Asian market. In Thailand, where remarkable economic growth has been fueled by imported oil and domestically produced natural gas, LNG may soon have to be imported from neighboring countries. The author sees Thailand's imports of natural gas increasing from 1.5 to 4.5 million tons annually. Similarly, Korea's imports of LNG will rise from 2 to 8 million tons between 1987 and 2000. In Japan, energy demand is expected to increase at an even faster rate in the 1990s. Given the opposition to nuclear power generation and growing concern about the greenhouse effect, it is likely that LNG will satisfy a major portion of Japan's increasing demand for energy. Japanese gas companies are studying the possibility of establishing a national pipeline network to move gas beyond metropolitan areas
Alternative ways to transport natural gas; Transporte alternativo de gas natural
Energy Technology Data Exchange (ETDEWEB)
Moura, N.R.; Campos, F.B. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil). Centro de Pesquisas (CENPES)
2008-07-01
The Brazilian energy matrix has been showing a huge increase in the demand of natural gas due mainly to industries and power plants. Today the Brazilian gas market is supplied with gas produced by PETROBRAS and imported from Bolivia. To increase the Brazilian gas supply, on the short and middle term, PETROBRAS will import LNG (liquefied natural gas) and exploit the new offshore fields discovered on the pre-salt area. The only proven technology available today to bring this offshore gas to the market is the pipeline, but its costs for the pre-salt area are high enough to keep the solution economically attractive. So, PETROBRAS are evaluating and developing alternative ways to transport offshore gas, such as LNG, CNG (Compressed Natural Gas), GTS (Gas-to-Solids or Natural Gas Hydrates) and ANG (Adsorbed Natural Gas). Using information available in the literature, this paper analyses the main concepts of CNG and LNG floating unities. This paper also presents the PETROBRAS R and D results on ANG and GTS aiming at offshore application. (author)
America: AGA [American Gas Association] initiative aims to boost gas demand
International Nuclear Information System (INIS)
Fraser, K.M.
1992-01-01
This article focuses on the aim of the American Gas Association to increase natural gas demand in the key areas of gas electric generation, natural gas vehicles, gas cooling, and conversion of oil burning facilities, electric water heaters and household appliances such as space heating, stoves, washers and lighting. The need to improve the reliability of natural gas supplies is discussed. It is anticipated that natural gas will not replace coal as the main energy source for power generation, but that it will help utilities to meet environmental regulations. (UK)
BC gas takes new approach to gas supply optimization
International Nuclear Information System (INIS)
Cawdery, J.; Swoveland, C.
1992-01-01
Wide-ranging changes have taken place in the US and Canada since the mid-1980s in the way that local gas distribution utilities and large industrial customers contract for their gas supplies. This paper reports that these changes have been brought about by open-access policies, the intent of which was to allow customers more latitude to make their gas purchase and transportation arrangements and to improve the access of shippers to available gas transmission capacity. The effects of the new open-access regime have been profound on both sides of the border. More than 70% of North American gas supplies are now sold under unbundled arrangements in which gas supply is contracted under separate commodity and transportation agreements. For local distribution utilities, the numbers of potential supply options have become extremely large. Analysis of these options has become increasingly complex with the need to take account of complicated contract provisions, a wider range of storage options and swap arrangements with other utilities, opportunities for some customers to purchase gas directly and uncertainty about future demand, prices and supplier reliability
Natural gas and Brazilian energetic matrix; Gas natural no Brasil
Energy Technology Data Exchange (ETDEWEB)
Moraes, Ricardo Luchese de [White Martins S.A., Rio de Janeiro, RJ (Brazil)
1997-07-01
Recent projection of the market in global scale shows a tendency in natural gas using replacing mostly the fuel oil. Its market share well increase from 21.1% in 1994 to 24.0% in 2010. The annual energetic use will reach 29.23 x 10{sup 9} Gcal in 2010 (8990 million Nm{sup 3} natural gas/day) versus 18.90 x 10{sup 9} Gcal in 1994 (5810 million Nm{sup 3} natural gas/day). For Brazil, its consumption will increase from 8.7 million Nm{sup 3} natural gas/day in 1994 to 35.9 million Nm{sup 3} natural gas/day in 2010. Projects like Brazil-Bolivia natural gas pipeline, will supply 18 million Nm{sup 3} natural gas/day, which expected to start-up before the year 2000. This projects will supply the Brazilian southern regions, that do not consume natural gas at the current moment. Although there are many different kind of natural gas consumption in the industry this paper presents the technical and economical estimate of the injection in the blast furnace operating with coke or charcoal. The process simulation is done assisted by math modeling developed by White Martins/Praxair Inc. (author)
The impact of northern gas on North American gas infrastructure
International Nuclear Information System (INIS)
Letwin, S.
2004-01-01
The three business units that Enbridge operates are crude oil pipelines; natural gas liquids (NGL) transportation; and gas transmission and distribution. The need for more infrastructure will increase as the demand for natural gas increases. This presentation outlined the issues that surround and sometimes impede infrastructure development. It also emphasized the need for northern gas supply at a time when conventional natural gas supplies are decreasing and demand is growing. Additional LNG supply is required along with new supply from Alaska, Mackenzie Delta and the east coast. The issue of a secure source of supply was discussed along with northern gas expectations. It is expected that Mackenzie Delta gas (1.2 bcf/day) will be available by 2008 to 2010 and Alaska North Slope gas (4 bcf/day) will be available from 2012 to 2014. Gas demand by industrial, residential, commercial and power generation sectors across North America was illustrated. The challenge lies in creating infrastructure to move the supply to where it is most in demand. General infrastructure issues were reviewed, such as prices, regulatory streamlining, lead times, stakeholder issues and supporting infrastructure. 19 figs
Processing of coke oven gas. Primary gas cooling
Energy Technology Data Exchange (ETDEWEB)
Ullrich, H [Otto (C.) und Co. G.m.b.H., Bochum (Germany, F.R.)
1976-11-01
The primary cooler is an indispensable part of all byproduct processing plants. Its purpose is to cool the raw gas from the coke oven battery and to remove the accompanying water vapor. The greater part of the cooling capacity is utilized for the condensation of water vapor and only a small capacity is needed for the gas cooling. Impurities in the gas, like naphthalene, tar and solid particles, necessitate a special design in view of the inclination to dirt accumulation. Standard types of direct and indirect primary gas coolers are described, with a discussion of their advantages and disadvantages.
Natural gas participation on brazilian demand supply of liquefied petroleum gas
International Nuclear Information System (INIS)
Freitas Rachid, L.B. de
1991-01-01
Natural Gas Liquids Production, Liquefied Petroleum Gas (LPG) among them, has undergone a continuous growth and technological development until the first half of the eighties. This paper presents the natural gas processing activity development in Brazil, in the last 20 years, and the increasing share of LPG produced from natural gas in the supply of LPG domestic market. Possibilities of achieving greater shares are discussed, based on economics of natural gas processing projects. Worldwide gas processing installed capacity and LPG pricing tendencies, and their influence in the construction of new Natural Gas Processing Units in Brazil, are also discussed. (author)
Retained Gas Sampling Results for the Flammable Gas Program
International Nuclear Information System (INIS)
Bates, J.M.; Mahoney, L.A.; Dahl, M.E.; Antoniak, Z.I.
1999-01-01
The key phenomena of the Flammable Gas Safety Issue are generation of the gas mixture, the modes of gas retention, and the mechanisms causing release of the gas. An understanding of the mechanisms of these processes is required for final resolution of the safety issue. Central to understanding is gathering information from such sources as historical records, tank sampling data, tank process data (temperatures, ventilation rates, etc.), and laboratory evaluations conducted on tank waste samples
Retained Gas Sampling Results for the Flammable Gas Program
Energy Technology Data Exchange (ETDEWEB)
J.M. Bates; L.A. Mahoney; M.E. Dahl; Z.I. Antoniak
1999-11-18
The key phenomena of the Flammable Gas Safety Issue are generation of the gas mixture, the modes of gas retention, and the mechanisms causing release of the gas. An understanding of the mechanisms of these processes is required for final resolution of the safety issue. Central to understanding is gathering information from such sources as historical records, tank sampling data, tank process data (temperatures, ventilation rates, etc.), and laboratory evaluations conducted on tank waste samples.
Lorenson, Thomas; Collett, Timothy S.
2018-01-01
The National Gas Hydrate Program Expedition 01 (NGHP-01) targeted gas hydrate accumulations offshore of the Indian Peninsula and along the Andaman convergent margin. The primary objectives of coring were to understand the geologic and geochemical controls on the accumulation of methane hydrate and their linkages to underlying petroleum systems. Four areas were investigated: 1) the Kerala-Konkan Basin in the eastern Arabian Sea, 2) the Mahanadi and 3) Krishna-Godavari Basins in the western Bay of Bengal, and 4) the Andaman forearc Basin in the Andaman Sea.Upward flux of methane at three of the four of the sites cored during NGHP-01 is apparent from the presence of seafloor mounds, seismic evidence for upward gas migration, shallow sub-seafloor geochemical evidence of methane oxidation, and near-seafloor gas composition that resembles gas from depth.The Kerala-Konkan Basin well contained only CO2 with no detectable hydrocarbons suggesting there is no gas hydrate system here. Gas and gas hydrate from the Krishna-Godavari Basin is mainly microbial methane with δ13C values ranging from −58.9 to −78.9‰, with small contributions from microbial ethane (−52.1‰) and CO2. Gas from the Mahanadi Basin was mainly methane with lower concentrations of C2-C5 hydrocarbons (C1/C2 ratios typically >1000) and CO2. Carbon isotopic compositions that ranged from −70.7 to −86.6‰ for methane and −62.9 to −63.7‰ for ethane are consistent with a microbial gas source; however deeper cores contained higher molecular weight hydrocarbon gases suggesting a small contribution from a thermogenic gas source. Gas composition in the Andaman Basin was mainly methane with lower concentrations of ethane to isopentane and CO2, C1/C2 ratios were mainly >1000 although deeper samples were exploration and occurs in a forearc basin. Each of these hydrate-bearing systems overlies and is likely supported by the presence and possible migration of gas from deeper gas-prone petroleum
Natural gas market review 2006 - towards a global gas market
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
Natural gas is essential to the world economy. Gas now accounts for almost a quarter of OECD primary energy requirements and is expected to become the second most important fuel in the world in the next decade. Industrial and residential consumers increasingly rely on natural gas to keep their houses warm, their lights on and their factories running. Meanwhile the gas industry itself has entered a new phase. Where gas used to be restricted to regional markets, it is now increasingly traded on a global scale. While gas production and transport requires long-term investment, now it is optimised on a short-term basis. Demand continues to grow, but local gas production has become much more expensive. How should we react? How will demand be satisfied? What changes are required to promote flexibility and trade? What are the implications for gas security, investment and interdependence? At stake is an opportunity to diversify supply and demand - but this goal is threatened by barriers to competition and investment. This book is the first of a new IEA publication series. It takes an unprecedented look at developments in natural gas to 2010, analysing not only the three IEA regions (Asia Pacific, North America and Europe) but also broader global trends, such as the interaction of pipeline gas with LNG which binds the regions together. The Review provides invaluable insights for understanding this dynamic market.
Natural gas market review 2006 - towards a global gas market
International Nuclear Information System (INIS)
2006-01-01
Natural gas is essential to the world economy. Gas now accounts for almost a quarter of OECD primary energy requirements and is expected to become the second most important fuel in the world in the next decade. Industrial and residential consumers increasingly rely on natural gas to keep their houses warm, their lights on and their factories running. Meanwhile the gas industry itself has entered a new phase. Where gas used to be restricted to regional markets, it is now increasingly traded on a global scale. While gas production and transport requires long-term investment, now it is optimised on a short-term basis. Demand continues to grow, but local gas production has become much more expensive. How should we react? How will demand be satisfied? What changes are required to promote flexibility and trade? What are the implications for gas security, investment and interdependence? At stake is an opportunity to diversify supply and demand - but this goal is threatened by barriers to competition and investment. This book is the first of a new IEA publication series. It takes an unprecedented look at developments in natural gas to 2010, analysing not only the three IEA regions (Asia Pacific, North America and Europe) but also broader global trends, such as the interaction of pipeline gas with LNG which binds the regions together. The Review provides invaluable insights for understanding this dynamic market
Investigation of Continuous Gas Engine CHP Operation on Biomass Producer Gas
DEFF Research Database (Denmark)
Ahrenfeldt, Jesper; Henriksen, Ulrik Birk; Jensen, Torben Kvist
2005-01-01
More than 2000 hours of gas engine operation with producer gas from biomass as fuel has been conducted on the gasification CHP demonstration and research plant, named “Viking” at the Technical University of Denmark. The gas engine is an integrated part of the entire gasification plant. The excess...... operates with varying excess of air due to variation in gas composition and thus stoichiometry, and a second where the excess of air in the exhaust gas is fixed and the flow rate of produced gas from the gasifier is varying. The interaction between the gas engine and the gasification system has been...... investigated. The engine and the plant are equipped with continuously data acquisition that monitors the operation including the composition of the producer gas and the flow. Producer gas properties and contaminations have been investigated. No detectable tar or particle content was observed...
Walker, Thad Gilbert; Lancor, Brian Robert; Wyllie, Robert
2016-05-03
Measurement of a precessional rate of a gas, such as an alkali gas, in a magnetic field is made by promoting a non-uniform precession of the gas in which substantially no net magnetic field affects the gas during a majority of the precession cycle. This allows sensitive gases that would be subject to spin-exchange collision de-phasing to be effectively used for extremely sensitive measurements in the presence of an environmental magnetic field such as the Earth's magnetic field.
International Nuclear Information System (INIS)
Anon.
1988-01-01
This book covers all aspects of gas marketing, from the basic regulatory structure to the latest developments in negotiating agreements and locating markets. Topics include: Federal regulation of the gas industry; Fundamentals of gas marketing contracts; FERC actions encouraging competitive markets; Marketing conditions from the pipelines' perspective; State non-utility regulation of natural gas production, transportation, and marketing; Natural gas wellhead agreements and tariffs; Natural gas processing agreements; Effective management of producer's natural gas contracts; Producer-pipeline litigation; Natural gas purchasing from the perspective of industrial gas users; Gas marketing by co-owners: problems of disproportionate sales, gas balancing, and accounting to royalty owners; Alternatives and new directions in marketing
International Nuclear Information System (INIS)
Michael, H.
1993-01-01
An overview is presented of the Venezuelan natural gas industry. The structure of PDVSA, the Petroleos de Venezuela Organization, its foreign and domestic affiliates, and its subsidiaries are discussed. Natural gas resources in Venezuela total 290 trillion cubic feet, and Venezuela's share of world, OPEC and latin American production and reserves are 1%, 11% and 26%, respectively for production and 3%, 6% and 49% for reserves. Venezuela's gas pipeline network, plants, production, and marketing are described. Natural gas production and demand forecasts to 2002 are presented. Gas resources are largely located in eastern Venezuela, and large volumes of natural gas non-associated with crude oil will start to become important in the Venezuelan natural gas industry. 19 figs
Reduction of gas flow nonuniformity in gas turbine engines by means of gas-dynamic methods
Matveev, V.; Baturin, O.; Kolmakova, D.; Popov, G.
2017-08-01
Gas flow nonuniformity is one of the main sources of rotor blade vibrations in the gas turbine engines. Usually, the flow circumferential nonuniformity occurs near the annular frames, located in the flow channel of the engine. This leads to the increased dynamic stresses in blades and as a consequence to the blade damage. The goal of the research was to find an acceptable method of reducing the level of gas flow nonuniformity as the source of dynamic stresses in the rotor blades. Two different methods were investigated during this research. Thus, this study gives the ideas about methods of improving the flow structure in gas turbine engine. On the basis of existing conditions (under development or existing engine) it allows the selection of the most suitable method for reducing gas flow nonuniformity.
International Nuclear Information System (INIS)
Carson, M.M.
1994-01-01
Natural gas is an important source of energy throughout the world due to its availability and clean burning characteristics. From liquefied natural gas being shipped via tanker from Alaska to Japan, to natural gas via pipeline from Canada to the US, to inter-country natural gas shipment within the European continent, natural gas continues to expand and justify its place of honor in the world energy picture
Gollan, A.
1988-03-29
Feed gas is directed tangentially along the non-skin surface of gas separation membrane modules comprising a cylindrical bundle of parallel contiguous hollow fibers supported to allow feed gas to flow from an inlet at one end of a cylindrical housing through the bores of the bundled fibers to an outlet at the other end while a component of the feed gas permeates through the fibers, each having the skin side on the outside, through a permeate outlet in the cylindrical casing. 3 figs.
International Nuclear Information System (INIS)
Anon.
1993-01-01
The spanish gas industry has become one of the major actors in the gas sector of the European Economic Community. This paper pictures the spanish gas industry on the basis of a study by Sedigas, the spanish member of the International Gas Union (IGU). The main subjects described are structure of gas companies, natural gas supply, transport and storage, natural gas distribution networks, statistical data on natural gas consumption, manufactured gas and Liquefied Petroleum Gases (LPG) production-consumption in Spain. 7 figs., 10 tabs
International Nuclear Information System (INIS)
Freedenthal, C.
1993-01-01
In recent years, natural gas has gained new momentum because of changes in marketing and regulations. The gas industry has always received an inordinate amount of regulatory control starting at the well head where the gas is produced to the consuming burner tip. Regulations have drastically impacted the availability of gas. Changes in the marketing and regulations have made the natural gas market sensitive at the point of production, the well head. Now, with plentiful supply and ease of transportation to bring the gas from the producing fields to the consumer, natural gas markets are taking advantage of the changed conditions. At the same time, new markets are developing to take advantage of the changes. This section shows consumers, especially the energy planners for large buyers of fuel, the advantages, sources and new methods of securing natural gas supplies. Background on how natural gas is produced and marketed are given. This section lists marketing sources, regulatory agencies and information groups available to help buyers and consumers of this important fuel for US industries and residences. 7 figs., 8 tabs
Gas-Dynamic Methods to Reduce Gas Flow Nonuniformity from the Annular Frames of Gas Turbine Engines
Kolmakova, D.; Popov, G.
2018-01-01
Gas flow nonuniformity is one of the main sources of rotor blade vibrations in the gas turbine engines. Usually, the flow circumferential nonuniformity occurs near the annular frames, located in the flow channel of the engine. This leads to the increased dynamic stresses in blades and consequently to the blade damage. The goal of the research was to find an acceptable method of reducing the level of gas flow nonuniformity. Two different methods were investigated during this research. Thus, this study gives the ideas about methods of improving the flow structure in gas turbine engine. Based on existing conditions (under development or existing engine) it allows the selection of the most suitable method for reducing gas flow nonuniformity.
Shale gas production: potential versus actual greenhouse gas emissions
O'Sullivan, Francis Martin; Paltsev, Sergey
2012-01-01
Estimates of greenhouse gas (GHG) emissions from shale gas production and use are controversial. Here we assess the level of GHG emissions from shale gas well hydraulic fracturing operations in the United States during 2010. Data from each of the approximately 4000 horizontal shale gas wells brought online that year are used to show that about 900 Gg CH[subscript 4] of potential fugitive emissions were generated by these operations, or 228 Mg CH[subscript 4] per well—a figure inappropriately ...
Russian natural gas policy and its possible effects on European gas markets
International Nuclear Information System (INIS)
Quast, O.; Locatelli, C.
1997-01-01
There is a growing perception among Western European gas experts that Russia has developed a considerable gas surplus - the Russian gas bubble. Thus, the question clearly arises how much gas is available for export and how much gas, over the next 15 to 20 years, can the Russian quasi-monopolist Gazprom market in Western Europe. We consider that Gazprom's export strategy mirrors the approach of Russia's natural gas policy towards the Western European market. In this paper, we will focus on the characteristics of Gazprom's export strategy, its underlying logic, and its impact on Western European gas markets. As a consequence of Gazprom's export strategy, the Russian gas company faces today a price quantity dilemma. Gazprom's problem is to place as much gas as possible in the growing Western European gas market, without destroying downstream gas prices. We argue that Gazprom has adopted a market share expansion and downstream vertical integration strategy, aimed at capturing a part of the downstream gas rent. Although this strategy appears to have initiated a form of gas to gas competition in a number of European consumer markets, this strategy is not based on an aggressive price policy. However, in order to live up to its ambitions, there is a chance that Gazprom will have to somewhat relax traditional contract clauses, such as contract length, indexation terms and take or pay conditions. (author)
International Nuclear Information System (INIS)
1996-01-01
The French government has decided to modify the conditions of extension of local natural gas authorities to neighbouring districts. The European Union is studying the conditions of internal gas market with the objective of more open markets although considering public service requirements
A miniaturized optical gas sensor for natural gas analysis
Ayerden, N.P.
2016-01-01
The depletion of domestic reserves and the growing use of sustainable resources forces a transition from the locally produced natural gas with a well-known composition toward the ‘new’ gas with a more flexible composition in the Netherlands. For safe combustion and proper billing, the natural gas
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-01-01
The Natural Gas Monthly highlights activities, events, and analyses of interest to public and private sector organizations associated with the natural gas industry. Volume and price data are presented each month for natural gas production, distribution, consumption, and interstate pipeline activities. Producer-related activities and underground storage data are also reported. From time to time, the Natural Gas Monthly features articles designed to assist readers in using and interpreting natural gas information.
Modern gas centrifuge and rarefied-gas dynamics
International Nuclear Information System (INIS)
Lowry, R.A.; Halle, E.V.; Wood, H.G. III.
1981-01-01
Today, the modern gas centrifuge appears to be the preferred method for the enrichment of the isotopes of uranium on a commercial scale. That this is the case is the result of diligent development programs pursued in this country as well as in the UK, Germany, and the Netherlands over the several decades since the end of WW II. The theoretical modelling of gas centrifuge performance has made notable advances. However, the theoretical work has been based primarily on continuum fluid dynamics considerations. Centrifuge problems involving rarefied gas dynamics considerations are discussed in this paper
Greenhouse gas emissions from high demand, natural gas-intensive energy scenarios
International Nuclear Information System (INIS)
Victor, D.G.
1990-01-01
Since coal and oil emit 70% and 30% more CO 2 per unit of energy than natural gas (methane), fuel switching to natural gas is an obvious pathway to lower CO 2 emissions and reduced theorized greenhouse warming. However, methane is, itself, a strong greenhouse gas so the CO 2 advantages of natural gas may be offset by leaks in the natural gas recovery and supply system. Simple models of atmospheric CO 2 and methane are used to test this hypothesis for several natural gas-intensive energy scenarios, including the work of Ausubel et al (1988). It is found that the methane leaks are significant and may increase the total 'greenhouse effect' from natural gas-intensive energy scenarios by 10%. Furthermore, because methane is short-lived in the atmosphere, leaking methane from natural gas-intensive, high energy growth scenarios effectively recharges the concentration of atmospheric methane continuously. For such scenarios, the problem of methane leaks is even more serious. A second objective is to explore some high demand scenarios that describe the role of methane leaks in the greenhouse tradeoff between gas and coal as energy sources. It is found that the uncertainty in the methane leaks from the natural gas system are large enough to consume the CO 2 advantages from using natural gas instead of coal for 20% of the market share. (author)
The computer simulation of 3d gas dynamics in a gas centrifuge
Borman, V. D.; Bogovalov, S. V.; Borisevich, V. D.; Tronin, I. V.; Tronin, V. N.
2016-09-01
We argue on the basis of the results of 2D analysis of the gas flow in gas centrifuges that a reliable calculation of the circulation of the gas and gas content in the gas centrifuge is possible only in frameworks of 3D numerical simulation of gas dynamics in the gas centrifuge (hereafter GC). The group from National research nuclear university, MEPhI, has created a computer code for 3D simulation of the gas flow in GC. The results of the computer simulations of the gas flows in GC are presented. A model Iguassu centrifuge is explored for the simulations. A nonaxisymmetric gas flow is produced due to interaction of the hypersonic rotating flow with the scoops for extraction of the product and waste flows from the GC. The scoops produce shock waves penetrating into a working camera of the GC and form spiral waves there.
The computer simulation of 3d gas dynamics in a gas centrifuge
International Nuclear Information System (INIS)
Borman, V D; Bogovalov, S V; Borisevich, V D; Tronin, I V; Tronin, V N
2016-01-01
We argue on the basis of the results of 2D analysis of the gas flow in gas centrifuges that a reliable calculation of the circulation of the gas and gas content in the gas centrifuge is possible only in frameworks of 3D numerical simulation of gas dynamics in the gas centrifuge (hereafter GC). The group from National research nuclear university, MEPhI, has created a computer code for 3D simulation of the gas flow in GC. The results of the computer simulations of the gas flows in GC are presented. A model Iguassu centrifuge is explored for the simulations. A nonaxisymmetric gas flow is produced due to interaction of the hypersonic rotating flow with the scoops for extraction of the product and waste flows from the GC. The scoops produce shock waves penetrating into a working camera of the GC and form spiral waves there. (paper)
Energy Technology Data Exchange (ETDEWEB)
Tada, A. [Agency of Natural Resources and Energy, Tokyo (Japan)
1995-07-20
This paper introduces the summary of the partial amendment in the gas business law (which was enforced in March 1995 upon propositions from the General Energy Investigation Council). The amendment consists mainly of deregulation on business rules for gas supply to large users. The amendment may be summarized as follows: the present billing regulations are deregulated for cases that gas purchasers are large users, permitting in principle the pricing to be agreed upon negotiations between the concerned parties; general gas business operators are allowed to supply gas under certain conditions even outside their supply areas, provided the supply is limited to large users; even any other persons than the general gas business operators can supply gas under certain conditions; persons to start newly a large -scale gas supply business shall be applied with the mandatory portions of the safety regulations that have already been imposed on the general gas business operators; clerical works for the national examination on chief gas engineers will be commissioned to civil organizations; and duplicated application of regulations in the gas utility industry law is eliminated for those operators who are subjected to regulations in the electric utility industry law. 1 fig.
Ismai, Reza Lutfi; Suseno, Jatmiko Endro; Suryono, Suryono
2017-01-01
Design of LPG gas leakage safety system using microcontroller has been made in this research. The purpose of this research is to make LPG gas sensor circuit to detect LPG gas concentration and make automation systems for LPG gas leakage protection. LPG gas leakage protection system can be applied for the use of LPG gas safely. Component to detect LPG gas concentration use sensor MQ 5 which can gives resistance as the output value which can be converted into voltage through the voltage devider...
Gas source localization and gas distribution mapping with a micro-drone
International Nuclear Information System (INIS)
Neumann, Patrick P.
2013-01-01
The objective of this Ph.D. thesis is the development and validation of a VTOL-based (Vertical Take Off and Landing) micro-drone for the measurement of gas concentrations, to locate gas emission sources, and to build gas distribution maps. Gas distribution mapping and localization of a static gas source are complex tasks due to the turbulent nature of gas transport under natural conditions and becomes even more challenging when airborne. This is especially so, when using a VTOL-based micro-drone that induces disturbances through its rotors, which heavily affects gas distribution. Besides the adaptation of a micro-drone for gas concentration measurements, a novel method for the determination of the wind vector in real-time is presented. The on-board sensors for the flight control of the micro-drone provide a basis for the wind vector calculation. Furthermore, robot operating software for controlling the micro-drone autonomously is developed and used to validate the algorithms developed within this Ph.D. thesis in simulations and real-world experiments. Three biologically inspired algorithms for locating gas sources are adapted and developed for use with the micro-drone: the surge-cast algorithm (a variant of the silkworm moth algorithm), the zigzag / dung beetle algorithm, and a newly developed algorithm called ''pseudo gradient algorithm''. The latter extracts from two spatially separated measuring positions the information necessary (concentration gradient and mean wind direction) to follow a gas plume to its emission source. The performance of the algorithms is evaluated in simulations and real-world experiments. The distance overhead and the gas source localization success rate are used as main performance criteria for comparing the algorithms. Next, a new method for gas source localization (GSL) based on a particle filter (PF) is presented. Each particle represents a weighted hypothesis of the gas source position. As a first step, the PF-based GSL algorithm
Gas source localization and gas distribution mapping with a micro-drone
Energy Technology Data Exchange (ETDEWEB)
Neumann, Patrick P.
2013-07-01
The objective of this Ph.D. thesis is the development and validation of a VTOL-based (Vertical Take Off and Landing) micro-drone for the measurement of gas concentrations, to locate gas emission sources, and to build gas distribution maps. Gas distribution mapping and localization of a static gas source are complex tasks due to the turbulent nature of gas transport under natural conditions and becomes even more challenging when airborne. This is especially so, when using a VTOL-based micro-drone that induces disturbances through its rotors, which heavily affects gas distribution. Besides the adaptation of a micro-drone for gas concentration measurements, a novel method for the determination of the wind vector in real-time is presented. The on-board sensors for the flight control of the micro-drone provide a basis for the wind vector calculation. Furthermore, robot operating software for controlling the micro-drone autonomously is developed and used to validate the algorithms developed within this Ph.D. thesis in simulations and real-world experiments. Three biologically inspired algorithms for locating gas sources are adapted and developed for use with the micro-drone: the surge-cast algorithm (a variant of the silkworm moth algorithm), the zigzag / dung beetle algorithm, and a newly developed algorithm called ''pseudo gradient algorithm''. The latter extracts from two spatially separated measuring positions the information necessary (concentration gradient and mean wind direction) to follow a gas plume to its emission source. The performance of the algorithms is evaluated in simulations and real-world experiments. The distance overhead and the gas source localization success rate are used as main performance criteria for comparing the algorithms. Next, a new method for gas source localization (GSL) based on a particle filter (PF) is presented. Each particle represents a weighted hypothesis of the gas source position. As a first step, the PF
Gas source localization and gas distribution mapping with a micro-drone
Energy Technology Data Exchange (ETDEWEB)
Neumann, Patrick P.
2013-07-01
The objective of this Ph.D. thesis is the development and validation of a VTOL-based (Vertical Take Off and Landing) micro-drone for the measurement of gas concentrations, to locate gas emission sources, and to build gas distribution maps. Gas distribution mapping and localization of a static gas source are complex tasks due to the turbulent nature of gas transport under natural conditions and becomes even more challenging when airborne. This is especially so, when using a VTOL-based micro-drone that induces disturbances through its rotors, which heavily affects gas distribution. Besides the adaptation of a micro-drone for gas concentration measurements, a novel method for the determination of the wind vector in real-time is presented. The on-board sensors for the flight control of the micro-drone provide a basis for the wind vector calculation. Furthermore, robot operating software for controlling the micro-drone autonomously is developed and used to validate the algorithms developed within this Ph.D. thesis in simulations and real-world experiments. Three biologically inspired algorithms for locating gas sources are adapted and developed for use with the micro-drone: the surge-cast algorithm (a variant of the silkworm moth algorithm), the zigzag / dung beetle algorithm, and a newly developed algorithm called ''pseudo gradient algorithm''. The latter extracts from two spatially separated measuring positions the information necessary (concentration gradient and mean wind direction) to follow a gas plume to its emission source. The performance of the algorithms is evaluated in simulations and real-world experiments. The distance overhead and the gas source localization success rate are used as main performance criteria for comparing the algorithms. Next, a new method for gas source localization (GSL) based on a particle filter (PF) is presented. Each particle represents a weighted hypothesis of the gas source position. As a first step, the PF-based GSL algorithm
Gas replacement system for fuel cell. Nenryo denchi no gas chikan hoshiki
Energy Technology Data Exchange (ETDEWEB)
Sugiyama, T
1990-02-14
When stopping the operation of a fuel cell, the gas in the reaction gas system is purged using such an inert gas as nitrogen for inactivation. A gas source such as inert gas bomb must be prepared beforehand for the purpose. This invention relates to a method of production of inert gas from the air collected from atmosphere to use it as the purge gas. The air collected from the atmosphere is passed through an oxygen remover filled with oxidation catalyst to remove oxygen, and dehumidified by a dehumidifier filled with drying agent, the obtained inert drying gas with nitrogen as the main constituent being used as the purge gas. Copper system catalyst supported by silica is used as the oxidation catalyst, and silica gel as the drying agent. After the operation of the fuel cell is re-started, a part of the high temperature fuel gas extracted from the reaction gas system is introduced to the oxygen remover for the reduction of oxidation catalyst and for heat regeneration of dehumidifying agent by the contained hydrogen. 1 fig.
US crude oil, natural gas, and natural gas liquids reserves, 1992 annual report
Energy Technology Data Exchange (ETDEWEB)
1993-10-18
This report presents estimates of proved reserves of crude oil, natural gas, and natural gas liquids as of December 31, 1992, as well as production volumes for the United States, and selected States and State subdivisions for the year 1992. Estimates are presented for the following four categories of natural gas: total gas (wet after lease separation), its two major components (nonassociated and associated-dissolved gas), and total dry gas (wet gas adjusted for the removal of liquids at natural gas processing plants). In addition, two components of natural gas liquids, lease condensate and natural gas plant liquids, have their reserves and production data presented. Also included is information on indicated additional crude oil reserves and crude oil, natural gas, and lease condensate reserves in nonproducing reservoirs. A discussion of notable oil and gas exploration and development activities during 1992 is provided.
US crude oil, natural gas, and natural gas liquids reserves, 1992 annual report
International Nuclear Information System (INIS)
1993-01-01
This report presents estimates of proved reserves of crude oil, natural gas, and natural gas liquids as of December 31, 1992, as well as production volumes for the United States, and selected States and State subdivisions for the year 1992. Estimates are presented for the following four categories of natural gas: total gas (wet after lease separation), its two major components (nonassociated and associated-dissolved gas), and total dry gas (wet gas adjusted for the removal of liquids at natural gas processing plants). In addition, two components of natural gas liquids, lease condensate and natural gas plant liquids, have their reserves and production data presented. Also included is information on indicated additional crude oil reserves and crude oil, natural gas, and lease condensate reserves in nonproducing reservoirs. A discussion of notable oil and gas exploration and development activities during 1992 is provided
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
The overall aim of the project was to gain more knowledge about the kinetics of gas hydrate formation especially the early growth phase. Knowledge of kinetics of gas hydrate formation is important and measurements of gas hydrate particle size and concentration can contribute to improve this knowledge. An experimental setup for carrying out experimental studies of the nucleation and growth of gas hydrates has been constructed and tested. Multi wavelength extinction (MWE) was the experimental technique selected for obtaining particle diameter and concentration. The principle behind MWE is described as well as turbidity spectrum analysis that in an initial stage of the project was considered as an alternative experimental technique. Details of the experimental setup and its operation are outlined. The measuring cell consists of a 1 litre horizontal tube sustaining pressures up to 200 bar. Laser light for particle size determination can be applied through sapphire windows. A description of the various auxiliary equipment and of another gas hydrate cell used in the study are given. A computer program for simulation and analysis of gas hydrate experiments is based on the gas hydrate kinetics model proposed by Skovborg and Rasmussen (1993). Initial measurements showed that knowledge of the refractive index of gas hydrates was important in order to use MWE. An experimental determination of the refractive index of methane and natural gas hydrate is described. The test experiments performed with MWE on collectives of gas hydrate particles and experiments with ethane, methane and natural gas hydrate are discussed. Gas hydrate particles initially seem to grow mainly in size and at latter stages in number. (EG) EFP-94; 41 refs.
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-31
The overall aim of the project was to gain more knowledge about the kinetics of gas hydrate formation especially the early growth phase. Knowledge of kinetics of gas hydrate formation is important and measurements of gas hydrate particle size and concentration can contribute to improve this knowledge. An experimental setup for carrying out experimental studies of the nucleation and growth of gas hydrates has been constructed and tested. Multi wavelength extinction (MWE) was the experimental technique selected for obtaining particle diameter and concentration. The principle behind MWE is described as well as turbidity spectrum analysis that in an initial stage of the project was considered as an alternative experimental technique. Details of the experimental setup and its operation are outlined. The measuring cell consists of a 1 litre horizontal tube sustaining pressures up to 200 bar. Laser light for particle size determination can be applied through sapphire windows. A description of the various auxiliary equipment and of another gas hydrate cell used in the study are given. A computer program for simulation and analysis of gas hydrate experiments is based on the gas hydrate kinetics model proposed by Skovborg and Rasmussen (1993). Initial measurements showed that knowledge of the refractive index of gas hydrates was important in order to use MWE. An experimental determination of the refractive index of methane and natural gas hydrate is described. The test experiments performed with MWE on collectives of gas hydrate particles and experiments with ethane, methane and natural gas hydrate are discussed. Gas hydrate particles initially seem to grow mainly in size and at latter stages in number. (EG) EFP-94; 41 refs.
Analysis of a multicomponent gas absorption system with carrier gas coabsorption
International Nuclear Information System (INIS)
Merriman, J.R.
1975-03-01
Conventional integrated versions of the packed gas absorber design equations do not account for significant coabsorption of the carrier gas along with the dilute transferring species. These equations, as a result, also neglect the relationship between dilute component transfer and carrier gas coabsorption. In the absorption of Kr and Xe from various carrier gases, using CCl 2 F 2 as the process solvent, carrier coabsorption is substantial. Consequently, a design package was developed to deal with multicomponent gas absorption in systems characterized by carrier gas coabsorption. Developed within the general film theory framework, the basic feature of this design approach is a view of dilute component mass-transfer as a conventional diffusive transfer superimposed on a net flux caused by carrier absorption. Other supporting elements of the design package include predictive techniques for various fluid properties, estimating procedures for carrier gas equilibrium constants, and correlations for carrier gas and dilute gas mass-transfer coefficients. When applied to systems using CCl 2 F 2 as the solvent; He, N 2 , air, or Ar as the carrier gas; and Kr or Xe as the dilute gas; the design approach gave good results, even when extended to conditions well beyond those of its development. (U.S.)
Survey of stranded gas and delivered costs to Europe of selected gas resources
Attanasi, E.D.; Freeman, P.A.
2011-01-01
Two important trends affecting the expected growth of global gas markets are (1) the shift by many industrialized countries from coal-fired electricity generation to the use of natural gas to generate electricity and (2) the industrialization of the heavily populated Asian countries of India and China. This paper surveys discovered gas in stranded conventional gas accumulations and presents estimates of the cost of developing and producing stranded gas in selected countries. Stranded gas is natural gas in discovered or identified fields that is not currently commercially producible for either physical or economic reasons. Published reserves of gas at the global level do not distinguish between volumes of gas in producing fields and volumes in nonproducing fields. Data on stranded gas reported here-that is the volumes, geographical distribution, and size distributions of stranded gas fields at the country and regional level-are based on the examination of individual-field data and represent a significant improvement in information available to industry and government decision makers. Globally, stranded gas is pervasive, but large volumes in large accumulations are concentrated in only a few areas. The cost component of the paper focuses on stranded conventional gas accumulations in Africa and South America that have the potential to augment supplies to Europe. The methods described for the computation of extraction and transport costs are innovative in that they use information on the sizes and geographical distribution of the identified stranded gas fields. The costs are based on industry data specific to the country and geologic basin where the stranded gas is located. Gas supplies to Europe can be increased significantly at competitive costs by the development of stranded gas. Net extraction costs of producing the identified gas depend critically on the natural-gas-liquids (NGLs) content, the prevailing prices of liquids, the size of the gas accumulation, and the
US crude oil, natural gas, and natural gas liquids reserves 1996 annual report
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-01
The EIA annual reserves report series is the only source of comprehensive domestic proved reserves estimates. This publication is used by the Congress, Federal and State agencies, industry, and other interested parties to obtain accurate estimates of the Nation`s proved reserves of crude oil, natural gas, and natural gas liquids. These data are essential to the development, implementation, and evaluation of energy policy and legislation. This report presents estimates of proved reserves of crude oil, natural gas, and natural gas liquids as of December 31, 1996, as well as production volumes for the US and selected States and State subdivisions for the year 1996. Estimates are presented for the following four categories of natural gas: total gas (wet after lease separation), nonassociated gas and associated-dissolved gas (which are the two major types of wet natural gas), and total dry gas (wet gas adjusted for the removal of liquids at natural gas processing plants). In addition, reserve estimates for two types of natural gas liquids, lease condensate and natural gas plant liquids, are presented. Also included is information on indicated additional crude oil reserves and crude oil, natural gas, and lease condensate reserves in nonproducing reservoirs. A discussion of notable oil and gas exploration and development activities during 1996 is provided. 21 figs., 16 tabs.
Shale gas - los yacimientos de hidrocarburos no convencionales: origen del Shale gas
Directory of Open Access Journals (Sweden)
José Francisco Longoria Treviño
2015-06-01
Full Text Available El shale gas tiene su origen en la acumulación de materia orgánica en cuencas marinas. En Norteamérica el gas de lutita (shale gas es una fuente emergente de gas natural de bajo costo. El gas natural es una fuente de energía abundante y relativamente limpia al quemarse. Se ha convertido en un combustible popular tanto para aplicaciones residenciales como industriales. De acuerdo con los datos recientes se estima que el suministro de gas natural derivado de yacimientos no convencionales (gas de lutita – shale gas durará más de 100 años. El gas natural ofrece un remplazo potencial para sustituir a los combustibles fósiles que producen gases de efecto invernadero y que en la actualidad se usan en la generación de energía, calefacción y transporte. Las emisiones de gas de efecto invernadero de la combustión de gas natural son aproximadamente 30% más limpias que aquellas que se derivan del aceite y 45% más limpias de las del carbón.
George, C.M.
1957-12-31
A liquid piston gas pump is described, capable of pumping minute amounts of gas in accurately measurable quantities. The pump consists of a flanged cylindrical regulating chamber and a mercury filled bellows. Sealed to the ABSTRACTS regulating chamber is a value and having a gas inlet and outlet, the inlet being connected by a helical channel to the bellows. A gravity check valve is in the gas outlet, so the gas passes through the inlet and the helical channel to the bellows where the pumping action as well as the metering is accomplished by the actuation of the mercury filled bellows. The gas then flows through the check valve and outlet to any associated apparatus.
An Ideal Gas Law Simulator for Atmospheric Gas Molecules ...
African Journals Online (AJOL)
The ideal gas law which is the equation of state of a hypothetical ideal gas that allows us to gain useful insights into the behavior of most real gases at low densities was utilized in this work to conceptualize, design and develop the ideal gas law simulator in a 3 dimensional space using Microsoft Visual Studio, Microsoft ...
International Nuclear Information System (INIS)
Gay, D.D.
1986-01-01
This patent describes disposable gas ampoule holding or containing a gas such as a radioactive gas, comprising: (a) a cylindrical glass tube which is adapted to hold the gas; (b) a layer of absorbent material which circumscribes and which contacts cylindrical glass tube (a) which absorbs the gas; (c) a plastic tube, which circumscribes and contacts absorbent material layer (b) and which is externally threaded on each of its end portions; (d) a cap, which is threaded onto a first end of plastic tube (c); (e) a cylindrical block, which is positioned in the first end of cylindrical glass tube (a) adjacent to cap (d), which contacts cylindrical glass tube (a), which is composed of a foamed material and which is impregnated with a gas adsorbent material; (f) a cylindrical plunger tip, which is located in the first end of cylindrical glass tube (a) in a gas-tight manner adjacent to cylindrical block (e); (g) an end stopper, which has a central cylindrical shaft that is positioned in the second end of cylindrical glass tube (a); and (h) a cap, which is threaded onto the second end of plastic tube (e). A combination of the disposable gas ampoule and syringe adapted to operably interface with the gas ampoule is also described
International Nuclear Information System (INIS)
Icart, Laura; Jean, Pascale; Georget, Cyrille; Schmill, Rafael
2017-01-01
This document contains 12 articles notably addressing the importance of natural gas production and supplies in Europe. The themes of the articles are: the advantages of natural gas in the context of energy and environmental policies, energy diversification, energy supply in the local territories, etc.; the position of GrDF, one of the main French natural gas supplier; LPG (butane, propane), a solution which popularity grows in remote areas; the Gaya project (production of renewable gas from dry biomass); a panorama of gas supply routes in Europe; the situation of gas in Europe's energy supply and consumption; the promotion of LNG fuel for maritime and fluvial ships; why the small scale LNG could be the next revolution; presentation of the new 'Honfleur' ferry (using LNG fuel) that will cross the English Channel by 2019; carbon market and the role of ETS for the energy policy in Europe facing the climatic change challenge; presentation of the French 'Climate Plan' that aims to engage France into a carbon neutrality by 2050; presentation of the French policy against air pollution; economic growth, energy, climate: how to square this circle?
International Nuclear Information System (INIS)
Hartnell, Gaynor
2000-01-01
Following the UK Government's initiative for stimulating renewable energy through the Non-Fossil Fuel Obligation (NFFO), the UK landfill gas industry has more than trebled in size in just 4 years. As a result, UK companies are now in a strong position to offer their skills and services overseas. Ireland, Greece and Spain also resort heavily to disposal to landfill. Particularly rapid growth of the landfill gas market is expected in the OECD-Pacific and NAFTA areas. The article explains that landfill gas is a methane-rich mixture produced by anaerobic decomposition of organic wastes in landfills: under optimum conditions, up to 500 cubic meters of gas can be obtained from 1 tonne of biodegradable waste. Data on the number and capacity of sites in the UK are given. The Landfill Gas Association runs courses to counteract the skills shortage in the UK, and tailored courses for overseas visitors are planned
Radon gas in oil and natural gas production facilities
International Nuclear Information System (INIS)
Chandler, W.P.
1994-01-01
Radon gas is a naturally occurring radionuclide that can be found in some oil and natural gas production facilities, either as a contaminant in a natural gas stream or derived from Radium dissolved in formation waters. The gas itself is not normally a health hazard, but it's decay products, which can be concentrated by plate-out or deposition as a scale in process equipment, can be a health hazard for maintenance personnel. To evaluate possible health hazards, it is necessary to monitor for naturally occurring radioactive materials (NORM) in the gas stream and in the formation water. If Radon and/or Radium is found, a monitoring programme should be initiated to comply with National or State requirements. In some instances, it has been found necessary to dispose of silt and scale materials as low level radioactive waste. 8 refs
U.S. crude oil, natural gas, and natural gas liquids reserves 1997 annual report
Energy Technology Data Exchange (ETDEWEB)
Wood, John H.; Grape, Steven G.; Green, Rhonda S.
1998-12-01
This report presents estimates of proved reserves of crude oil, natural gas, and natural gas liquids as of December 31, 1997, as well as production volumes for the US and selected States and State subdivisions for the year 1997. Estimates are presented for the following four categories of natural gas: total gas (wet after lease separation), nonassociated gas and associated-dissolved gas (which are the two major types of wet natural gas), and total dry gas (wet gas adjusted for the removal of liquids at natural gas processing plants). In addition, reserve estimates for two types of natural gas liquids, lease condensate and natural gas plant liquids, are presented. Also included is information on indicated additional crude oil reserves and crude oil, natural gas, and lease condensate reserves in nonproducing reservoirs. A discussion of notable oil and gas exploration and development activities during 1997 is provided. 21 figs., 16 tabs.
Monitoring gas quality green gas feeding in; Monitoring gaskwaliteit groengasinvoeding
Energy Technology Data Exchange (ETDEWEB)
Holstein, J. [DNV KEMA Energy and Sustainability, Arnhem (Netherlands); Polman, E. [Kiwa Technology, Apeldoorn (Netherlands)
2013-04-15
Due to the growing number of green gas facilities in the Netherlands more practical knowledge is collected about the production and injection of green gas. Also there was the need to gather data about more practical experiences and knowledge about the gas quality, the performance of gas cleaning and gas treatment systems, as well the integration of green gas in the gas infrastructure. In addition to this, there is a need to get insight in the safety aspects of green gas injection. In order to comply this demand, DNV KEMA en Kiwa Technology measured the quality parameters continuously between June 2012 en January 2013 (three weeks) and discontinuously (gas samples) of green gas at eight production facilities. The measurements have been performed at designated places and are independent from the measurements of the biomethane producer. In order to be sure that the results of DNV KEMA and Kiwa are comparable, a combined measurement program was executed. It results in uniformity for all the measured values: the differences are within the uncertainty level for each component. During the measurement period of three weeks, the gas quality parameters were compared to specifications, written down in the national regulations for the transport and the distribution grid respectively [Dutch] Door het groeiend aantal groengasinvoedingen in Nederland wordt steeds meer praktijkkennis verzameld. Er dient meer praktijkkennis te worden verzameld over de chemische gaskwaliteit, prestaties van de gasreiniging- en gasopwaardering en de wijze van inpassing in de bestaande infrastructuur. Daarnaast is het wenselijk om inzicht te verkrijgen in de veiligheid van groengasinvoeding. Daarop is de groengaskwaliteit op acht locaties over een periode van drie weken continu en discontinu gemeten tussen juni 2012 en januari 2013. De metingen zijn uitgevoerd op een aangewezen plaats door de netbeheerder en staan los van de metingen van de invoeders zelf. Voor het waarborgen van de uniformiteit van
Energy Technology Data Exchange (ETDEWEB)
De Nardo, L., E-mail: laura.denardo@unipd.it [University of Padova, Physics and Astronomy Department and PD-INFN, via Marzolo 8, I-35131 Padova (Italy); Farahmand, M., E-mail: majid.farahmand@rivm.nl [Centre for Environmental Safety and Security, National Institute for Public Health and the Environment (RIVM), PO Box 1, NL-3720 BA Bilthoven (Netherlands)
2016-05-21
A Tissue-Equivalent Proportional Counter (TEPC), based on a single GEM foil of standard geometry, has been tested with pure propane gas at low pressure, in order to simulate a tissue site of about 1 µm equivalent size. In this work, the performance of GEM with propane gas at a pressure of 21 and 28 kPa will be presented. The effective gas gain was measured in various conditions using a {sup 244}Cm alpha source. The dependence of effective gain on the electric field strength along the GEM channel and in the drift and induction region was investigated. A maximum effective gain of about 5×10{sup 3} has been reached. Results obtained in pure propane gas are compared with gas gain measurements in gas mixtures commonly employed in microdosimetry, that is propane and methane based Tissue-Equivalent gas mixtures.
A Gas Target with a Tritium Gas Handling System
Energy Technology Data Exchange (ETDEWEB)
Holmqvist, B; Wiedling, T
1963-12-15
A detailed description is given of a simple tritium gas target and its tritium gas filling system, and how to put it into operation. By using the T (p,n) He reaction the gas target has been employed for production of monoenergetic fast neutrons of well defined energy and high intensity. The target has been operated successfully for a long time.
Laser Gas-Analyser for Monitoring a Source of Gas Pollution
Directory of Open Access Journals (Sweden)
V. A. Gorodnichev
2015-01-01
Full Text Available Currently, the problem of growing air pollution of the Earth is of relevance. Many countries have taken measures to protect the environment in order to limit the negative anthropogenic impacts.In such a situation an objective information on the actual content of pollutants in the atmosphere is of importance. For operational inspection of the pollutant concentrations and for monitoring pollution sources, it is necessary to create high-speed high-sensitivity gas analysers.Laser meters are the most effective to provide operational remote and local inspection of gas pollution of the Earth atmosphere.Laser meter for routine gas analysis should conduct operational analysis of the gas mixture (air. For this a development of appropriate information support is required.Such information support should include a database with absorption coefficients of pollutants (specific to potential sources of pollution at possible measuring wavelengths (holding data for a particular emitter of the laser meter and an efficient algorithms to search the measuring wavelengths and conduct a quantitative analysis of gas mixtures.Currently, the issues, important for practice and related to the development of information support for the laser gas analyzer to conduct important for practice routine measurements remain unclear.In this paper we develop an algorithm to provide an operational search of the measuring wavelengths of laser gas analyser and an algorithm to recover quantitively the gaseous component concentrations of controlled gas mixture from the laser multi-spectral measurements that take into account a priori information about the source-controlled gas pollution and do not require a large amount of computation. The method of mathematical simulation shows the effectiveness of the algorithms described both for seach of measuring wavelengths and for quantitative analysis of gas releases.
Lorenson, T.D.
1999-01-01
Molecular and isotopic composition of gases from the JAPEX/JNOC/GSC Mallik 2L-38 gas hydrate research well demonstrate that the in situ gases can be divided into three zones composed of mixtures of microbial and thermogenic gases. Sediments penetrated by the well are thermally immature; thus the sediments are probably not a source of thermogenic gas. Thermogenic gas likely migrated from depths below 5000 m. Higher concentrations of gas within and beneath the gas hydrate zone suggest that gas hydrate is a partial barrier to gas migration. Gas hydrate accumulations occur wholly within zone 3, below the base of permafrost. The gas in gas hydrate resembles, in part, the thermogenic gas in surrounding sediments and gas desorbed from lignite. Gas hydrate composition implies that the primary gas hydrate form is Structure I. However, Structure II stabilizing gases are more concentrated and isotopically partitioned in gas hydrate relative to the sediment hosting the gas hydrate, implying that Structure II gas hydrate may be present in small quantities.
World`s gas field and establishment of gas-specific database
Energy Technology Data Exchange (ETDEWEB)
Seong, W M [Hanyang Unversity, Seoul (Korea, Republic of)
1998-05-01
As the natural gas demand of each country of the world including Korea continuously increases, it will be very important to diversify the characteristics of import areas and import gas as well as the import method for the stable and long-term supply. This study collects information such as reserves, the possibility of production, gas composition, etc. of gas fields that are spread all over the world with areas that can be developed or simply imported under the current conditions of Korea, and analyzed the projects that can be supplied through pipelines and information on non-conventional gas field that can be estimated in the future. 35 refs., 3 figs., 28 tabs.
Energy Technology Data Exchange (ETDEWEB)
Luebbe, D.
1987-07-01
The innovative US calculation method for natural gas real gas factors is applicable to great pressure and temperature ranges and does not involve any restrictions as to the quality of natural gas. The results obtained for natural gas coming from Northern Germany or for imported natural gas are well consistent with actual measuring results. The model can therefore be applied as a rule for computing in a new technical recommendation and determine real gas factors whenever they are relevant to trading. The respective calculations must be preceded by a complete analysis characterizing the quality of gases. However, the new method allows for the alternative calculation of real gas factors on the basis of a small number of easily measurable factors (for example H/sub 0/, d, CO/sub 2/). This quality seams to be all the more attractive as it allows for an automatic translation of parametric sets at changing gas qualities which for the first time can manage without an expensive online gas chromatography or density translators, respectively.
Gas Transfer in Cellularized Collagen-Membrane Gas Exchange Devices.
Lo, Justin H; Bassett, Erik K; Penson, Elliot J N; Hoganson, David M; Vacanti, Joseph P
2015-08-01
Chronic lower respiratory disease is highly prevalent in the United States, and there remains a need for alternatives to lung transplant for patients who progress to end-stage lung disease. Portable or implantable gas oxygenators based on microfluidic technologies can address this need, provided they operate both efficiently and biocompatibly. Incorporating biomimetic materials into such devices can help replicate native gas exchange function and additionally support cellular components. In this work, we have developed microfluidic devices that enable blood gas exchange across ultra-thin collagen membranes (as thin as 2 μm). Endothelial, stromal, and parenchymal cells readily adhere to these membranes, and long-term culture with cellular components results in remodeling, reflected by reduced membrane thickness. Functionally, acellular collagen-membrane lung devices can mediate effective gas exchange up to ∼288 mL/min/m(2) of oxygen and ∼685 mL/min/m(2) of carbon dioxide, approaching the gas exchange efficiency noted in the native lung. Testing several configurations of lung devices to explore various physical parameters of the device design, we concluded that thinner membranes and longer gas exchange distances result in improved hemoglobin saturation and increases in pO2. However, in the design space tested, these effects are relatively small compared to the improvement in overall oxygen and carbon dioxide transfer by increasing the blood flow rate. Finally, devices cultured with endothelial and parenchymal cells achieved similar gas exchange rates compared with acellular devices. Biomimetic blood oxygenator design opens the possibility of creating portable or implantable microfluidic devices that achieve efficient gas transfer while also maintaining physiologic conditions.
Gas hydrates in gas storage caverns; Gashydrate bei der Gaskavernenspeicherung
Energy Technology Data Exchange (ETDEWEB)
Groenefeld, P. [Kavernen Bau- und Betriebs-GmbH, Hannover (Germany)
1997-12-31
Given appropriate pressure and temperature conditions the storage of natural gas in salt caverns can lead to the formation of gas hydrates in the producing well or aboveground operating facilities. This is attributable to the stored gas becoming more or less saturated with water vapour. The present contribution describes the humidity, pressure, and temperature conditions conducive to gas hydrate formation. It also deals with the reduction of the gas removal capacity resulting from gas hydrate formation, and possible measures for preventing hydrate formation such as injection of glycol, the reduction of water vapour absorption from the cavern sump, and dewatering of the cavern sump. (MSK) [Deutsch] Bei der Speicherung von Erdgas in Salzkavernen kann es unter entsprechenden Druck- und Temperaturverhaeltnissen zur Gashydratbildung in den Foerdersonden oder obertaegigen Betriebseinrichtungen kommen, weil sich das eingelagerte Gas mehr oder weniger mit Wasserdampf aufsaettigt. Im Folgenden werden die Feuchtigkeits-, Druck- und Temperaturbedingungen, die zur Hydratbildung fuehren erlaeutert. Ebenso werden die Verringerung der Auslagerungskapazitaet durch die Hydratbildung, Massnahmen zur Verhinderung der Hydratbildung wie die Injektion von Glykol, die Verringerung der Wasserdampfaufnahme aus dem Kavernensumpf und die Entwaesserung der Kavernensumpfs selbst beschrieben.
International Nuclear Information System (INIS)
1996-01-01
The Asia region has experienced a period of dynamic growth, both of economies and energy demand. The next fifteen years are likely to see further rapid economic growth in Asia. To fuel this growth energy consumption will also increase rapidly. Of all forms of energy, natural gas demand is likely to grow the fastest. The gas sector will face rapid and dramatic change, creating challenges for the governments of the region. Infrastructure, both for export and domestic consumption of gas, will need to expand significantly. Regional trade in natural gas could triple by 2010. Trade will continue to be dominated by liquefied natural gas (LNG) but pipeline exports will also grow rapidly. Investment needs will be large, putting pressure on governments to look for alternative funding mechanisms. As Asian gas transmission and distribution networks expand and become more interconnected, consumer choice becomes possible. How to encourage and regulate competition will become a vital policy question. As gas consumption increases both in absolute terms, and in terms of its share of energy consumption within particular sectors of the economy (for example, as a fuel for power generation), governments will need to give higher priority to policies dealing with gas security. This study examines the current and possible future role of natural gas in Asia. In particular, it examines in detail the relevant energy policies of six of the key gas producing and consuming economies in the region: Brunei-Darussalam, Chinese Taipei, Indonesia, the Republic of Korea, Malaysia and Thailand. (author). 17 figs., 14 tabs., 7 appends
Gas supplies of interstate natural gas pipeline companies 1990
International Nuclear Information System (INIS)
1992-01-01
This publication provides information on the interstate pipeline companies' supply of natural gas in the United States during calendar year 1990, for use by the Federal Energy Regulatory Commission for regulatory purposes. It also provides information to other Government agencies, the natural gas industry, as well as policy makers, analysts, and consumers interested in current levels of interstate supplies of natural gas and trends over recent years
Ruppel, Carolyn D.
2018-01-17
Gas hydrate is a naturally occurring, ice-like substance that forms when water and gas combine under high pressure and at moderate temperatures. Methane is the most common gas present in gas hydrate, although other gases may also be included in hydrate structures, particularly in areas close to conventional oil and gas reservoirs. Gas hydrate is widespread in ocean-bottom sediments at water depths greater than 300–500 meters (m; 984–1,640 feet [ft]) and is also present in areas with permanently frozen ground (permafrost). Several countries are evaluating gas hydrate as a possible energy resource in deepwater or permafrost settings. Gas hydrate is also under investigation to determine how environmental change may affect these deposits.
International Nuclear Information System (INIS)
2015-01-01
A first part proposes an overview of the current situation of the gas market and predictions regarding gas consumption and turnovers of gas producers and dealers, indication of important recent events, and a dashboard of the sector activity. A second part proposes an annual report on trends and on the competition context. It describes the activity structure (sector organisations, gas types, main customers, heating modes in French housing, tariff offers), indicates the main determining factors for the sector activity, describes the context (temperature evolution, thermal electricity production, production of the chemical industry, housing stock, natural gas consumption), analyses the evolution of the sector activity (trends, indicators), describes the sector economic structure (upstream sector, gas supply), and gives an overview of actors: historical suppliers, alternate suppliers, highlights of the sector, company rankings, and financial performance
Natural gas retailing: writing the last chapter of natural gas deregulation
International Nuclear Information System (INIS)
Bjerkelund, T.
1995-01-01
Under the A greement on Natural Gas Markets and Prices of October 1985, the Canadian federal government agreed to deregulate the price of natural gas and to allow a competitive gas market to develop. Several beneficial changes that have occurred as a result of the deregulation were described, including the Industrial Gas Users Association's (IGUA) view on the marketing and sale of natural gas by local gas distributor's (LDC) and the sale within the LDC franchise. IGUA's support for the separation between LDC distribution and LDC sales and marketing activities as the last step in deregulation process, was explained. Several arguments for the opposing view were also discussed. Recommendations were made for effective separation of LDC distribution and LDC sales/marketing activities
Geochemical evidence of water-soluble gas accumulation in the Weiyuan gas field, Sichuan Basin
Directory of Open Access Journals (Sweden)
Shengfei Qin
2016-01-01
Full Text Available At present, there are several different opinions on the formation process of the Weiyuan gas field in the Sichuan Basin and the source of its natural gas. In view of the fact that the methane carbon isotope of the natural gas in the Weiyuan gas field is abnormally heavy, the geologic characteristics of gas reservoirs and the geochemical characteristics of natural gas were first analyzed. In the Weiyuan gas field, the principal gas reservoirs belong to Sinian Dengying Fm. The natural gas is mainly composed of methane, with slight ethane and trace propane. The gas reservoirs are higher in water saturation, with well preserved primary water. Then, it was discriminated from the relationship of H2S content vs. methane carbon isotope that the heavier methane carbon isotope of natural gas in this area is not caused by thermochemical sulfate reduction (TSR. Based on the comparison of methane carbon isotope in this area with that in adjacent areas, and combined with the tectonic evolution background, it is regarded that the natural gas in the Weiyuan gas field is mainly derived from water-soluble gas rather than be migrated laterally from adjacent areas. Some conclusions are made. First, since methane released from water is carbon isotopically heavier, the water-soluble gas accumulation after degasification results in the heavy methane carbon isotope of the gas produced from Weiyuan gas field. Second, along with Himalayan movement, great uplift occurred in the Weiyuan area and structural traps were formed. Under high temperature and high pressure, the gas dissolved in water experienced decompression precipitation, and the released natural gas accumulated in traps, consequently leading to the formation of Weiyuan gas field. Third, based on calculation, the amount of natural gas released from water which is entrapped in the Weiyuan gas field after the tectonic uplift is basically equal to the proved reserves of this field, confirming the opinion of water
Gas assessment and perspectives
International Nuclear Information System (INIS)
Ferrier, Jerome; Bouchard, Georges; Al-Saffar, Ali; ); Bros, Thierry; Khayat, Armand; Leger, Sebastien; Nyouki, Evariste; Jamme, Dominique; Remont, Sophie; Delamare, Monique; Hureau, Geoffroy; Poillion, Christophe; Noilhan, Fabrice; Lafon, Madeleine; Lagumina, Sandra
2015-01-01
This document reports the content of contributions and debates of the 'Gas assessment and perspectives' convention organised by the AFG (the French Gas Association) in March 2015. After an introduction speech, a contributor proposed a comment of the 'World energy outlook 2014' (discussion of factors related to demand and to supply, pressures related to climate change). A round table discussed the context and overview of the gas market, and more precisely addressed the evolution of the gas European market on the short term (demand, storage, production, imports, LNG market), the gas demand for electricity production (the electricity European market, impact on gas, European perspectives, the gas market, three scenarios of evolution of gas demand, World perspectives), the European gas demand on the medium term (the control of gas price in Europe, the final decline of gas, the assessment of the European energy policy, the divorce between Russia and Europe), the recent trends and perspectives for the LNG market (price evolution, a still comfortable market, LNG back in Europe, demand and supply, LNG in the global energy mix), and an assessment of the French gas market by the CRE (the French Commission on Energy Regulation). A second round table addressed the security of gas supply: status and perspectives for the European gas supply, stress tests and measures on the short term to improve supply security, role of the State in the security of gas supply, storage as a key tool for the security of supply, development of new policy for security of supplies. The last speech stated the point of view of a GrDF manager
Catalytic hot gas cleaning of gasification gas
Energy Technology Data Exchange (ETDEWEB)
Simell, P. [VTT Energy, Espoo (Finland). Energy Production Technologies
1997-12-31
The aim of this work was to study the catalytic cleaning of gasification gas from tars and ammonia. In addition, factors influencing catalytic activity in industrial applications were studied, as well as the effects of different operation conditions and limits. Also the catalytic reactions of tar and ammonia with gasification gas components were studied. The activities of different catalyst materials were measured with laboratory-scale reactors fed by slip streams taken from updraft and fluid bed gasifiers. Carbonate rocks and nickel catalysts proved to be active tar decomposing catalysts. Ammonia decomposition was in turn facilitated by nickel catalysts and iron materials like iron sinter and iron dolomite. Temperatures over 850 deg C were required at 2000{sup -1} space velocity at ambient pressure to achieve almost complete conversions. During catalytic reactions H{sub 2} and CO were formed and H{sub 2}O was consumed in addition to decomposing hydrocarbons and ammonia. Equilibrium gas composition was almost achieved with nickel catalysts at 900 deg C. No deactivation by H{sub 2}S or carbon took place in these conditions. Catalyst blocking by particulates was avoided by using a monolith type of catalyst. The apparent first order kinetic parameters were determined for the most active materials. The activities of dolomite, nickel catalyst and reference materials were measured in different gas atmospheres using laboratory apparatus. This consisted of nitrogen carrier, toluene as tar model compound, ammonia and one of the components H{sub 2}, H{sub 2}O, CO, CO{sub 2}, CO{sub 2}+H{sub 2}O or CO+CO{sub 2}. Also synthetic gasification gas was used. With the dolomite and nickel catalyst the highest toluene decomposition rates were measured with CO{sub 2} and H{sub 2}O. In gasification gas, however, the rate was retarded due to inhibition by reaction products (CO, H{sub 2}, CO{sub 2}). Tar decomposition over dolomite was modelled by benzene reactions with CO{sub 2}, H
Combustion heating value gas in a gas turbine
Energy Technology Data Exchange (ETDEWEB)
Kelsall, G [CTDD, British Coal Corporation, Cheltenham (United Kingdom); Cannon, M [European Gas Turbines Ltd., Lincoln (United Kingdom)
1997-12-31
Advanced coal and/or biomass based power generation systems offer the potential for high efficiency electricity generation with minimum environmental impact. An important component for many of these advanced power generation cycles is the gas turbine, for which development of a combustion system to burn low calorific value coal derived fuel gas, at turbine inlet temperatures of typically 1 100 - 1 260 deg C and with minimum pollutant emissions, is a key issue. A phased combustor development programme is under-way burning low calorific value fuel gas (3.6 - 4.1 MJ/m{sup 3}) with low emissions, particularly NO{sub x} derived from fuel-bound nitrogen. The first and second phases of the combustor development programme have been completed. The first phase used a generic tubo-annular, prototype combustor based on conventional design principles. Combustor performance for this first prototype combustor was encouraging. The second phase assessed five design variants of the prototype combustor, each variant achieving a progressive improvement in combustor performance. The operating conditions for this assessment were selected to represent a particular medium sized industrial gas turbine operating as part of an Air Blown Gasification Cycle (ABGC). The test conditions assessed therefore included the capability to operate the combustor using natural gas as a supplementary fuel, to suit one possible start-up procedure for the cycle. The paper presents a brief overview of the ABGC development initiative and discusses the general requirements for a gas turbine operating within such a cycle. In addition, it presents full combustor performance results for the second phase of turbine combustor development and discusses the rationale for the progressive design modifications made within that programme. The strategy for the further development of the combustor to burn low calorific value fuel gas with very low conversion of fuel-bound nitrogen to NO{sub x} is presented. (orig.) 6 refs.
Combustion heating value gas in a gas turbine
Energy Technology Data Exchange (ETDEWEB)
Kelsall, G. [CTDD, British Coal Corporation, Cheltenham (United Kingdom); Cannon, M. [European Gas Turbines Ltd., Lincoln (United Kingdom)
1996-12-31
Advanced coal and/or biomass based power generation systems offer the potential for high efficiency electricity generation with minimum environmental impact. An important component for many of these advanced power generation cycles is the gas turbine, for which development of a combustion system to burn low calorific value coal derived fuel gas, at turbine inlet temperatures of typically 1 100 - 1 260 deg C and with minimum pollutant emissions, is a key issue. A phased combustor development programme is under-way burning low calorific value fuel gas (3.6 - 4.1 MJ/m{sup 3}) with low emissions, particularly NO{sub x} derived from fuel-bound nitrogen. The first and second phases of the combustor development programme have been completed. The first phase used a generic tubo-annular, prototype combustor based on conventional design principles. Combustor performance for this first prototype combustor was encouraging. The second phase assessed five design variants of the prototype combustor, each variant achieving a progressive improvement in combustor performance. The operating conditions for this assessment were selected to represent a particular medium sized industrial gas turbine operating as part of an Air Blown Gasification Cycle (ABGC). The test conditions assessed therefore included the capability to operate the combustor using natural gas as a supplementary fuel, to suit one possible start-up procedure for the cycle. The paper presents a brief overview of the ABGC development initiative and discusses the general requirements for a gas turbine operating within such a cycle. In addition, it presents full combustor performance results for the second phase of turbine combustor development and discusses the rationale for the progressive design modifications made within that programme. The strategy for the further development of the combustor to burn low calorific value fuel gas with very low conversion of fuel-bound nitrogen to NO{sub x} is presented. (orig.) 6 refs.
Natural Gas Liberalisation and Deregulation - The German Gas Industry's View
International Nuclear Information System (INIS)
Czernie, W.
2001-01-01
In Europe, the process of creating a single energy market is under way. The 1998 Gas Directive established an important date for the European gas industry. On 10 August 1998, ''Directive 98/30/EC of the European Parliament and of the Council of 22 June 1998 concerning common rules for the internal market in natural gas'' came into force. It had to be transposed into national law by the EU member states within two years, i.e. by 10 August 2000. The Directive is a cornerstone in establishing a competitive gas market in the European Union. It is the outcome of several years of negotiations and can be regarded as a compromise between the various interests. On the whole, it leaves EU member states with sufficient scope for adequately taking account of national characteristics in keeping with the principle of subsidiarity. The process of transposing the Gas Directive into the national law of individual EU member states is being closely followed by the European Commission. While acknowledging all the progress made in the single market process, the Commission still detects shortcomings in the implementation of the Gas Directive on the road to an actual single market. This is seen as a justification for new initiatives and intervention, even though the new political framework for the gas industry has not yet been tested in practice and been able to prove itself on a broad scale for any length of time. In the debate on liberalisation, tried-and-tested instruments of secure and market-oriented gas supply on the European continent long-term supply contracts with take-or-pay clauses and competitive oil-indexed gas prices have also come under scrutiny. However, even under the conditions of liberalisation, security of supply has to be achieved mainly by a balanced mix of supply sources and by long-term supply contracts, including competitive pricing as ensured by so-called oil indexing. In the further liberalisation of west European gas industries, it will be essential to ensure
Skarstrom, C.W.
1960-09-01
A gas lubricated bearing for a rotating shaft is described. The assembly comprises a stationary collar having an annular member resiliently supported thereon. The collar and annular member are provided with cooperating gas passages arranged for admission of pressurized gas which supports and lubricates a bearing block fixed to the rotatable shaft. The resilient means for the annular member support the latter against movement away from the bearing block when the assembly is in operation.
A new method for calculating gas saturation of low-resistivity shale gas reservoirs
Directory of Open Access Journals (Sweden)
Jinyan Zhang
2017-09-01
Full Text Available The Jiaoshiba shale gas field is located in the Fuling area of the Sichuan Basin, with the Upper Ordovician WufengâLower Silurian Longmaxi Fm as the pay zone. At the bottom of the pay zone, a high-quality shale gas reservoir about 20Â m thick is generally developed with high organic contents and gas abundance, but its resistivity is relatively low. Accordingly, the gas saturation calculated by formulas (e.g. Archie using electric logging data is often much lower than the experiment-derived value. In this paper, a new method was presented for calculating gas saturation more accurately based on non-electric logging data. Firstly, the causes for the low resistivity of shale gas reservoirs in this area were analyzed. Then, the limitation of traditional methods for calculating gas saturation based on electric logging data was diagnosed, and the feasibility of the neutronâdensity porosity overlay method was illustrated. According to the response characteristics of neutron, density and other porosity logging in shale gas reservoirs, a model for calculating gas saturation of shale gas was established by core experimental calibration based on the density logging value, the density porosity and the difference between density porosity and neutron porosity, by means of multiple methods (e.g. the dual-porosity overlay method by optimizing the best overlay coefficient. This new method avoids the effect of low resistivity, and thus can provide normal calculated gas saturation of high-quality shale gas reservoirs. It works well in practical application. This new method provides a technical support for the calculation of shale gas reserves in this area. Keywords: Shale gas, Gas saturation, Low resistivity, Non-electric logging, Volume density, Compensated neutron, Overlay method, Reserves calculation, Sichuan Basin, Jiaoshiba shale gas field
The challenge of implementing green gas into the gas supply
Bekkering, Jan
2014-01-01
In order to gain a more mature share in the future energy supply, green gas supply chains face some interesting challenges. In this thesis green gas supply chains, based on codigestion of cow manure and maize, are considered. The produced biogas is upgraded to natural gas quality and injected into
Experimental Study of Gas Explosions in Hydrogen Sulfide-Natural Gas-Air Mixtures
Directory of Open Access Journals (Sweden)
André Vagner Gaathaug
2014-01-01
Full Text Available An experimental study of turbulent combustion of hydrogen sulfide (H2S and natural gas was performed to provide reference data for verification of CFD codes and direct comparison. Hydrogen sulfide is present in most crude oil sources, and the explosion behaviour of pure H2S and mixtures with natural gas is important to address. The explosion behaviour was studied in a four-meter-long square pipe. The first two meters of the pipe had obstacles while the rest was smooth. Pressure transducers were used to measure the combustion in the pipe. The pure H2S gave slightly lower explosion pressure than pure natural gas for lean-to-stoichiometric mixtures. The rich H2S gave higher pressure than natural gas. Mixtures of H2S and natural gas were also studied and pressure spikes were observed when 5% and 10% H2S were added to natural gas and also when 5% and 10% natural gas were added to H2S. The addition of 5% H2S to natural gas resulted in higher pressure than pure H2S and pure natural gas. The 5% mixture gave much faster combustion than pure natural gas under fuel rich conditions.
De-linking oil and gas; The cost of Gulf gas; Middle East gas must look to Europe
International Nuclear Information System (INIS)
Aissaoui, Ali; Jensen, Jim; Stern, Jonathan
1994-01-01
This item consists of letters in response to an article by Robert Mabro on the prospects for gas in North Africa and the Middle East. The first letter is concerned with the issue of de-linking oil and gas. It is argued that the introduction of an ecotax, far from its creators' intentions, may deter investment in the natural gas industry to the benefit of coal and oil producers, rather than promoting gas as the fuel which best protects the environment. The second writer points out the Middle East's geographical disadvantage in aiming to supply natural gas to Europe. While reserves are ample, they are also readily available closer to European consumers, and without extra transportation costs. Markets nearby are either already functioning or, in areas such as India or Pakistan, prohibitively expensive in terms of pipeline construction or other technology. The last author also argues for investment in large-scale pipeline projects in order to use the Middle Eastern gas reserves, but stresses the need for political and security problems to be addressed at the same time. (UK)
International Nuclear Information System (INIS)
Biljetina, R.
1994-01-01
One of the constant challenges facing the research community is the identification of technology needs 5 to 15 years from now. A look back into history indicates that the forces driving natural gas research have changed from decade to decade. In the 1970s research was driven by concerns for adequate supply; in the 1980s research was aimed at creating new markets for natural gas. What then are the driving forces for the 1990s? Recent reports from the natural gas industry have helped define a new direction driven primarily by market demand for natural gas. A study prepared by the Interstate Natural Gas Association of America Foundation entitled ''Survey of Natural Research, Development, and Demonstration RD ampersand D Priorities'' indicated that in the 1990s the highest research priority should be for natural gas utilization and that technology development efforts should not only address efficiency and cost, but environmental and regulatory issues as well. This study and others, such as the report by the American Gas Association (A.G.A.) entitled ''Strategic Vision for Natural Gas Through the Year 2000,'' clearly identify the market sectors driving today's technology development needs. The biggest driver is the power generation market followed by the industrial, transportation, appliance, and gas cooling markets. This is best illustrated by the GRI 1994 Baseline Projection on market growth in various sectors between the year 1992 and 2010. This paper highlights some of the recent technology developments in each one of these sectors
Energy Technology Data Exchange (ETDEWEB)
Gudz, A.
1975-05-01
Natural gas from the Shatlyk gas field in the Kara Kum Desert, Turkmenia, U.S.S.R., will soon be available to the European section of the U.S.S.R. with the recent completion of the 291-mi Shatlyk-Khiva gas pipeline and the completion of all associated production units by the end of the year. The gas field, with explored reserves of (1.5 trillion m/sup 3/), is expected to be producing (100 million m/sup 3//day) at the end of 1975. Diagonal profiling was used in the exploration stage to reduce the number of boreholes required from 16 to 11, saving about $6.7 million (5 million rubles) and cutting the exploration time by almost 2 y. Most of the boreholes, drilled within the contour of the gas-bearing structure, can be used for gas production. The gas, produced at 2352 psi and 205/sup 0/F, is cooled to 113/sup 0/F, stripped of condensate and moisture, metered, and treated before transmission.
International Nuclear Information System (INIS)
Yamamoto, Tokihiro.
1986-01-01
Purpose: When injecting gas during plasma discharge, to prevent erronous operation of the piezoelectric valves due to vibrations and to inject gas into the vacuum vessel by accurately controlling gas flow. Constitution: The piezoelectric valve designed to control the flow of gas when charging vacuum vessels is installed between the vacuum vessel and the gas cylinder and a pulse voltage generator to control the valve (open/close) and the reverse voltage generator to apply a reverse current to the valve element are also provided. When a voltage is applied to the piezoelectric element, the piezoelectric element bends. However, when the polarity is changed, the direction of the bend is also reversed. The seat portion is pressed in proportion to the degree of bending. When gas is injected while plasma is being discharged, the gap created, due to vibrations, between the piezoelectric element and the sealing material is prevented by the application of a reverse current. This allows precise control of the gas injection volume as well as the injection interval. This assures maintenance of precise test conditions when testing thermonuclear devices. (Horiuchi, T.)
U.S. crude oil, natural gas, and natural gas liquids reserves 1995 annual report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-11-01
The EIA annual reserves report series is the only source of comprehensive domestic proved reserves estimates. This publication is used by the Congress, Federal and State agencies, industry, and other interested parties to obtain accurate estimates of the Nation`s proved reserves of crude oil, natural gas, and natural gas liquids. These data are essential to the development, implementation, and evaluation of energy policy and legislation. This report presents estimates of proved reserves of crude oil, natural gas, and natural gas liquids as of December 31, 1995, as well as production volumes for the US and selected States and State subdivisions for the year 1995. Estimates are presented for the following four categories of natural gas: total gas (wet after lease separation), nonassociated gas and associated-dissolved gas (which are the two major types of wet natural gas), and total dry gas (wet gas adjusted for the removal of liquids at natural gas processing plants). In addition, reserve estimates for two types of natural gas liquids, lease condensate and natural gas plant liquids, are presented. Also included is information on indicated additional crude oil reserves and crude oil, natural gas, and lease condensate reserves in nonproducing reservoirs. A discussion of notable oil and gas exploration and development activities during 1995 is provided. 21 figs., 16 tabs.
International Nuclear Information System (INIS)
Freedenthal, C.
1993-01-01
Natural gas pricing is the heart and soul of the gas business. Price specifically affects every phase of the industry. Too low a price will result in short supplies as seen in the mid-1970s when natural gas was scarce and in tight supply. To fully understand the pricing of this energy commodity, it is important to understand the total energy picture. In addition, the effect and impact of world and US economies, and economics in general are crucial to understanding natural gas pricing. The purpose of this presentation will be to show the parameters going into US natural gas pricing including the influence of the many outside industry factors like crude oil and coal pricing, market drivers pushing the gas industry, supply/demand parameters, risk management for buyers and sellers, and other elements involved in pricing analysis
Research into the transmission of natural gas by gas pipeline
Energy Technology Data Exchange (ETDEWEB)
Gadonneix, P.
1998-12-31
This paper is the press release of the talk given at the `Gaz de France scientific meeting with the press` by P. Gadonneix, chairman of Gaz de France company, on October 7, 1998. The aim of this talk concerns the new French and European supply link for bringing natural gas from the Norwegian North Sea fields. This new supply link is the first direct link between Norway and France and the NorFra gas pipeline which brings natural gas from the North Sea to France is the longest offshore pipeline in the world. The `Artere des Hauts de France` pipeline (the largest diameter gas pipeline ever laid in France) is devoted to the transfer of natural gas from Dunkerque to the Gournay-sur-Aronde underground storage site. This paper describes successively: the French European gas supply hub, the NorFra project, the Artere des Hauts de France pipeline, the network performance research, the safety and quality guaranties, the reduction of overland natural gas transmission costs (improvement of pipe-laying techniques and optimization of line route and welding operations), the specific techniques used for road and river crossing (micro-tunnel digging, river-crossing ditches) and for anchoring (buoyancy compensation). Finally, the environmental impact of the laying operations is briefly described. (J.S.)
International Nuclear Information System (INIS)
Lefevre, Thierry; Todoc, Jessie L.
1999-11-01
Contains Executive Summary and Chapters on: Country background; Overview of the energy sector; Natural gas supply; Natural gas infrastructure; Natural gas infrastructure; Natural gas demand; Outlook-government policy reform and industry development, and Appendices on Global and regional energy and gas trends; Overview of India's investment policy, incentives and regulation; The ENRON Dabhol power project. (Author)
International Nuclear Information System (INIS)
Des Brisay, C.
2005-01-01
Terasen Gas is pursuing alternatives for the supply of additional natural gas capacity to Vancouver Island. Its subsidiary, Terasen Gas (Vancouver Island) Inc. (TGVI), is responding to the need for delivery of increased gas supply and, is supporting plans for new gas-fired power generation on Vancouver Island. TGVI's proposal for new natural gas capacity involves a combination of compression and pipeline loops as well as the addition of a storage facility for liquefied natural gas (LNG) at Mt. Hayes to help manage price volatility. This presentation outlined the objectives and components of the resource planning process, including demand forecast scenarios and the preferred infrastructure options. tabs., figs
International Nuclear Information System (INIS)
Stonehouse, D.
2001-01-01
Despite completing 8,900 gas wells in year 2000, the deliverability of natural gas out of the Western Canadian Sedimentary Basin (WCSB) was stagnant which has left many analysts wondering whether the basin has reached its limit. It also leaves many wondering if gas producers will be able to meet the strong demand for natural gas in the future. Nearly all new electrical generation being built in the U.S. is gas-based due to strict new environmental standards limiting the growth in hydro and coal-powered generation. Any future coal plants will use gasification technology and combined cycle turbines. Combined cycle turbines developed by Boeing and Lockheed are more efficient than combustion turbines, making gas more competitive with fuel alternatives. The lack of growth in natural gas supply has left storage levels near record lows. Demand is expected to increase in 2001 by 3.2 per cent to 23 trillion cubic feet in the U.S. Longer term, major new reserves must be brought on stream to meet this demand. It was noted that the easy discoveries within the WCSB have been made. The new plays are smaller, more technically complex and expensive which suggests that more investment is needed in training geologists, geophysicists and petroleum engineers to find new reserves. The Canadian Energy Research Institute agrees that there is enough gas in Alberta and British Columbia to meet current demands but efforts must shift towards drilling in the foothills front and northwest regions of Alberta to increase deliverability. Brief notes on several gas finds by various oil and gas companies in the area were presented. The article also discussed the huge untapped potential of northern reserves. Analysts have noted 44 Tcf of proven reserve, with a potential of 165 Tcf. In addition, new pipelines from the Alaskan North Slope and the Mackenzie Delta could transport nearly 2 Tcf annually to market. Wells drilled by Chevron and Paramount at Fort Liard in 1999 initially flowed at rates up to
Energy Technology Data Exchange (ETDEWEB)
North, D.
1977-08-01
Consumersfirst Ltd. is reacting to deregulation with a massive advertising campaign. The gas utility is owned by Consumers Gas Energy Inc., and is struggling to hold onto its 35 per cent share of Ontario`s two million residential natural gas buyers. An industry analyst pointed out that deregulation could mean that Consumers` Gas has much to lose: customers, market share, control of the assets and control of the process. The Ontario Energy Board (OEB) however, had specified that Consumersfirst is not to proceed with paperwork to sign up new customers until the OEB issues a draft code-of-conduct that would prevent cross-subsidizing between regulated franchise holders. This has now been done, and several heavyweights such as Calgary-based Suncor Energy Inc., Union Gas of Chatham, Ontario, and the US-based Enron Corp. of Houston, have started campaigns to sign up potential consumers. It is predicted that brand loyalty will be a factor, but in the end, like long distance telephone rates, it will all come down to pricing, and a winning formula is not easy to find.
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I receive approval to produce gas-cap gas from an oil reservoir with an associated gas cap? 250.1157 Section 250.1157 Mineral Resources... do I receive approval to produce gas-cap gas from an oil reservoir with an associated gas cap? (a...
Expanding Canadian natural gas production will strengthen growth of LP-gas industry
International Nuclear Information System (INIS)
Hawkins, D.J.
1994-01-01
In 1992, over 86% of Canadian propane and 70% of Canadian butane production originated in gas plants. Propane and butane production not recovered at gas plants is recovered in other processing facilities, primarily refineries and heavy oil upgraders. As a result, supplies of both products are largely tied to natural gas production, and the outlook for natural gas therefore provides the basis for any discussion on the outlook for gas processing and NGL industry infrastructure. The paper discusses gas processing, economies of scale, NGL supply, expected declines, industry structure and infrastructure, the two major centers of the Canadian NGL industry, new shippers, and required pipeline expansion
Gas system 2016: Press conference 17 January 2017 + Gas consumption by administrative regions
International Nuclear Information System (INIS)
2017-01-01
GRTgaz is a European leader in natural gas transmission, a world expert in gas transmission networks and systems, and an operator firmly committed to the energy transition. It owns and operates the gas transmission network throughout most of France and it manages the transmission network in Germany, thereby helping to ensure correct operation of the French and European gas market. It contributes to the energy security of regional supply systems and performs a public service mission to ensure the continuity of consumer supply. This document presents some key figures about GRTgaz activity in 2016: A first part presents the national data about gas consumption, production of gas-fired power plants, new gas uses (diesel-gas substitution, biomethane..) and their environmental impacts, and the development of the Internet open-data platform. A second part presents the regional gas consumptions with a focus on industrial clients
Stanis³aw Brzeziñski
2007-01-01
In the paper, Author presents chosen aspects of natural gas transportation within global market. Natural gas transportation is a technicaly complicated and economicly expensive process; in infrastructure construction and activities costs. The paper also considers last and proposed initiatives in natural gas transportation.
International Nuclear Information System (INIS)
Roberts, Richard.
1994-01-01
The NSW Southern Coalfield at Bulli is Australia's most gas plagued producing region. Whilst gas drainage using long boreholes has been successfully adapted in high methane areas, these techniques are not efficient when high levels of carbon dioxide are present, as is the case at Bulli NSW. This article discusses the limitations of the current gas drainage technologies and the improvements needed in underground drilling technologies and hydrofacing for efficient gas drainage. 1 table, 1 photo
Directory of Open Access Journals (Sweden)
Shengfei Qin
2016-10-01
Full Text Available In this paper, the origin of natural gas in the formations of the Changxing–Feixianguan within the Longgang gas field was studied in detail using geochemical methods. The gas discovered has a very high dryness coefficient, yet low ethane and other less heavy hydrocarbons content. Apart from a small amount of N2 and CO2 gasses it generally contains H2S. In the field location, the Changxing–Feixianguan formations itself does not have a hydrocarbon generation potential. Nearing the edge of the Kaijiang-Liangping Trough, there developed the Dalong Formation. However, it also has a very low TOC content in the area of the Longgang gas field, and it cannot act as an effective source rock. The geochemistry of natural gas is much different from the gasses generated by the Silurian and Cambrian source rocks. Therefore, it is impossible that the gas in the Longgang gas field is from the Silurian and Cambrian source rocks. Gas reservoirs generally contain bitumen which is considered a product of crude oil cracking. The carbon isotope fractionation between the bitumen and methane is not distinct, and it indicates that the gas is not directly from oil cracking. The carbon of methane and ethane has isotopically less negative value, which is considered to be in a high-overmature coal-formed gas, mainly from the Longtan Formation coal measures. In comparison to the gas from high overmature stage obtained from the Xujiahe coal measure source rock in the Western Sichuan Depression. The methane in the Longgang gas field has abnormal less negative carbon isotopic value. It is due to the superposition of these two factors together: higher evolution of source rocks and mixing of gas degassing from the water. It is not caused by TSR that most researchers believed at present because the methane carbon isotopic values have no relationship with H2S content.
Preliminary report on the commercial viability of gas production from natural gas hydrates
Walsh, M.R.; Hancock, S.H.; Wilson, S.J.; Patil, S.L.; Moridis, G.J.; Boswell, R.; Collett, T.S.; Koh, C.A.; Sloan, E.D.
2009-01-01
Economic studies on simulated gas hydrate reservoirs have been compiled to estimate the price of natural gas that may lead to economically viable production from the most promising gas hydrate accumulations. As a first estimate, $CDN2005 12/Mscf is the lowest gas price that would allow economically viable production from gas hydrates in the absence of associated free gas, while an underlying gas deposit will reduce the viability price estimate to $CDN2005 7.50/Mscf. Results from a recent analysis of the simulated production of natural gas from marine hydrate deposits are also considered in this report; on an IROR basis, it is $US2008 3.50-4.00/Mscf more expensive to produce marine hydrates than conventional marine gas assuming the existence of sufficiently large marine hydrate accumulations. While these prices represent the best available estimates, the economic evaluation of a specific project is highly dependent on the producibility of the target zone, the amount of gas in place, the associated geologic and depositional environment, existing pipeline infrastructure, and local tariffs and taxes. ?? 2009 Elsevier B.V.
DEFF Research Database (Denmark)
Alberti, Mark; la Cour, Morten
2018-01-01
PURPOSE: To compare gas-foveal contact in face-down positioning (FDP) and nonsupine positioning (NSP), to analyze causes of gas-foveal separation and to determine how gas-foveal contact affects clinical outcome after idiopathic macular hole repair. METHODS: Single center, randomized controlled...... study. Participants with an idiopathic macular hole were allocated to either FDP or NSP. Primary outcome was gas-foveal contact, calculated by analyzing positioning in relation to intraocular gas fill. Positioning was measured with an electronic device recording positioning for 72 hours postoperatively....... RESULTS: Positioning data were available for 33/35 in the FDP group and 35/37 in the NSP group, thus results are based on 68 analyzed participants. Median gas-foveal contact was 99.82% (range 73.6-100.0) in the FDP group and 99.57% (range 85.3-100.0) in the NSP group (P = 0.22). In a statistical model...
International Nuclear Information System (INIS)
Parent, L.
1991-01-01
This paper reports that U.S. gas producers won't see much price relief in 1991, barring a Persian Gulf war that interrupts crude supply which might be replaced by gas on short notice. Besides the current supply surplus, natural gas futures have added yet another dimension to the process of setting gas prices. Spectators (read speculators) having no intention of ever buying one cu ft of gas now have a hand in setting the forward price of gas. That doesn't necessarily mean something bad; it simply means that there is a new game with new rules and new players. All things considered, look for an average spot price of $1.70 this year. Exploration should pick up modestly, but production from conventional sources is expected to decline slightly in the '90s. Technological developments that enhance deliverability and reduce finding costs will moderate the decline, but not halt it
International Nuclear Information System (INIS)
Molyneaux, M.P.
1998-01-01
An overview of natural gas markets in Canada and in the United States was provided. The major factors that determine the direction of natural gas prices were depicted graphically. Price volatility has decreased in recent months. As expected, April through November total energy consumption reached historically high levels. Demand for natural gas during the summer of 1997 was not as strong as anticipated. Nuclear energy appears to be on the slippery slope, with natural gas-driven electricity projects to fill the void. Hydroelectricity had a strong showing in 1997. Prospects are less bright for 1998 due to above average temperatures. Canadian natural gas export capacity has increased 5.5 times between 1986 and estimated 1999 levels. Despite this, in 1997, deliveries to the United States were marginally behind expectations. Natural gas consumption, comparative fuel prices, natural gas drilling activity, natural gas storage capacity, actual storage by region, and average weekly spot natural gas prices, for both the U. S. and Canada, were also provided. With regard to Canada, it was suggested that Canadian producers are well positioned for a significant increase in their price realization mostly because of the increase in Canada's export capacity in 1997 (+175 Mmcf/d), 1998 (1,060 Mmcf/d) and potentially in 1999 or 2000, via the Alliance Pipeline project. Nevertheless, with current production projections it appears next to impossible to fill the 10.9 Bcf/d of export capacity that will be potentially in place by the end of 1999. tabs., figs
Energy Technology Data Exchange (ETDEWEB)
Welker, T.F.
1997-07-01
The quality of gas has changed drastically in the past few years. Most gas is wet with hydrocarbons, water, and heavier contaminants that tend to condense if not handled properly. If a gas stream is contaminated with condensables, the sampling of that stream must be done in a manner that will ensure all of the components in the stream are introduced into the sample container as the composite. The sampling and handling of wet gas is extremely difficult under ideal conditions. There are no ideal conditions in the real world. The problems related to offshore operations and other wet gas systems, as well as the transportation of the sample, are additional problems that must be overcome if the analysis is to mean anything to the producer and gatherer. The sampling of wet gas systems is decidedly more difficult than sampling conventional dry gas systems. Wet gas systems were generally going to result in the measurement of one heating value at the inlet of the pipe and a drastic reduction in the heating value of the gas at the outlet end of the system. This is caused by the fallout or accumulation of the heavier products that, at the inlet, may be in the vapor state in the pipeline; hence, the high gravity and high BTU. But, in fact, because of pressure and temperature variances, these liquids condense and form a liquid that is actually running down the pipe as a stream or is accumulated in drips to be blown from the system. (author)
Energy Technology Data Exchange (ETDEWEB)
Pessoa, Isac Quintao; Miranda, Luciano Lellis; Fullin Junior, Benjamin; Rodrigues, Henrique de Castro; Manella, Roberto [Aperam South America, Timoteo, MG (Brazil). Utilidades e Eficiencia Energetica; Lins, Vanessa de Freitas Cunha [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Quimica
2011-12-21
Minas Gerais is a State where there is no production of natural gas. Aiming to increase the consumption of natural gas in Minas Gerais, PETROBRAS increase the network of gas natural distribution in the State of Minas Gerais and the State concessionaire (GASMIG) installed the Project of Natural Gas Valley. The case study is associated to an enterprise that firmed contract for supplying of natural gas. The fuel to be substituted is the Liquefied Petroleum Gas and the results of the substitution were shown. The advantages of the substitution were related to costs, and environmental aspects with the reduction of CO{sub 2} production. The natural gas contains a lower content of impurities and is operated with higher safety than the petroleum liquefied gas. (author)
Natural gas supply in Denmark - A model of natural gas transmission and the liberalized gas market
International Nuclear Information System (INIS)
Bregnbaek, L.
2005-01-01
In the wake of the liberalization of European energy markets a large area of research has spawned. This area includes the development of mathematical models to analyze the impact of liberalization with respect to efficiency, supply security and environment, to name but a few subjects. This project describes the development of such a model. In Denmark the parallel liberalization of the markets of natural gas and electricity and the existence of an abundance of de-centralized combined heat and power generators of which most are natural gas fired, leads to the natural assumption that the future holds a greater deal of interdependency for these markets. A model is developed describing network flows in the natural gas transmission system, the main arteries of natural gas supply, from a technical viewpoint. This yields a technical bounding on the supply available in different parts of the country. Additionally the economic structure of the Danish natural gas market is formulated mathematically giving a description of the transmission, distribution and storage options available to the market. The supply and demand of natural gas is put into a partial equilibrium context by integrating the developed model with the Balmorel model, which describes the markets for electricity and district heat. Specifically on the demand side the consumption of natural gas for heat and power generation is emphasized. General results and three demonstration cases are presented to illustrate how the developed model can be used to analyze various energy policy issues, and to disclose the strengths and weaknesses in the formulation. (au)
Today's gas glut and yesterday's contracts: the British Gas predicament
International Nuclear Information System (INIS)
Stoppard, M.
1996-10-01
Deregulation of the gas and electricity industries has led to a state of pronounced oversupply in the UK gas market. The effects of this oversupply became apparent during the course of 1995 and took two forms. Firstly, there was the emergence of a market for the short-term trading of gas. The price levels in this market collapsed in the first half of 1995 opening up a price gap between ''spot'' and contract gas. Secondly, some contract gas was paid for but was not produced, so that delivery to market was indefinitely postponed: there was a run-up in inventory - or ''take-or-pay'' - gas levels, as a form of keeping supply off the market. Oversupply has exerted great pressure on a number of market participants throughout the gas chain who remain locked into purchase agreements for volumes which have no market outlet, and at prices above market levels. The rally in spot price levels experienced since the second quarter of 1996 has eased pressure within the market but has not removed the fundamental strains. The market is expected to remain in oversupply at least up to the end of 1998. Keen price competition may not clear the market even at discount prices, so that shut-in of production capacity is likely. The consequent build-up in take-or-pay levels will continue through the period, although at steadily declining rates, and there is little scope prior to 1999 for the industry as a whole to offload this inventory gas on the market. (author)
Gas-partitioning tracer test to qualify trapped gas during recharge
Heilweil, Victor M.; Kip, Solomon D.; Perkins, Kim S.; Ellett, Kevin M.
2004-01-01
Dissolved helium and bromide tracers were used to evaluate trapped gas during an infiltration pond experiment. Dissolved helium preferentially partitioned into trapped gas bubbles, or other pore air, because of its low solubility in water. This produced observed helium retardation factors of as much as 12 relative to bromide. Numerical simulations of helium breakthrough with both equilibrium and kinetically limited advection/dispersion/retardation did not match observed helium concentrations. However, better fits were obtained by including a decay term representing the diffusive loss of helium through interconnected, gas-filled pores. Calculations indicate that 7% to more than 26% of the porosity beneath the pond was filled with gas. Measurements of laboratory hydraulic properties indicate that a 10% decrease in saturation would reduce the hydraulic conductivity by at least one order of magnitude in the well-sorted sandstone, but less in the overlying soils. This is consistent with in situ measurements during the experiment, which show steeper hydraulic gradients in sandstone than in soil. Intrinsic permeability of the soil doubled during the first six months of the experiment, likely caused by a combination of dissolution and thermal contraction of trapped gas. Managers of artificial recharge basins may consider minimizing the amount of trapped gas by using wet, rather than dry, tilling to optimize infiltration rates, particularly in well-sorted porous media in which reintroduced trapped gas may cause substantial reductions in permeability. Trapped gas may also inhibit the amount of focused infiltration that occurs naturally during ephemeral flood events along washes and playas.
Gas-partitioning tracer test to quantify trapped gas during recharge
Heilweil, V.M.; Solomon, D.K.; Perkins, K.S.; Ellett, K.M.
2004-01-01
Dissolved helium and bromide tracers were used to evaluate trapped gas during an infiltration pond experiment. Dissolved helium preferentially partitioned into trapped gas bubbles, or other pore air, because of its low solubility in water. This produced observed helium retardation factors of as much as 12 relative to bromide. Numerical simulations of helium breakthrough with both equilibrium and kinetically limited advection/dispersion/retardation did not match observed helium concentrations. However, better fits were obtained by including a decay term representing the diffusive loss of helium through interconnected, gas-filled pores. Calculations indicate that 7% to more than 26% of the porosity beneath the pond was filled with gas. Measurements of laboratory hydraulic properties indicate that a 10% decrease in saturation would reduce the hydraulic conductivity by at least one order of magnitude in the well-sorted sandstone, but less in the overlying soils. This is consistent with in situ measurements during the experiment, which show steeper hydraulic gradients in sandstone than in soil. Intrinsic permeability of the soil doubled during the first six months of the experiment, likely caused by a combination of dissolution and thermal contraction of trapped gas. Managers of artificial recharge basins may consider minimizing the amount of trapped gas by using wet, rather than dry, tilling to optimize infiltration rates, particularly in well-sorted porous media in which reintroduced trapped gas may cause substantial reductions in permeability. Trapped gas may also inhibit the amount of focused infiltration that occurs naturally during ephemeral flood events along washes and playas.
International Nuclear Information System (INIS)
Ramirez, M.
1999-01-01
A series of overhead viewgraphs accompanied this presentation which focused on various aspects of the natural gas industry in Mexico. Some of the viewgraphs depicted statistics from 1998 regarding natural gas throughput from various companies in North America, natural gas reserves around the world, and natural gas reserves in Mexico. Other viewgraphs depicted associated and non-associated natural gas production from 1988 to 1998 in million cubic feet per day. The Burgos Basin and the Cantarell Basin gas production from 1997 to 2004 was also depicted. Other viewgraphs were entitled: (1) gas processing infrastructure for 1999, (2) cryogenic plant at Cd. PEMEX, (3) average annual growth of dry natural gas production for 1997-2004 is estimated at 5.2 per cent, (4) gas flows for December 1998, (5) PGPB- interconnect points, (6) U.S. Mexico gas trade for 1994-1998, (7) PGPB's interconnect projects with U.S., and (8) natural gas storage areas. Technological innovations in the industry include more efficient gas turbines which allow for cogeneration, heat recovery steam generators which reduce pollutant emissions by 21 per cent, cold boxes which increase heat transfer efficiency, and lateral reboilers which reduce energy consumption and total costs. A pie chart depicting natural gas demand by sector shows that natural gas for power generation will increase from 16 per cent in 1997 to 31 per cent in 2004. The opportunities for cogeneration projects were also reviewed. The Comision Federal de Electricidad and independent power producers represent the largest opportunity. The 1997-2001 investment program proposes an 85 per cent sulphur dioxide emission reduction compared to 1997 levels. This presentation also noted that during the 1998-2001 period, total ethane production will grow by 58 tbd. 31 figs
International Nuclear Information System (INIS)
1997-01-01
The Russian Federation holds the world's largest proven natural gas reserves, and produces more natural gas than any other nation. Russian exports of gas to Europe and the other nations of the Commonwealth of Independent States (CIS) have a significant impact on natural gas markets throughout Europe and Asia. The aim of this three part study is to inform the international energy and investment community about the current status of the Russian gas industry and the prospects for its future development through 2010. It is also intended to provide an opportunity for the appropriate authorities in the Russian Federation to assess the needs of the industry and to consider areas for possible collaboration with the international investment community and international organizations in a rapidly changing economic and business environment. The study was prepared by the Energy Branch of the United Nations Department for Development Support and Management Services (UN/DDSMS). It was financed by the United Nations Development Programme (UNDP). Part I describes Russian gas reserves and potential resources, and overviews the country's gas producing, pipeline and distribution industries. Additionally, it summarizes the markets for Russian natural gas including domestic and external markets. It discusses the primary economics and potential factors that currently impact the Russian gas industry during the Federation's transition toward a market economy. Part II highlights possible directions for the development of the Russian gas resource base, including upstream gas production and downstream marketing in five-, ten- and fifteen-year time frames. It projects export opportunities for Russian Federation gas and evaluates the options for shaping regional and international markets. Part III addresses the legal and regulatory framework and fiscal regime of the Russian gas industry. It also reviews the major investment requirements and the equipment and training needs of the Russian gas
Energy Technology Data Exchange (ETDEWEB)
Berthold, D.
The second Federal German experts' meeting on Gas Consulting from 2nd to 5th June 1981 in Saarbruecken documents the importance attached by the gas industry to a qualified energy consulting. The consumers are informed of natural gas by country-wide and regional PR- and marketing activities. This information is the basis for sales promotion measures in the regional and local sphere. All communicative measures end with the consulting. It is the most important sales-political instrument which helps the supply companies to win interested and informed customers. The action gas consulting shows possibilities of how to effect an advisory service in cooperation between Information on Natural Gas and local suppliers.
International Nuclear Information System (INIS)
2009-01-01
This document is published before a congress which will address the struggle against climate change, the security of the gas supply chain, the responses of energy groups to environmental and economic challenges, the opening of the gas market, the European energy policy, the future role of gas in the third industrial revolution, and the security of gas supplies. After an introduction briefly discussing these issues and the impacts of the French 'Grenelle de l'Environnement' and the struggle against climate change for gas production and consumption, several interviews are proposed with actors belonging to the AFG (Association Francaise du Gaz), ADEME, European Commission, Total, GDF Suez, other professional bodies, or local communities
International Nuclear Information System (INIS)
Anon.
2013-01-01
This special issue of Gaz d'Aujourd'hui journal contains the proceedings of the 2013 edition of the annual French gas conference. These proceedings comprise 7 talks, 5 round-tables and 9 workshops: 1 - Opening talk (H. Malherbe); 2 - Defending the natural gas position in the energy mix (G. Mestralet); 3 - The new youth of natural gas (P. Sauquet); 4 - Round-table No.1: the natural gas market perspectives; 5 - Round-table No.2: natural gas in France's energy transition; 6 - Answering the energy transition challenges (B. Lescoeur); 7 - Round-table No.3: towards an integrated European market in 2014?; 8 - Building up the European gas market (P. de Ladoucette); 9 - Workshop No.1: the big client's strategies in the gas market; 10 - Workshop No.2: the fuel gas perspectives in terrestrial mobility; 11 - Workshop No.3: gas innovations; 12 - The 2030 and 2050 strategy of the European Union policy (B. Devlin); 13 - Round-table No.4: Decentralized production and local development; 14 - Workshop No.4: Gas and maritime transport; 15 - Workshop No.5: bio-methane, vector of the energy transition; 16 - Workshop No.6: Evolution of the storage activity; 17 - Workshop No.7: Dwellings renovation and natural gas development; 18 - Workshop No.8: Is the target model of gas a reality?; 19 - Workshop No.9: Non-conventional gases in the world; 20 - Round-table No.5: Actors' strategy; 21 - Closing talk (J. Ferrier)
International Nuclear Information System (INIS)
Hayes, D.
2001-01-01
Demand for natural gas in Thailand is increasing significantly as the Electricity Generating Authority of Thailand and the independent private power producers (IPPs) switch from oil to gas to fire their power stations in line with Government policy to reduce oil imports and use more gas from the Gulf of Thailand. The Petroleum Authority of Thailand (PTT) has the sole right to buy and sell natural gas and other petroleum products in Thailand. According to PTT, the surge in demand for natural gas in the first half of 2001 was matched by a fall in demand for refined oil products. The PTT has received Government approval to convert to a limited company ready for listing on the Thai Stock Exchange. This is expected to further increase gas consumption. Details of gas sales to power generation and other industrial sectors by PTT and Unocal, Thailand's largest producer, are given. PTT operations include work to extend its gas pipeline transmission system. A number of new pipeline schemes are planned, including one across southern Thailand to transfer offshore gas from the Joint Development Area gas field owned by Thailand and Malaysia. This has encountered protests over the proposed plant and pipeline route
Chen, Peng (Inventor); Buric, Michael P. (Inventor); Swinehart, Philip R. (Inventor); Maklad, Mokhtar S. (Inventor)
2010-01-01
A gas sensor includes an in-fiber resonant wavelength device provided in a fiber core at a first location. The fiber propagates a sensing light and a power light. A layer of a material is attached to the fiber at the first location. The material is able to absorb the gas at a temperature dependent gas absorption rate. The power light is used to heat the material and increases the gas absorption rate, thereby increasing sensor performance, especially at low temperatures. Further, a method is described of flash heating the gas sensor to absorb more of the gas, allowing the sensor to cool, thereby locking in the gas content of the sensor material, and taking the difference between the starting and ending resonant wavelengths as an indication of the concentration of the gas in the ambient atmosphere.
Preliminary report on the economics of gas production from natural gas hydrates
International Nuclear Information System (INIS)
Walsh, M.; Wilson, S.; Patil, S.; Moridis, G.; Boswell, R.; Koh, C.; Sloan, D.
2008-01-01
Gas hydrates are solid crystalline compounds in which gas molecules reside inside cages that are formed by hydrogen-bonded water molecules in a crystal lattice. At particularly low temperatures and high pressures, a guest molecule will combine with water to form gas hydrates. Gas hydrates are found in two different settings in which the temperature and pressure conditions are suitable for their existence, notably in Arctic permafrost regions and below the seafloor. Because of the size of this possible future resource, if any of the gas in hydrates can be proven to be economically recoverable, then production from gas hydrates could become an important portion of the world's energy portfolio as demand for natural gas increases along with the technology to compress and distribute natural gas to distant markets. This paper presented a compilation of economic research that was conducted on the resource potential of gas hydrates. The paper reported a preliminary estimate of the price of natural gas that may lead to economically-viable production from North American Arctic region hydrates. The paper also discussed the implications of a recent study on the production of class 3 marine hydrate deposits from the Gulf of Mexico. The state of the art technologies and methods in hydrate reservoir modeling and hydrate reservoir production and petrophysical testing were also discussed. It was concluded that the somewhat optimistic results presented in this report should be interpreted with caution, however, the economically-viable gas production from hydrates was not an unreasonable scenario. 23 refs., 2 tabs., 10 figs
International Nuclear Information System (INIS)
Moncel, V.
1999-01-01
Traditionally, the commercial activities of gas companies have been limited almost exclusively to the sale of gas. However, several socioeconomic factors specific to the gas industry, such as increasing customer expectations, competition between gas operators, a growing emphasis on services in many companies and the opening of public monopolies to competition, will bring inevitable change. Moreover, these developments coincide with imminent gas market opening. In response to the changing situation, the gas industry will seek to develop a range of multi-service offers, probably through external partnerships. (authors)
Gage for gas flow measurement especially in gas-suction pipes
International Nuclear Information System (INIS)
Renner, K.; Stegmanns, W.
1978-01-01
The gage utilizes the differential pressure given by a differential pressure producer to generate, in a bypass, a partial gas flow measured by means of a direct-reading anemometer of windmill type. The partial gas flow is generated between pressure pick-up openings in the gas-suction pipe in front of a venturi insert and pressure pick-up openings at the bottleneck of the venturi insert. The reading of the anemometer is proportional to the main gas flow and independent of the variables of state and the properties of the gases to be measured. (RW) [de
Generation of synthesis gas by partial oxidation of natural gas in a gas turbine
Cornelissen, R.; Tober, E.; Kok, Jacobus B.W.; van der Meer, Theodorus H.
2006-01-01
The application of partial oxidation in a gas turbine (PO-GT) in the production of synthesis gas for methanol production is explored. In PO-GT, methane is compressed, preheated, partial oxidized and expanded. For the methanol synthesis a 12% gain in thermal efficiency has been calculated for the
Flue gas corrosion through halogen compounds in fuel gas
Energy Technology Data Exchange (ETDEWEB)
Eisenmann, R
1987-04-01
The halogens of chlorine and fluorine greatly influence the corrosion speed of metal materials. If small quantities of chlorinated and/or fluorinated hydrocarbons are present in fuel gas like in landfill gas, they must not result in enhanced corrosion of gas appliances. Data from literature and the initial results of tests run by the author indicate that quantities at about 10 mg/cbm (in terms of chlorine) can be assumed not to cause any noticeable acceleration of corrosion speed.
Gas to Power in China. Gas-fired Power in China. Clearing the policy bottleneck
International Nuclear Information System (INIS)
Chen, Xavier
2005-12-01
Policy for gas-fired power is the single most serious and common issue that needs urgent resolution for all China's current and future gas projects, including LNG projects. This was the main conclusion of a national seminar on gas industry development policy that was held in July 2004. At the time of writing this paper, such a policy is still missing. In order to reduce pollution, improve energy security and meet the needs of the ever-growing economy for high-quality energies, the Chinese government has declared its firm intention to develop a natural gas market. The official target is to develop a gas market of 200 bcm/a by 2020, five times of the current size of around 40 bcm/a. Domestic supply is expected to provide 120 bcm/a, with the rest (80 bcm/a) by gas imports either in the form of piped gas or LNG. Gas-fired power generation plays a critical role in developing a sizeable gas market, especially for large-scale pipeline and LNG projects. Similar to the Guangdong and Fujian LNG projects where gas-fired power accounts for approximately 60% and 70% respectively of the first phase gas volume, each of the proposed LNG projects has allocated a large portion of the gas off-take volume to the power sector. In addition to the first two commercial CCGT plants that were commissioned in 2005, there are over 20 projects totalling 18 GW of capacity under construction. By 2020, China's planners foresee a total gas-fired power capacity of 60 GW, accounting for around 6% of the total installed capacity in the country. Despite these impressive projections, gas-fired power faces significant uncertainties in China: (1) there is an ongoing debate on whether China should develop gas-fired power, given the relative scarcity and higher cost of gas; (2) high gas prices and imported equipment limit the competitiveness of gas-fired power relative to a coal-fired one; (3) it lacks policy support. For the moment, gas-fired power plants are required to participate in a yet
International Nuclear Information System (INIS)
Oberlin, J.C.; Frick, G.; Kempfer, C.; North, C.
1988-09-01
The state of work on the Vivitron gas transfer system and the system functions are summarized. The system has to: evacuate the Vivitron reservoir; transfer gas from storage tanks to the Vivitron; recirculate gas during operation; transfer gas from the Vivitron to storage tanks; and assure air input. The system is now being installed. Leak alarms are given by SF6 detectors, which set off a system of forced ventilation. Another system continuously monitors the amount of SF6 in the tanks [fr
Energy Technology Data Exchange (ETDEWEB)
Anderson, R S [Belfast City Council Gas Dept.; Asquith, R S; Brown, J M; McKay, G
1977-07-01
Throughout Northern Ireland the production of town gas is derived from hydrocarbon feedstocks. In the larger undertakings in Northern Ireland the feedstock is light distillate; a light petroleum feedstock which is a crude gasoline comprised mainly of pentanes, reformed in catalytic plants. The remaining gas undertakings produce a liquefied petroleum gas (LPG)/air mixture using a mixture of either butane or propane and air. The individual gas units and the type of reforming feedstock are shown. A review of the oil-dependence of town gas and electricity production in Northern Ireland has been considered and is mainly responsible for the high fuel prices experienced in the community. A detailed description of the reforming process has been described, and considerable efforts have been made to optimize the process. In spite of substantial economic savings being made on the processing unit, the gas industry is very susceptible to the changes in oil prices which have escalated rapidly in recent years. The difference in gas prices between the United Kingdom and Northern Ireland indicates that North Sea gas would offer major economic benefits to the gas industry in Northern Ireland, which is operating at a substantial loss at the moment. The industrial concerns, which are dependent on gas and therefore paying high fuel costs, suffer in competition with outside companies. The injection of a moderately cheap natural gas supply to the community may encourage industrial expansion and provide work in a high unemployment area. Although substantial costs must be incurred in distribution pipelines and burner conversions if Northern Ireland changes to natural gas, there appears to be a strong case to introduce North Sea gas in the near future.
Gas allocation plans based on failures scenarios: PETROBRAS-Gas and Power Sector
Energy Technology Data Exchange (ETDEWEB)
Faertes, Denise; Vieira, Flavia; Saker, Leonardo; Heil, Luciana [PETROBRAS, Rio de Janeiro, RJ (Brazil); Galvao, Joao [DNV, Rio de Janeiro, RJ (Brazil)
2009-07-01
The purpose of this paper is to present gas allocation plans developed for PETROBRAS Gas and Power Sector, considering failure to supply scenarios that could occur along gas supply network. Those scenarios, as well as the associated contingency plans, were identified and validated by an experienced team, composed by engineers and operators from different PETROBRAS sectors. The key issue of concern was the anticipation of possible undesired scenarios that could imply on contract shortfalls, the evaluation of possible maneuvers, taking into account best gas delivery allocation. Different software were used for the simulation of best gas supply allocation and for the verification of delivery pressure and conditions for final consumers. The ability of being capable of dealing with undesired or crisis scenarios, based on suitable anticipation levels, is, nowadays, a highly valuable attribute to be presented by competitive corporations, for best crisis management and prompt recovery response. Those plans are being used by Gas and Power Gas Operation Control Centre and as an input for reliability modeling of gas supply chain. (author)
Oil and gas. Gas supply under pressure
International Nuclear Information System (INIS)
Forbes, A.
2008-01-01
The latest review of natural gas markets from the International Energy Agency (IEA) paints a picture of growing demand in the face of rising prices, a strengthening link between gas and electricity markets, and a globalising influence from increasingly flexible LNG supplies. But there are growing signs that security of supply is under threat from underinvestment, delays and cost escalation
Lindholm, Lena; Engström, Karl Gunnar
2012-09-01
Gas embolism is an identified problem during cardiopulmonary bypass (CPB). Our aim was to analyze the potential influence from gas solubility based on simple physical laws, here called endogenous gas embolism. Gas solubility decreases at higher temperature and gas bubbles are presumably formed at CPB warming. An experimental model to measure gas release was designed. Medium (water or blood retrieved from mediastinal drains, 14.6 mL) was incubated and equilibrated with gas (air, 100% oxygen, or 5% carbon dioxide in air) at low temperature (10 degrees C or 23 degrees C). At warming to 37 degrees C, gas release was digitally measured. Also, the effect of fluid motion was evaluated. At warming, the medium became oversaturated with dissolved gas. When fluid motion was applied, gas was released to form bubbles. This was exemplified by a gas release of .45% (.31/.54, medians and quartile range, volume percent, p = .007) and 1.26% (1.14/ 1.33, p = .003) when blood was warmed from 23 degrees C or 10 degrees C to 37 degrees C, respectively (carbon dioxide 5% in air). Consistent findings were seen for water and with the other types of gas exposure. The theory of endogenous gas embolization was confirmed with gas being released at warming. The endogenous gas formation demonstrated a dynamic pattern with oversaturation and with rapid gas released at fluid motion. The gas release at warming was substantial, in particular when the results were extrapolated to full-scale CPB conditions. The interference from endogenous gas formation should be considered in parallel to external sources of gas microemboli. cardiopulmonary bypass, gas embolization, microemboli, gas solubility, temperature.
International Nuclear Information System (INIS)
Corbin, Patrick; Ferrier, Jerome; Holleaux, Didier; Vivier, Laurent; Gattaz, Pierre; Delga, Carole; Carenco, Jean-Francois; Sadamori, Keisuke
2017-01-01
This special issue of 'Gaz d'Aujourd'hui' journal is entirely devoted to the 2017 Gas Congress proceedings. The congress was organized in 5 round tables and 12 workshops: Round table 1 - COP 21 2 years after, workshops 1-6: 1 - digital transformation: what are the challenges for the gas sector? 2 - Which actors and what policies to fight against energy insecurity? 3 - Natural gas development: what fiscal signs? 4 - Terrestrial transportation: current situation and prospects; 5 - Consumers' perception of gas; 6 - industrial uses; Round table 2 - Maritime and fluvial LNG perspectives; Round table 3 - Territories, the new decision-makers, workshops 7-12: 7 - What energy regulation for tomorrow? 8 - How to succeed in injecting more and more green gas? 9 - Digital, data and emerging technologies (drones, blockchain..): challenges and applications for gas networks? 10 - Underground storage: a promising infrastructure? 11 - Security of supply: what new cooperation? 12 - Power-to-gas: a new way of energy valorization; Round table 4 - Gas and electricity, winning synergies; Round table 5 - The Europe of gas
Energy Technology Data Exchange (ETDEWEB)
Santos, Antonio L.F. dos [PETROBRAS, Rio de Janeiro, RJ (Brazil). Gerencia de Tecnologia do Gas Natural; Freire, Luiz G.M. [PETROBRAS, Rio de Janeiro, RJ (Brazil). Coordenacao de Tecnologia da RedeGasEnergia
2004-07-01
The present work aims at to present a new methodology of Excellency Net of Natural Gas - RedeGasEnergia for the development do natural gas market no Brazil, through in the application do model management for technologies associates different segments da economy: residential, commercial, industrial, Vehicle and of cogeneration, in accord with the Strategical Planning of the PETROBRAS. The developed methodology is based on the interaction enters the technological lines of direction of the segments of the economy and marketing lines of direction, inside of a corporative environment enters the some agents of the productive chain of the Natural Gas, which is: University, the delivering and transporting Institutions of Research and Technologies (technological arm) and companies of NG, municipal, state and federal equipment manufacturers (enterprise arm) and agencies, trade associations (governmental arm) to which of integrated and articulated form carry through a sustainable development of the Natural Gas market in Brazil. A study of case of the methodology will be shown, from the analysis of the current scenes of the use of the natural gas in light vehicles and weighed, locomotives and boats, as well as the available infrastructure for the Vehicle applications. (author)
Gas situation in the world; Sekai no gas jijo
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-04-10
The Chinese Government intends to totally prohibit the combustion of coal as is in 2000 onward to deal with environmental problems. To attain the coal, however, it will have to develop technologies for high-efficiency coal utilization, coal pulverization for power generation, and power generation not dependent on coal. Qatar and India signed a letter confirming their intention to enhance cooperation in the oil and gas sectors. It is predicted that natural gas consumption in the United States will renew its maximum record in 1998. In the last half of this year, Venezuela will open its natural gas distribution and transportation sectors to foreign investors. Itohchu Oil Exploration Co., Ltd., operated by Itohchu Corporation for natural resources exploration, won the first success in a foreign capital-led trial drilling in the Caspian Sea off Azerbaijan. Six U.S. corporations plan to participitate in a project of constructing an LNG receiving base and distribution network in Lebanon. Norway is making efforts to increase its sale of gas to the British market despite there are great quantities of inexpensive gas in Britain. Britain will put off the complete liberalization of electric retailing scheduled to be effectuated in April this year until September. The investment in the oil and gas upstream sectors across the world in 1997 is found to be two times larger than that of 1990
Gas-path leakage seal for a gas turbine
Wolfe, C.E.; Dinc, O.S.; Bagepalli, B.S.; Correia, V.H.; Aksit, M.F.
1996-04-23
A gas-path leakage seal is described for generally sealing a gas-path leakage-gap between spaced-apart first and second members of a gas turbine (such as combustor casing segments). The seal includes a generally imperforate foil-layer assemblage which is generally impervious to gas and is located in the leakage-gap. The seal also includes a cloth-layer assemblage generally enclosingly contacting the foil-layer assemblage. In one seal, the first edge of the foil-layer assemblage is left exposed, and the foil-layer assemblage resiliently contacts the first member near the first edge to reduce leakage in the ``plane`` of the cloth-layer assemblage under conditions which include differential thermal growth of the two members. In another seal, such leakage is reduced by having a first weld-bead which permeates the cloth-layer assemblage, is attached to the metal-foil-layer assemblage near the first edge, and unattachedly contacts the first member. 4 figs.
International Nuclear Information System (INIS)
Seifert, M.
2006-01-01
The condensing gas boiler is now state of the art and there is no more room for improvement in performance, technically speaking. The next logical step to improve the overall efficiency is to exploit ambient heat in combination with the primary source of energy, natural gas. That means using natural-gas driven heat pumps and gas-fired heat pumps. Based on this, the Swiss Gas Industry decided to set up a practical test programme enjoying a high priority. The aim of the project 'Gas-fired heat pump practical test' is to assess by field tests the characteristics and performance of the foreign serial heat pumps currently on the market and to prepare and promote the introduction on the market place of this sustainable natural-gas technology. (author)
International Nuclear Information System (INIS)
Riddell, C.H.
1993-01-01
The natural gas industry and market prospects in Canada are reviewed from a producer's point of view. In the first eight months of 1993, $2.3 billion in new equity was raised for natural gas exploration and production, compared to $900 million in 1991 and $1.2 billion in 1992. The number of wells drilled in the western Canada basin is expected to reach 8,000-9,000 in 1993, up from 5,600 in 1992, and Canadian producers' share of the North American natural gas market will probably reach 20% in 1993, up from 13% in 1986. Potential and proved gas supply in North America is ca 750 trillion ft 3 , of which ca 30% is in Canada. Factors affecting gas producers in Canada are the deregulated nature of the market, low costs for finding gas (finding costs in the western Canada basin are the lowest of any basin in North America), and the coming into balance of gas supply and demand. The former gas surplus has been reduced by expanding markets and by low prices which reduced the incentive to find new reserves. This surplus is largely gone, and prices have started rising although they are still lower than the pre-deregulation prices. Progress is continuing toward an integrated North American gas market in which a number of market hubs allow easy gas trading between producers and consumers. Commodity exchanges for hedging gas prices are beginning operation and electronic trading of gas contracts and pipeline capacity will also become a reality. 4 figs
Gas development plan - Lithuania
International Nuclear Information System (INIS)
1993-10-01
A detailed description of the plan for the development of gas utilization in Lithuania is presented. The plan is subdivided under the headings of gas supply, gas demand, gas transmission and distribution, economy and the organization of the gas sector in the country. The first phase of the project has been undertaken by a Danish firm in cooperation with the Lithuanian firm Lietuvos Dujos. The first aim was to clarify the problems that will arise in connection with this joint venture on developing the use of gas in Lithuania, focusing on existing gas supply and market conditions, the current flow control and metering and economic constraints. The organization of the gas sector in the country as it stands today is described and possible models for its future organization are discussed in addition to a strategy of implementation. Possible development trends are outlined and maximum/minimum demand scenarios are suggested. Subjects and areas related to the gas sector in Lithuania are identified for further investigation in the next phase. It is stated that Lithuania is at present undergoing a fast transformation towards a market economy and that the transfer of foreign currency has been liberalized. Only the pipeline from Minsk to Vilnius is open at present and provides the total supply of natural gas to Lithuania and Kalingrad, controlled by the Russian gas company, Lentransgas, on the basis of a gas purchase agreement regulated on a yearly basis. Other possible supply sources are the Danish part of the North Sea and the Norwegian offshore fields. (AB)
Technology strategy for gas technologies; Technology Target Areas; TTA8 Gas Technology
Energy Technology Data Exchange (ETDEWEB)
2008-07-01
TTA8 - Gas technologies points out the various routes Norway can follow to capitalise on the vast resources of natural gas that will be produced in the years to come by developing a strong technology and competence platform. A broad view is taken for the value creation having as basis the continued gas export from NCS to Europe, but also a strong focus on development of gas resources in other parts of the world. The latter can also be seen as part of international positioning for upstream resources and does also include involvements in projects, and export of technology and products. The TTA has structured the analysis into 3 main areas: Gas transport and processing (pipeline, LNG, other); Gas conversion to fuels, chemicals and materials; CO{sub 2} management. In this report, for each of these areas, scenarios based on a gap analysis are presented. One of the key goals has been to identify pacing and emerging technologies for the next 20 years. Based on this, technologies have been mapped according to importance for future competitiveness and technology ambitions. This also includes primary funding responsibilities (public and/or industry). The road map below reflects the key issues in the proposed strategy. The base level of the figure explains areas that will have to be pursued to maintain Norway's role as a key gas and gas technology provider. The second layer represents near term options and possibilities with a reasonable risk profile that could further enhance the Norwegian position given the resources and drive to further develop this industry. As the top layer we have selected some of our 'dreams', what we may achieve if a progressive approach is followed with a strongly innovation based policy. It is acknowledged by the TTA that Norway cannot be a leading technology player in all aspects of the gas value chain. For some technologies we should be an active player and developer, whilst for other technologies we should become a competent buyer and user. This
Technology strategy for gas technologies; Technology Target Areas; TTA8 Gas Technology
Energy Technology Data Exchange (ETDEWEB)
2008-07-01
TTA8 - Gas technologies points out the various routes Norway can follow to capitalise on the vast resources of natural gas that will be produced in the years to come by developing a strong technology and competence platform. A broad view is taken for the value creation having as basis the continued gas export from NCS to Europe, but also a strong focus on development of gas resources in other parts of the world. The latter can also be seen as part of international positioning for upstream resources and does also include involvements in projects, and export of technology and products. The TTA has structured the analysis into 3 main areas: Gas transport and processing (pipeline, LNG, other); Gas conversion to fuels, chemicals and materials; CO{sub 2} management. In this report, for each of these areas, scenarios based on a gap analysis are presented. One of the key goals has been to identify pacing and emerging technologies for the next 20 years. Based on this, technologies have been mapped according to importance for future competitiveness and technology ambitions. This also includes primary funding responsibilities (public and/or industry). The road map below reflects the key issues in the proposed strategy. The base level of the figure explains areas that will have to be pursued to maintain Norway's role as a key gas and gas technology provider. The second layer represents near term options and possibilities with a reasonable risk profile that could further enhance the Norwegian position given the resources and drive to further develop this industry. As the top layer we have selected some of our 'dreams', what we may achieve if a progressive approach is followed with a strongly innovation based policy. It is acknowledged by the TTA that Norway cannot be a leading technology player in all aspects of the gas value chain. For some technologies we should be an active player and developer, whilst for other technologies we should become a competent buyer
Trends in the analysis of natural gas by capillary gas chromatography
Cramers, C.A.M.G.; Rossum, van G.J.
1986-01-01
The importance of correct determination of physical and chemical properties of natural gas is evident. The calculation of calorific value or hydrocarbon dew point requires detailed analysis as can be provided by gas chromatography. Analysis by gas chromatography is a necessary complement to direct
International Nuclear Information System (INIS)
Cognasse, Olivier; Dupin, Ludovic; Chandes, Camille
2013-01-01
A first article illustrates the strong presence of French companies in the shale gas sector, from the exploitation to gas liquefaction. Some examples are evoked: Total (gas fields and petrochemical), CGG (seismic exploration), Vallourec (tube manufacturer), Nexans (cable manufacturer), Imery and Saint-Gobain (ceramic balls used to maintain cracks opened), Saltel (fracturing), SNF Floerger (extraction), GDF Suez (shale gas export). The interest of some foreign actors in the French shale gas is also evoked. A second article reports the activity of Total in Port Arthur, Texas, where it adapted a huge steam cracker to shale gas. This illustrates the renewal of the American petrochemical industry
unconventional natural gas reservoirs
International Nuclear Information System (INIS)
Correa G, Tomas F; Osorio, Nelson; Restrepo R, Dora P
2009-01-01
This work is an exploration about different unconventional gas reservoirs worldwide: coal bed methane, tight gas, shale gas and gas hydrate? describing aspects such as definition, reserves, production methods, environmental issues and economics. The overview also mentioned preliminary studies about these sources in Colombia.
Energy Technology Data Exchange (ETDEWEB)
Maculan, Berenice D. [Agencia Nacional do Petroleo, Gas Natural e Biocombustiveis (ANP), Rio de Janeiro, RJ (Brazil); Falabella, Eduardo [PETROBRAS, Rio de Janeiro, RJ (Brazil). Centro de Pesquisas (CENPES)
2004-07-01
The GTL - gas to liquids technology was born in Germany, after the 20's with the goal to product liquid fuel from coal to supply the bellicose and domestic demand. The grow of the petroleum industry lead the world to the forgiveness of the GTL technology, except in South Africa. In the last two decades the number of news natural gas reserves and the perspectives of the increase demand from natural gas for the next 20 years change this scenario. Nearly 60% of this reserves are calling stranded or remote, meaning reserves which can't produce with conventional technologies (logistics and economics barriers). So, the oil and gas industry restart to analyze the economics and applicability of the GTL technology. The competitively and applicability of this technology were evaluated and compared to the traditional way of natural gas transport, as well as the solidification of the new environmental rules and the creation of niche to this kind of fuel - the cleans ones - seams the cause of this changes in the oil and gas industries. Which began to adjust to all this news rules and conditions, as show in the sum of investments in R and D area. So, is in this new scenario that the reappear of GTL technology is consider has a technological innovation. (author)
Large scale gas injection test (Lasgit): Results from two gas injection tests
International Nuclear Information System (INIS)
Cuss, R. J.; Harrington, J. F.; Noy, D. J.; Wikman, A.; Sellin, P.
2011-01-01
This paper describes the initial results from a large scale gas injection test (Lasgit) performed at the Aespoe Hard Rock Laboratory (Sweden)). Lasgit is a full-scale field-scale experiment based on the Swedish KBS-3V repository concept, examining the processes controlling gas and water flow in compact buffer bentonite. The first 2 years of the test focused on the artificial hydration of the bentonite buffer. This was followed by a programme of hydraulic and gas injection tests which ran from day 843 to 1110. A further period of artificial hydration occurred from day 1110 to 1385, followed by a more complex programme of gas injection testing which remains on going (day 1385+). After 2 years of hydration, hydraulic conductivity and specific storage values in the lower filter array were found to range from 9 x 10 -14 to 1.6 x 10 -13 m/s and 5.5 x 10 -5 to 4.4 x 10 -4 m -1 respectively, with the injection filter FL903 yielding values of 7.5 x 10 -14 m/s and 2.5 x 10 -5 m -1 . A second set of hydraulic measurements were performed over 1 year and a half later yielding similar values, in the range 7.8 x 10 -14 m/s and 1.3 x 10 -13 m/s. The hydraulic conductivity of FL903 had reduced slightly to 5.3 x 10 -14 m/s while specific storage had increased to 4.0 x 10 -5 m -1 . Both datasets agree with laboratory values performed on small-scale saturated samples. Two sets of gas injection tests were performed over a 3 year period. During the course of testing, gas entry pressure was found to increase from around 650 kPa to approximately 1.3 MPa, indicative of the maturation of the clay. The sequential reduction in volumetric flow rate and lack of correlation between the rate of gas inflow and the gas pressure gradient observed during constant pressure steps prior to major gas entry, is suggestive of a reduction in gas permeability of the buffer and indicates only limited quantities of gas can be injected into the clay without interacting with the continuum stress field. Major gas
Natural gas resources in Canada
International Nuclear Information System (INIS)
Meneley, R.A.
2001-01-01
Natural gas is an important component in many of the technologies aimed at reducing greenhouse gas emissions. In order to understand the role that natural gas can play, it is important to know how much may be present, where it is, when can it be accessed and at what cost. The Canadian Gas Potential Committee has completed its second report 'Natural Gas Potential in Canada - 2001' (CGPC, 2001). This comprehensive study of exploration plays in Canada addresses the two issues of 'how much may be present' and 'where is it'. The Report deals with both conventional gas and non-conventional gas. One hundred and seven Established Conventional Exploration Plays, where discoveries of gas exist, have been assessed in all of the sedimentary basins in Canada. In addition, where sufficient information was available, twelve Conceptual Exploration Plays, where no discoveries have been made, were assessed. Sixty-five other Conceptual Plays were described and qualitatively ranked. An experienced volunteer team of exploration professionals conducted assessments of undiscovered gas potential over a four-year period. The team used technical judgment, statistical techniques and a unique peer review process to make a comprehensive assessment of undiscovered gas potential and estimates of the size of individual undiscovered gas accumulations. The Committee assessed all gas in place in individual exploration plays. For Established Plays, estimates of Undiscovered Nominal Marketable Gas are based on the percentage of the gas in place that is marketable gas in the discovered pools in a play. Not all of the Nominal Marketable Gas will be available. Some underlies areas where exploration is not possible, such as parks, cities and other closed areas. Some will be held in gas pools that are too small to be economic and some of the pools will never be found. In some areas no production infrastructure will be available. Detailed studies of individual exploration plays and basins will be required
Gas system 2015: Press conference 21 January 2016 + Gas consumption by administrative regions
International Nuclear Information System (INIS)
2016-01-01
GRTgaz is a European leader in natural gas transmission, a world expert in gas transmission networks and systems, and an operator firmly committed to the energy transition. It owns and operates the gas transmission network throughout most of France and it manages the transmission network in Germany, thereby helping to ensure correct operation of the French and European gas market. It contributes to the energy security of regional supply systems and performs a public service mission to ensure the continuity of consumer supply. This document presents some key figures about GRTgaz activity in 2015: Gas consumption resumed despite warm conditions in 2015. Gas demand for power generation in gas-fired power plants has strongly increased, due to favourable economic conditions. 2015 was characterised by the lowest LNG imports to France ever, which entailed a still intensive use of the North-South link, despite transits to Spain and Italy back to 5 year average level. New gas uses and biomethane permitted to avoid 490,000 tonnes of CO 2 emissions in 2015. A second part presents the regional gas consumptions by administrative regions
International Nuclear Information System (INIS)
Bohl, T.L.
1982-01-01
A differential thermocouple hydrogen gas detector has one thermocouple junction coated with an activated palladium or palladium-silver alloy catalytic material to allow heated hydrogen gas to react with the catalyst and raise the temperature of that junction. The other juction is covered with inert glass or epoxy resin, and does not experience a rise in temperature in the presence of hydrogen gas. A coil heater may be mounted around the thermocouple junctions to heat the hydrogen, or the gas may be passed through a heated block prior to exposing it to the thermocouples
International Nuclear Information System (INIS)
Thomas, V.
2000-01-01
This article reports on the economic recovery that is underway in Latin America which remains one of the world's most important markets for natural gas which will need investment over the coming years. Forecasts of rising gas demand, the restructuring of the gas industry, estimates of the investments needed, Latin America's heavy use of hydroelectric power, market patterns for international gas trade in South America, and the construction of a Bolivia to Brazil pipeline are discussed. Overviews of the situations in Argentina, Venezuela, Brazil, and Bolivia are presented
Development of natural gas ocean transportation chain by means of natural gas hydrate (NGH)
International Nuclear Information System (INIS)
Nogami, T.; Oya, N.; Ishida, H.; Matsumoto, H.
2008-01-01
Recent studies in Japan have suggested that natural gas hydrate (NGH) transportation of natural gas is more economical than liquefied natural gas (LNG) transportation systems for small, medium and remote gas fields. Researchers in Japan have built a 600 kg per day NGH production and pelletizing plant and regasification facility. This paper discussed feasibility studies conducted in southeast Asia to determine the unit's commercialization potential with large natural gas-related businesses including shipping companies and electric power utilities. The total supply chain was compared with the corresponding liquefied natural gas (LNG) and compressed natural gas (CNG) supply chains. The study also examined natural gas reserves, energy policies, the positioning of natural gas supplies, and future forecasts of natural gas demand. A conceptual design for an NGH supply chain in Indonesia was presented. Results of the study have demonstrated that the NGH chain is an appropriate and economically feasible transportation method for many areas in southeast Asia. 8 refs., 10 figs
Energy Technology Data Exchange (ETDEWEB)
Graf, Frank [DVGW-Forschungsstelle am KIT, Karlsruhe (Germany); Groeschl, Frank; Wetzel, Uwe [DVGW, Bonn (Germany); Heikrodt, Klaus [Hochschule Ostwestfalen-Lippe, Lemgo (Germany); Krause, Hartmut [DBI Gastechnologisches Institut, An-Institut der TU Bergakademie, Freiberg (Germany); Beestermoeller, Christina; Witschen, Bernhard [Team Consult G.P.E. GmbH, Berlin (Germany); Albus, Rolf; Burmeister, Frank [Gas- und Waerme-Institut Essen e.V., Essen (Germany)
2015-07-01
The reform of the EEG in Germany, a positive global development in natural gas, the decline in oil prices, questions about the security of supply in Europe, and not least the effect of the decision by E.on at the end of 2014 have moved the gas industry. Gas has the lowest CO{sub 2} emissions of fossil fuels. Flexibility, storability, useful for networks and the diversity in the application make it an ideal partner for renewable energy. However, these complementary properties are valued at wind and photovoltaics internationally and nationally different. The situation in the gas power plants remains tense. LNG - liquefied natural gas - is on the rise. [German] Die Reform des EEG in Deutschland, eine positive Entwicklung beim Gas weltweit, der Verfall der Oelpreises, Fragen zur Versorgungssicherheit in Europa und nicht zuletzt die Auswirkung der Entscheidung von E.on Ende 2014 haben die Gaswirtschaft bewegt. Gas weist die geringsten CO{sub 2}-Emissioen der fossilen Energietraeger auf. Flexibilitaet, Speicherbarkeit, Netzdienlichkeit sowie die Vielfalt in der Anwendung machen es zum idealen Partner der erneuerbaren Energien. Allerdings werden diese komplementaeren Eigenschaften zu Wind und Photovoltaik international und national unterschiedlich bewertet. Die Lage bei den Gaskraftwerken bleibt weiter angespannt. LNG - verfluessigtes Erdgas - ist auf dem Vormarsch.
Energy Technology Data Exchange (ETDEWEB)
NONE
2010-08-15
The ongoing improvement of production technologies has enabled access to unconventional gas resources present in source rocks. Whether Poland is going to see a gas revolution depends chiefly on the geological conditions. At this point it is difficult to estimate the actual size of Poland's shale gas resources and commercialization of shale gas production. First results will be known in the next four or five years, when operators complete the work under exploration and appraisal licences granted to them by the Ministry of the Environment. Polish government is offering licences on exceptionally favourable terms as an incentive for research on unconventional gas resources. Such an approach is driven by the strategic objective of ending Poland's reliance on foreign sources of natural gas in the future. Shale gas will not change Poland's and the region's energy landscape instantaneously. As in the case of all commodity and energy revolutions, changes occur slowly, but shale gas development offers huge opportunities for a permanent shift in the Polish and European energy sectors. Poland stands a chance of becoming fully independent on natural gas imports, and Polish companies - a chance of improving their international standing.
Larsen, Tarjei Thorrud
2011-01-01
Subsea wet gas compression renders new possibilities for cost savings and enhanced gas recovery on existing gas wells. Technology like this opens to make traditional offshore processing plants redundant. With new technology, follows new challenges. Multiphase flows is regarded as a complex field of study, and increased knowledge on the fundamental mechanisms regarding wet gas flow is of paramount importance to the efficiency and stability of the wet gas compressor. The scope of this work was ...
International Nuclear Information System (INIS)
Thomas, V.
2001-01-01
Despite the significant contribution of the Middle East countries of Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia and the United Arab Emirates in the Arabia Gulf to the world's oil output, they are placing increasing emphasis on natural gas as a source of exports and to fuel domestic economic growth. The region accounts for 35% of the world's proven gas resource base, with Iran and Qatar holding major reserves. The region is becoming increasingly important in global liquefied natural gas (LNG) trade and details of key LNG projects and the major players in this area are given; a key advantage is the region's position between the two main markets - the Asia Pacific and the Atlantic Basin. Brief details are also given of gas pipeline projects and gas-to-liquid (GTL) projects in the region
International Nuclear Information System (INIS)
Lucas, D.A.
1991-01-01
Canada's natural gas industry enjoys a quiet confidence as it looks ahead to the 1990s. In this paper, the author explains why, despite some critical uncertainties, the optimism endures. Reviewing the current conditions of supply, production, consumption, pipelines, and pipeline expansion plans, the author contends that the New World of the 1990s will belong to natural gas. The author's assessment of natural gas markets proceeds far beyond the borders of Canada. The author examines the determinants of gas prices throughout North America and he identifies the one force that promises to seize almost complete control of gas prices throughout the continent. While the analysis points out the attributes of this new pricing regime, it also names the obstacles that could prevent this emerging mechanism from assuming its anticipated position
International Nuclear Information System (INIS)
Therme, C.
2008-01-01
The development of the gas sector has not allowed, up to now, Iran to become one of the main gas actors, whether it is on the regional or international market. This under-development of the gas sector finds expression, each winter, through the Iranian incapability to satisfy its domestic demand as well as its exportation commitments to Turkey or Armenia. In this study, the author tries to examine the origins of Iranian difficulties to increase its gas production and to abide by its commitments to export gas to other countries. The possibility of gas exportation from Iran to the European Union is also discussed
Exhaust gas processing facility
International Nuclear Information System (INIS)
Terada, Shin-ichi.
1995-01-01
The facility of the present invention comprises a radioactive liquid storage vessel, an exhaust gas dehumidifying device for dehumidifying gases exhausted from the vessel and an exhaust gas processing device for reducing radioactive materials in the exhaust gases. A purified gas line is disposed to the radioactive liquid storage vessel for purging exhaust gases generated from the radioactive liquid, then dehumidified and condensed liquid is recovered, and exhaust gases are discharged through an exhaust gas pipe disposed downstream of the exhaust gas processing device. With such procedures, the scale of the exhaust gas processing facility can be reduced and exhaust gases can be processed efficiently. (T.M.)
Flammable gas tank safety program: Technical basis for gas analysis and monitoring
International Nuclear Information System (INIS)
Sherwood, D.J.
1995-01-01
Flammable gases generated in radioactive liquids. Twenty-five high level radioactive liquid waste storage tanks located underground at the Hanford Site are on a Flammable Gas Watch List because they contain waste which tends to retain the gases generated in it until rather large quantities are available for sudden release to the tank head space; if a tank is full it has little dome space, and a flammable concentration of gases could be produced--even if the tank is ventilated. If the waste has no tendency to retain gas generated in it then a continual flammable gas concentration in the tank dome space is established by the gas production rate and the tank ventilation rate (or breathing rate for unventilated tanks); this is also a potential problem for Flammable Gas Watch List tanks, and perhaps other Hanford tanks too. All Flammable Gas Watch List tanks will be fitted with Standard Hydorgen Monitoring Systems so that their behavior can be observed. In some cases, such as tank 241-SY-101, the data gathered from such observations will indicate that tank conditions need to be mitigated so that gas release events are either eliminated or rendered harmless. For example, a mixer pump was installed in tank 241-SY-101; operating the pump stirs the waste, replacing the large gas release events with small releases of gas that are kept below twenty-five percent of the lower flammability limit by the ventilation system. The concentration of hydrogen measured in Hanford waste tanks is greater than that of any other flammable gas. Hydrogen levels measured with a Standard Hydrogen Monitoring System in excess of 0.6 volume percent will cause Westinghouse Hanford Company to consider actions which will decrease the amount of flammable gas in the tank
Energy Technology Data Exchange (ETDEWEB)
Chang, Paulo Lee K.C. [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Faculdade de Engenharia Mecanica; Ligero, Eliana L.; Schiozer, Denis J. [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Faculdade de Engenharia Mecanica. Dept. de Engenharia de Petroleo
2008-07-01
Most of Brazilian gas fields are low-permeability or tight sandstone reservoirs and some of them should be gas condensate reservoir. In this type of natural gas reservoir, part of the gaseous hydrocarbon mixture is condensate and the liquid hydrocarbon accumulates near the well bore that causes the loss of productivity. The liquid hydrocarbon formation inside the reservoir should be well understood such as the knowledge of the variables that causes the condensate formation and its importance in the natural gas production. This work had as goal to better understanding the effect of condensate accumulation near a producer well. The influence of the porosity and the absolute permeability in the gas production was studied in three distinct gas reservoirs: a dry gas reservoir and two gas condensate reservoirs. The refinement of the simulation grid near the producer well was also investigated. The choice of simulation model was shown to be very important in the simulation of gas condensate reservoirs. The porosity was the little relevance in the gas production and in the liquid hydrocarbon formation; otherwise the permeability was very relevant. (author)
Morrow, Thomas B [San Antonio, TX; Kelner, Eric [San Antonio, TX; Owen, Thomas E [Helotes, TX
2008-07-08
A gas energy meter that acquires the data and performs the processing for an inferential determination of one or more gas properties, such as heating value, molecular weight, or density. The meter has a sensor module that acquires temperature, pressure, CO2, and speed of sound data. Data is acquired at two different states of the gas, which eliminates the need to determine the concentration of nitrogen in the gas. A processing module receives this data and uses it to perform a "two-state" inferential algorithm.
International Nuclear Information System (INIS)
Woodord, Julian.
1997-01-01
This article examines the move by water utilities into the gas market and potentially into the electricity supply market. Operation by Dee Valley Holdings, York Waterworks, York Gas, and North Wales Gas are reported, and investment, use of mail campaigns and telemarketing to secure customers, and the opportunities offered by diversification are considered. (UK)
Diatomic infrared gas-dynamic laser
International Nuclear Information System (INIS)
Mckenzie, R.L.
1971-01-01
A laser is provided which utilizes the infrared vibration rotation transitions of a diatomic gas such as carbon monoxide. The laser action is produced by an active diatomic gas such as carbon monoxide mixed with a vibrationally resonant pumping gas such as nitrogen. In addition, a noble gas such as argon may be employed as a third gas in the mixture. The gas mixture contains from 1 to 80 vol percent of the active gas based on the pumping gas, and the third gas, if used, can constitute up to 90 percent of the total gas volume. A number of significantly different wavelengths can be produced by the laser. A single laser may contain several optical resonators at different locations, so that the desired wave length can be selected at will
International Nuclear Information System (INIS)
Newcomb, J.
1990-01-01
During the 1990s, natural gas will be the critical pressure point for energy and environmental developments in North America, according to the author of this paper. The author points to the forces bearing on natural gas, including the need for new power generation capacity, tightening environmental standards, growing concerns about energy security, cyclical factors in U.S. oil and gas exploration, and changes in the oil services industry. This paper discusses how these external factors will shape gas markets in the 1990s. First, it states that gas will gain market share in power generation through greater use of both existing gas-fired facilities and new turbines by electric utilities. Second, it predicts that the cumulative impact of the Clean Air Act and other environmental legislation having significant consequences for the relative roles of coal and natural gas, particularly during the late 1990s. Third, it points to the eventual reawakening of energy security concerns, focusing attention on developing North America's sizeable gas reserves. Finally, it states that while the long-term view of a gas supply crisis without a rebound in drilling activity is accurate, it has been disastrously wrong in the short term. This had led to underestimation of the amount of extra gas that can be provided in the interim from conventional areas at relatively low cost
1st European Conference on Gas Micro Flows (GasMems 2012)
Frijns, A.J.H.; Valougeorgis, D.; Colin, S.; Baldas, L.
2012-01-01
PREFACE The aim of the 1st European Conference on Gas Micro Flows is to advance research in Europe and worldwide in the field of gas micro flows as well as to improve global fundamental knowledge and to enable technological applications. Gas flows in microsystems are of great importance and touch
Refining Bio-Gas Produced from Biomass: An Alternative to Cooking Gas
Directory of Open Access Journals (Sweden)
A. S. ABDULKAREEM
2005-06-01
Full Text Available Our life is completely dependent on a reliable and adequate supply of energy. In other to reduce dependence on fossil fuels, the use of animal dung in producing a renewable alternative source of energy has been proved using cow dung. This work is aimed at produced and refined bio - gas from animal dung by reduces the H2S and CO2 content of bio - gas in other to improved the quality of the bio - gas to be used as an alternative to the petroleum based produces in use now. The sample of gas produced was passed through the gas chromatography to determine the percentage composition (mol % dry basis of the bio - gas contents. The results of the bio - gas before refinement were 54.09% mole dry CH4, 40.02mole % dry CO2 and 0.80mole % dry H2S which conformed with the literature values of 50 - 65 % mole dry CH4, 35 - 50 % mole dry CO2 and 0.1 - 1.0 % mole dry H2S. After refining, the composition of bio - gas on dry basis were 54.09% mole dry CH4, 4.01% mole dry CO2, 0.02% mole dry O2, 0.05% mole dry NH3, 0.01% mole dry H2S, 0.5% mole dry H2 and 2.54% mole dry N2. Analysis of the remnant indicated that it could be used for plant nutrient.
Directory of Open Access Journals (Sweden)
Fangtian Wang
2017-09-01
Full Text Available A thin coal seam mined as a protective coal seam above a gas outburst coal seam plays a central role in decreasing the degree of stress placed on a protected seam, thus increasing gas permeability levels and desorption capacities to dramatically eliminate gas outburst risk for the protected seam. However, when multiple layers of coal seams are present, stress-relieved gas from adjacent coal seams can cause a gas explosion. Thus, the post-drainage of gas from fractured and de-stressed strata should be applied. Comprehensive studies of gas permeability evolution mechanisms and gas seepage rules of protected seams close to protective seams that occur during protective seam mining must be carried out. Based on the case of the LongWall (LW 23209 working face in the Hancheng coal mine, Shaanxi Province, this paper presents a seepage model developed through the FLAC3D software program (version 5.0, Itasca Consulting Group, Inc., Minneapolis, MI, USA from which gas flow characteristics can be reflected by changes in rock mass permeability. A method involving theoretical analysis and numerical simulation was used to analyze stress relief and gas permeability evolution mechanisms present during broken rock mass compaction in a goaf. This process occurs over a reasonable amount of extraction time and in appropriate locations for comprehensive gas extraction technologies. In using this comprehensive gas drainage technological tool, the safe and efficient co-extraction of thin coal seams and gas resources can be realized, thus creating a favorable environment for the safe mining of coal and gas outburst seams.
Gas revenue increasingly significant
International Nuclear Information System (INIS)
Megill, R.E.
1991-01-01
This paper briefly describes the wellhead prices of natural gas compared to crude oil over the past 70 years. Although natural gas prices have never reached price parity with crude oil, the relative value of a gas BTU has been increasing. It is one of the reasons that the total amount of money coming from natural gas wells is becoming more significant. From 1920 to 1955 the revenue at the wellhead for natural gas was only about 10% of the money received by producers. Most of the money needed for exploration, development, and production came from crude oil. At present, however, over 40% of the money from the upstream portion of the petroleum industry is from natural gas. As a result, in a few short years natural gas may become 50% of the money revenues generated from wellhead production facilities
Steelmaking gas prediction system; Sistema de predicao de gas de aciaria
Energy Technology Data Exchange (ETDEWEB)
Diniz, Pedro Henrique Boaventura; Sampaio, William Genelhu [USIMINAS, Ipatinga, MG (Brazil)
2011-12-21
The Usiminas, Steelmaking Plant located in Ipatinga - MG, has the necessity to complement its energy matrix with additional fuel (oil derived from petroleum presently). Despite the high cost of this fuel, 24,3% of the LDG gas was wasted due to inadequate size of the LDG gas holder and the inappropriate tool to manage the distribution of the fuel. This paper presents how the Steelmaking Gas Prediction System was developed aiming to improve its management and other actions to increase the gas usage minimizing the matrix complementation. (author)
Having our gas and selling it too : natural gas distribution in Atlantic Canada
International Nuclear Information System (INIS)
Tucker, T.L.; Crowley, B.L.
2002-01-01
This paper presented an overview of the gas industry in Atlantic Canada, its history and development, with particular attention to the future of natural gas in Atlantic Canada, market pricing and rationalized regulation. It also includes a primer on the economic forces behind the industry. A regulatory framework was recommended that will provide gas to the greatest number of consumers at the lowest possible price. The report also describes 10 popular misconceptions regarding how the region believes it can best benefit from natural gas. The report dispels the idea that the greatest benefit comes from consuming natural gas locally. Other misconceptions are that gas can be sold locally at discount prices and at a premium to export markets. It was emphasized that Atlantic Canada needs the gas as much as New England markets, but the investment by consumers in the United States are a big driving force for offshore gas development. The author emphasized that even if Atlantic Canada never consumes its own natural gas, the royalties, economic growth, economic diversification and a new addition to the energy mix will generate benefits much greater than those which could come from local consumption alone. The author also suggests that the lack of market power in Atlantic Canada means that gas-specific provincial regulations to protect the public interest are not required. It was suggested that a gas distributor should be chosen to build the infrastructure and attract customers. This paper demonstrated that the greatest benefit to the region will come from deregulating the distribution industry while realizing the full market value of the gas for its owners. 15 refs
Natural gas marketing and transportation
International Nuclear Information System (INIS)
Anon.
1991-01-01
This book covers: Overview of the natural gas industry; Federal regulation of marketing and transportation; State regulation of transportation; Fundamentals of gas marketing contracts; Gas marketing options and strategies; End user agreements; Transportation on interstate pipelines; Administration of natural gas contracts; Structuring transactions with the nonconventional source fuels credit; Take-or-pay wars- a cautionary analysis for the future; Antitrust pitfalls in the natural gas industry; Producer imbalances; Natural gas futures for the complete novice; State non-utility regulation of production, transportation and marketing; Natural gas processing agreements and Disproportionate sales, gas balancing, and accounting to royalty owners
Common ground : bitumen and gas producers come together to find gas-over-bitumen solutions
Energy Technology Data Exchange (ETDEWEB)
Ross, E.
2005-08-01
The gas-over-bitumen issue has meant that hundreds of natural gas wells remain closed while regulatory hearings and research activities continue. The Alberta Energy and Utilities Board should soon reach a final decision on the status of gas wells considered to be a threat to thermal extraction of underlying oil sands. This article discussed collaborative efforts by oil and gas companies to resolve these issues, including the use of fluid injection technology, low pressure Steam-Assisted Gravity Drainage (SAGD) and artificial lift. The objective of the Gas Reinjection and Production Experiment (GRIPE) is to reinject gas to displace natural gas being produced. The pilot project, conducted by Paramount Resources Ltd., consists of 2 injector wells, 4 producers and 12 observation wells that measure gas pressure in the reservoir. The project also includes a 2 stage compressor modified to handle flue gas. According to reservoir simulations, Paramount should be able to recover between 50 to 60 per cent of the remaining gas in place. Results from the pilot suggest that the technique could result in more than half the currently shut-in pools being re-opened. It was suggested that gas-by-gas displacement may result in higher recovery rates because there is usually more remaining gas in place. It was noted that EnCana Corporation has also been repressurizing a depleted natural gas pool by injecting compressed air rather than flue gas. Various other projects were reviewed, including the use of electric submersible pumps, low pressure SAGD and new SAGD well pair configurations. It was concluded that the artificial lift and low pressure SAGD technical sub-committee have now filed 10 applications for funding under the Alberta Energy Department's Innovative Energy Technology Program.
Energy Technology Data Exchange (ETDEWEB)
Warnecke, Wolfgang; Karanikas, John; Levell, Bruce; Mesters, Carl; Schreckenberg, Jens; Adolf, Joerg [Shell Deutschland (Germany)
2013-08-01
Great progress has been made in the exploration and production of natural gas in recent years. Reserves of conventional gas are plentiful, and large resources of unconventional gas have been added. At the same time, there is still a lot of pressure for climate action to reduce greenhouse gas emissions. Natural gas is the lowest-carbon fossil fuel. Almost all medium- to long-term energy scenarios foresee a substantial increase in global consumption of natural gas. It can be used to generate both power and heat. But so far gaseous fuels have had only a niche position as an option for the transport sector. Increased discussion of gas, in particular natural gas, as a future transport fuel started just recently. The following article starts by considering the development of supply and current expectations for availability of natural gas. It discusses the various types of gas, in particular conventional and unconventional, and technical methods both standard and new for gas production. It also deals with natural gas demand scenarios and future markets, including the value chain for natural gas fuels. The article covers in particular the use of gaseous and gas-based fuels in the transport sector. It examines various production paths for natural gas fuels for transport, and also the fuels as such (CNG, LNG, GTL); it compares the product characteristics of natural gas fuels with those of conventional fuels (gasoline / diesel fuel) and other gaseous fuels (in particular LPG and hydrogen). It discusses the application possibilities of gas fuels in the various transport sectors. It considers the use of gas fuels in internal combustion engines in different transport sectors with different combustion processes, including consideration of their energy efficiency (consumption / performance) and their ecological performance (air pollutants and greenhouse gas emissions). Finally, it addresses the question of what and under what conditions natural gas fuels can contribute to an &apos
International Nuclear Information System (INIS)
2002-01-01
The gas crisis in Europe is getting more evident. Basing his discussion on BP's annual statistical review of world energy, 2002, the author concludes that an increasing number of the major European consumers of natural gas may acquire a supply- and safety problem and become more dependent on imported gas for operating power stations. This is going to be most dramatic for France, Germany and Italy. Great Britain have gas reserves that will last for about seven years. Spain is an interesting ''phenomenon'' in the European gas market; they have trebled their gas consumption during the last decade. Europe's dependence on a high production rate on the Norwegian Shelf has become stronger from year to year
International Nuclear Information System (INIS)
1974-01-01
The invention aims at simplying gas-cooled nuclear reactors. For the cooling gas, the reactor is provided with a main circulation system comprising one or several energy conversion main groups such as gas turbines, and an auxiliary circulation system comprising at least one steam-generating boiler heated by the gas after its passage through the reactor core and adapted to feed a steam turbine with motive steam. The invention can be applied to reactors the main groups of which are direct-cycle gas turbines [fr
International Nuclear Information System (INIS)
Powell, B.E.; Bakhshi, V.S.; Randolph, D.A.
1984-01-01
A process for adsorbing sulfur dioxide from a gas comprising contacting a gas containing SO 2 , such as a flue gas, with about stoichiometric amounts of a specially prepared calcium oxide so that substantially all of the sulfur dioxide content is reacted throughout the calcium oxide particle to form a calcium sulfate reaction product. The useful calcium oxide particles comprise a highly voided skeletal structure of very large surface area and large pore volume with numerous macro pores. Such particles are obtained by flash calcining sand-size grains of calcium carbonate, such as aragonite, calcite or dolomite
Energy Technology Data Exchange (ETDEWEB)
Farahan, E.; Eudaly, J.P.
1978-10-01
This evaluation provides performance and cost data for commercially available simple- and regenerative-cycle gas turbines. Intercooled, reheat, and compound cycles are discussed from theoretical basis only, because actual units are not currently available, except on a special-order basis. Performance characteristics investigated include unit efficiency at full-load and off-design conditions, and at rated capacity. Costs are tabulated for both simple- and regenerative-cycle gas turbines. The output capacity of the gas turbines investigated ranges from 80 to 134,000 hp for simple units and from 12,000 to 50,000 hp for regenerative units.
A gas circulation and purification system for gas-cell-based low-energy RI-beam production
Energy Technology Data Exchange (ETDEWEB)
Sonoda, T.; Wada, M.; Katayama, I.; Kojima, T. M.; Reponen, M. [RIKEN Nishina Center for Accelerator-Based Science, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Tsubota, T. [Tokyo KOATSU Co., Ltd., 1-9-8 Shibuya, Shibuyaku, Tokyo 150-0002 (Japan)
2016-06-15
A gas circulation and purification system was developed at the RIKEN Radioactive Isotope Beam Factory that can be used for gas-cell-based low-energy RI-beam production. A high-flow-rate gas cell filled with one atmosphere of buffer gas (argon or helium) is used for the deceleration and thermalization of high-energy RI-beams. The exhausted buffer gas is efficiently collected using a compact dry pump and returned to the gas cell with a recovery efficiency of >97%. The buffer gas is efficiently purified using two gas purifiers as well as collision cleaning, which eliminates impurities in the gas. An impurity level of one part per billion is achieved with this method.
The origin of gas seeps and shallow gas in northern part of South China Sea
Li, M.; Jin, X.
2003-04-01
The northern part of South China Sea is of passive continental margin, which geologic units include shelf, slope and deep sea basin. There are rifting basins forming during Paleogene (or Cretaceous ?) to Quaternary developed on shelf and slope, which sediments are dominated by fluvial and lake clastic rock of Paleogene, and marine clastic rock and carbonate of Neogene - Quaternary. The main basins include the Pearl River Mouth Basin, Beibu Gulf basin, Qiongdongnan Basin and Yinggehai basin. They contain rich oil and gas resources, and have become important industrial oil and gas producing region in South China Sea. With the increasing of petroleum exploration actives and marine petroleum engineering, it has been paid more attention to the investigation and research of gas seeps and shallow gas, for they become a potential threaten to the marine engineering while they are regarded as the indicators of industrial oil and gas. By study the distribution and geochemical characteristics of gas seeps in northeast part of Yinggehai basin and shallow gas in sediments on slope, combined with their regional geologic background, this paper deals with the origin, migration pathway and emission mechanism of gas seeps and shallow gas in northern part of South China Sea, for providing a base knowledge for the evaluation of marine engineering geology. In northeast part of Yinggehai basin gas seeps have been found and recorded for near 100 years. During 1990s, as a part of petroleum exploration, the gas seeps in the basin have been investigated and research by oil companies (Baojia Huang et al., 1992; Jiaqiong He et al., 2000). Gas seeps were found in shallow water area along southwest coast of Hainan Island, water depth usually less than 50 m. The occurrence of gas seeps can be divided into two types: (1) gas continuously emission, continuous gas bubbles groups can be detected by sonar underwater and observed on water surface. (2) gas intermittently emission, the time intervals
International Nuclear Information System (INIS)
Posner, D.M.
1988-01-01
Marketing natural gas produced in the San Juan Basin of New Mexico and Colorado principally involves four gas pipeline companies with significant facilities in the basin. The system capacity, transportation rates, regulatory status, and market access of each of these companies is evaluated. Because of excess gas supplies available to these pipeline companies, producers can expect improved take levels and prices by selling gas directly to end users and utilities as opposed to selling gas to the pipelines for system supply. The complexities of transporting gas today suggest that the services of an independent gas marketing company may be beneficial to smaller producers with gas supplies in the San Juan Basin
Combined production og energy by vapor-gas unit on natural gas in Skopje (Macedonia)
International Nuclear Information System (INIS)
Armenski, Slave; Dimitrov, Konstantin; Tashevski, Done
1998-01-01
The steam and gas turbine power plant for combine heat (for district heating of Skopje - the capital of Macedonia) and power (connected to the grid) production is analyzed and determined. Two variants of power plants are analyzed: power plant with gas turbine, heat recovery steam generator and a back pressure steam turbine; and power plant with two gas turbines, two heat recovery steam generators (HRSG) and one back pressure steam turbine. The power plant would operate on natural gas as the main fuel source. It will be burnt in the gas turbine as well in the HRSG as an auxiliary fuel.The backup fuel for the gas turbine would be light oil. In normal operation, the HRSG uses the waste heat of the exhaust gases from the gas turbine. During gas turbine shutdowns, the HRSG can continue to generate the maximum steam capacity. The heat for district heating would be produce in HRSG by flue gases from the gas turbine and in the heat exchanger by condensed steam from back pressure turbine. The main parameters of the combined power plant, as: overall energy efficiency, natural gas consumption, natural gas saving are analyzed and determined in comparison with separated production of heat (for district heating) and power (for electrical grid). (Author)
Burnable gas concentration control device
International Nuclear Information System (INIS)
Goto, Hiroshi; Sanada, Takahiro; Kuboniwa, Takao.
1980-01-01
Purpose: To provide connecting ports by doubling nitrogen gas injection pipes thereby to secure lengthiness of the device only by providing one nitrogen gas generator. Constitution: Nitrogen gas injection pipes are provided in two lines separately, and attachable and detachable connecting ports for feeding nitrogen gas connectable to a movable type nitrogen gas supply installation for the purpose of backing up the nitrogen gas generator. (Yoshihara, H.)
International Nuclear Information System (INIS)
Groenewegen, G.G.
1992-01-01
On a conference (Gas for Europe in the 1990's) during the Gasexpo '91 the author held a speech of which the Dutch text is presented here. Attention is paid to the current European pricing methods (prices based on the costs of buying, transporting and distributing the natural gas and prices based on the market value, which is deducted from the prices of alternative fuels), and the transparency of the prices (lack of information on the way the prices are determined). Also attention is paid to the market signal transparency and gas-gas competition, which means a more or less free market of gas distribution. The risks of gas-to-gas competition for a long term price stability, investment policies and security of supply are discussed. Opposition against the Third Party Access (TPA), which is the program to implement gas-to-gas competition, is caused by the fear of natural gas companies for lower gas prices and lower profits. Finally attention is paid to government regulation and the activities of the European Commission (EC) in this matter. 1 fig., 6 ills., 1 tab
International Nuclear Information System (INIS)
Encel, Frederic; Boroumand, Raphael H.; Charlez, Philippe; Goutte, Stephane; Lafargue, Francois; Lombardi, Roland; Porcher, Thomas; Rebiere, Noemie; Schalck, Christophe; Sebban, Anne-Sophie; Sylvestre, Stephan
2016-01-01
As natural gas is about to become the first energy source in the world, is abundant and easy to transport, this collective publication addresses issues related to shale gas and to natural gas. The first part addresses shale gas. Four articles propose a global overview, comment the situation in the USA which, in eight years of time, reduced their oil dependency by half and became almost self-sufficient as far as gas is concerned, discuss technical and legal issues related to shale gas exploitation, discuss the perspective of evolution of the world gas markets, and notice that shale gas will not be a game changer in Europe. The second part addresses the natural gas. The articles discuss the possible influence of natural gas exploitation by Israel on the Middle-East geopolitical situation, the influence of the emergence of new producers in Africa (Tanzania and Mozambique), the contribution of gas-fuelled power station to the coverage of market risks, and the issue of European energy safety with a focus on the role of Turkey
Energy Technology Data Exchange (ETDEWEB)
Perez Cordova, Hugo; Elizalde Baltierra, Alberto [Petroleos Mexicanos (PEMEX), (Mexico)
2004-06-15
The possible incorporation of new points of supply of natural gas to the Sistema National de Gasoductos (SNG) through the import of Liquified Natural Gas or (GNL) could cause an important modification in the national balance of supply-demand of the fuel and in its price, if large volumes are received. An analysis is presented of the possible impact that would have in the natural gas national market and in its prices the import of GNL made by the region of Altamira, Tamaulipas. [Spanish] La posible incorporacion de nuevos puntos de oferta de gas natural al Sistema Nacional de Gasoductos (SNG) a traves de la importacion de Gas Natural Licuado (GNL), podria provocar una modificacion importante en el balance oferta-demanda nacional del combustible y en su precio, si se reciben fuertes volumenes. Se presenta un analisis del posible impacto que tendria en el mercado nacional del gas natural y en sus precios la importacion de GNL realizada por la region de Altamira, Tamaulipas.
Gas explosion in domestic buildings. The vented gas explosion[sub][/sub
Directory of Open Access Journals (Sweden)
Tadeusz Chyży
2014-08-01
Full Text Available In this paper, the basic information, related to the so-called vented gas explosion, has been presented. The vented explosion it is an explosion, during which the destruction of the weakest elements of the structure occurs. Through the resulting holes (decompressing surfaces can flow both combustion products and non-burned gas mixture. In consequence, reduction of the maximum explosion pressure[i] P[sub]red [/sub][/i] may be significant. Often, a gas explosion occurs inside residential buildings. In this case, natural vents are window and door openings.[b]Keywords[/b]: gas, explosion, combustion, explosion vents
Walker, Thad Gilbert; Lancor, Brian Robert; Wyllie, Robert
2014-04-15
Precise measurements of a precessional rate of noble gas in a magnetic field is obtained by constraining the time averaged direction of the spins of a stimulating alkali gas to lie in a plane transverse to the magnetic field. In this way, the magnetic field of the alkali gas does not provide a net contribution to the precessional rate of the noble gas.
Normalization of natural gas composition data measured by gas chromatography
International Nuclear Information System (INIS)
Milton, Martin J T; Harris, Peter M; Brown, Andrew S; Cowper, Chris J
2009-01-01
The composition of natural gas determined by gas chromatography is routinely used as the basis for calculating physico-chemical properties of the gas. Since the data measured by gas chromatography have particular statistical properties, the methods used to determine the composition can make use of a priori assumptions about the statistical model for the data. We discuss a generalized approach to determining the composition, and show that there are particular statistical models for the data for which the generalized approach reduces to the widely used method of post-normalization. We also show that the post-normalization approach provides reasonable estimates of the composition for cases where it cannot be shown to arise rigorously from the statistical structure of the data
Energy Technology Data Exchange (ETDEWEB)
Abthoff, J; Schuster, H D; Gabler, R
1976-11-17
A small cracked-gas generator in a vehicle driven, in particular, by an air combustion engine has been proposed for the economic production of the gases necessary for low toxicity combustion from diesel fuel. This proceeds via catalytic crack-gasification and exploitation of residual heat from exhaust gases. This patent application foresees the insertion of one of the catalysts supporting the cracked-gas reaction in a container through which the reacting mixture for cracked-gas production flows in longitudinal direction. Further, air ducts are embedded in the catalyst through which exhaust gases and fresh air flow in counter direction to the cracked gas flow in the catalyst. The air vents are connected through heat conduction to the catalyst. A cracked gas constituting H/sub 2//CO/CO/sub 2//CH/sub 4/ and H/sub 2/O can be produced from the air-fuel mixture using appropriate catalysts. By the addition of 5 to 25% of cracked gas to the volume of air drawn in by the combustion engine, a more favourable combustion can be achieved compared to that obtained under normal combustion conditions.
International Nuclear Information System (INIS)
Kobayashi, Yoshihiro; Seki, Eiji.
1991-01-01
State of electric discharge is detected based on a gas pressure in a sealed container and a discharging current flowing between both of electrodes. When electric arc discharges occur, introduction of gases to be processed is stopped and a voltage applied to both of the electrodes is interrupted. Then, when the gas pressure in the sealed container is lowered to a predetermined value, a power source voltage is applied again to both of the electrodes to recover glow discharges, and the introduction of the gas to be processed is started. With such steps, even if electric arc discharges occur, they are eliminated automatically and, accordingly, normal glow discharges can be recovered, to prevent failures of the device due to electric arc discharges. The glow discharges are recovered automatically without stopping the operation of the gas processing device, and gas injection and solidification processing can be conducted continuously and stably. (T.M.)
The gas is the next prize; El gas es el proximo premio
Energy Technology Data Exchange (ETDEWEB)
Yergin, Daniel [Cambridge Energy Research Associates (CERA)(United States); Stoppard, Michael [CERA' s Global LNG (United States)
2004-01-15
The emerging global natural gas market has the potential to satisfy the global electric energy growing demand. The United States, American gas reserves decrease, but there are in other regions vast of resources that have not been exploited and that are more attainable now that the gas can be liquefied, transported and used with efficiency. The new energy links are going to create new risks, but nothing that cannot be managed by means of an properly diversification. [Spanish] El mercado global emergente del gas natural tiene el potencial para satisfacer la creciente demanda mundial de energia electrica. Las reservas estadounidenses de gas disminuyen, pero en otros lugares hay vastos recursos aun no explotados que son mas accesibles ahora que el gas puede licuarse, transportarse y utilizarse con eficiencia. Los nuevos vinculos energeticos crearan nuevos riesgos, pero ninguno que no pueda manejarse mediante una diversificacion apropiada.
Reichardt, Thomas A [Livermore, CA; Luong, Amy Khai [Dublin, CA; Kulp, Thomas J [Livermore, CA; Devdas, Sanjay [Albany, CA
2008-05-20
A system is described that is suitable for use in determining the location of leaks of gases having a background concentration. The system is a point-wise backscatter absorption gas measurement system that measures absorption and distance to each point of an image. The absorption measurement provides an indication of the total amount of a gas of interest, and the distance provides an estimate of the background concentration of gas. The distance is measured from the time-of-flight of laser pulse that is generated along with the absorption measurement light. The measurements are formated into an image of the presence of gas in excess of the background. Alternatively, an image of the scene is superimosed on the image of the gas to aid in locating leaks. By further modeling excess gas as a plume having a known concentration profile, the present system provides an estimate of the maximum concentration of the gas of interest.
Serbian gas sector in the spotlight of oil and gas agreement with Russia
International Nuclear Information System (INIS)
Brkic, Dejan
2009-01-01
The Russian natural gas industry is the world's largest producer and transporter of natural gas. This paper identifies the benefits for Serbia as transient country to European Union for Russian natural gas through South Stream gas-line in the current political context of implementation of gas agreement. On the other hand, according to the Agreement on Stabilization and Integration to European Union, Serbia is obligatory to implement reforms in energy sector and its energy policy must be in accordance with the European Union policy. Republic of Serbia has produced and consumed natural gas domestically since 1952, but has always been net importer. Strategy of Energy Development in Serbia and especially, National Action Plan for the gasification on the territory of Republic of Serbia dedicated special attention to gas economy development in respect with expected contribution in efficient energy use and environmental policy protection in the country.
The European natural gas market
International Nuclear Information System (INIS)
Hagland, Jan
2001-01-01
An increasing amount of natural gas is flowing into continental Europe, one of the largest gas markets in the world. There are three main sources of gas: Africa, Russia and Norway. Norway is an important supplier of gas, but may be vulnerable to competition. The demand for gas is increasing on a global basis and the largest increase is expected in Asia, followed by America and Europe. It is expected that Norwegian gas deliveries will be a principle source of natural gas for North Europe in the next years and that they will take an increasing part of the British market as the gas deliveries from the British shelf is going down. The European gas market is likely to become liberalized according to the EU's competition- and gas directives. This will not necessarily be a problem, and Norway may be able to increase the export of gas to Great Britain considerably from the year 2010, perhaps up to 40 billion standard m3 per year. Russia is expected to take an increased share of the European gas market, especially in East- and Central Europe, Germany and North Italy. But large investments in existing fields, new developments and new strategic pipelines are necessary
Gas development plan - Estonia
International Nuclear Information System (INIS)
1994-06-01
The total supply of natural gas to Estonia is provided by the Russian company ''Lentransgas'', a 10 year contract is under negotiation. The gas transmission system is physically a part of the transmission network in the Baltic region which previously operated as an integral part of the USSR gas transmission system. The potential market is too small to justify investment in an alternative pipeline from the North Sea. The general reduction in purchasing power in the former COMECON countries has resulted in a decreased industrial production in Estonia and lead to a steep decline in natural gas consumption in all sectors except households. The Danish firm ''Dansk Olie og Naturgas A/S'' has been requested to assist the Estonian company ''AS Eesti Gaas J.S.C.'' in preparing a gas development plan for Estonia. Phase 1 of this plan aims to provide a detailed description of the status of the existing situation under the headings of gas supply and demand, transmission and distribution, economy and organization. The most important problems related to the current transition of the Estonian gas sector towards operation under market conditions are addressed, focussing on gas supply and market conditions, flow control and metering. The general organization of the gas sector in Estonia is described and possible models for future organization are discussed. Some recommendations are given and areas in need of further investigation are identified. (AB)
Centre of the European gas market. The European Autumn Gas Conference
International Nuclear Information System (INIS)
Van Hasselt, F.; Van der Wal, W.; Ruinen, H.
1998-01-01
From the results of the 1997 European Autumn Gas Conference in Barcelona, Spain, it appears that the European gas industry is mainly focused on the liberalization of the European energy market. The main topic of the Conference was 'dealing with surplus'. A brief overview is given of the natural gas trade developments in the European countries. 1 ill., 1 tab. 2 ills
Energy Technology Data Exchange (ETDEWEB)
Bolinger, Mark; Wiser, Ryan; Golove, William
2003-08-13
Against the backdrop of increasingly volatile natural gas prices, renewable energy resources, which by their nature are immune to natural gas fuel price risk, provide a real economic benefit. Unlike many contracts for natural gas-fired generation, renewable generation is typically sold under fixed-price contracts. Assuming that electricity consumers value long-term price stability, a utility or other retail electricity supplier that is looking to expand its resource portfolio (or a policymaker interested in evaluating different resource options) should therefore compare the cost of fixed-price renewable generation to the hedged or guaranteed cost of new natural gas-fired generation, rather than to projected costs based on uncertain gas price forecasts. To do otherwise would be to compare apples to oranges: by their nature, renewable resources carry no natural gas fuel price risk, and if the market values that attribute, then the most appropriate comparison is to the hedged cost of natural gas-fired generation. Nonetheless, utilities and others often compare the costs of renewable to gas-fired generation using as their fuel price input long-term gas price forecasts that are inherently uncertain, rather than long-term natural gas forward prices that can actually be locked in. This practice raises the critical question of how these two price streams compare. If they are similar, then one might conclude that forecast-based modeling and planning exercises are in fact approximating an apples-to-apples comparison, and no further consideration is necessary. If, however, natural gas forward prices systematically differ from price forecasts, then the use of such forecasts in planning and modeling exercises will yield results that are biased in favor of either renewable (if forwards < forecasts) or natural gas-fired generation (if forwards > forecasts). In this report we compare the cost of hedging natural gas price risk through traditional gas-based hedging instruments (e
Deregulation, market structure and gas prices in the Canadian Natural Gas Industry
International Nuclear Information System (INIS)
Uhler, R.S.
1992-01-01
During the course of the development of the natural gas industry in Canada, gas purchase and sales markets have evolved from being relatively free of regulation to being highly regulated and back again. Though pipeline transport charges were regulated, the pipeline companies, or their subsidiaries, owned the gas that they transported and price and other provisions of purchase and sales contracts were freely negotiated with the producers at one end and distributing utilities or industrial users at the other end. The Western Accord of 1985 set the process of deregulation of the Canadian natural gas industry in motion. On November 1, 1986, natural gas prices in interprovincial trade were deregulated in that domestic natural gas prices were to be freely negotiated. Although not stated explicitly, government policy is to permit export prices to be freely negotiated so long as they do not fall below domestic prices. The deregulation process has dramatically changed the relationship between buyers and sellers. Of particular importance is that deregulation has permitted companies to negotiate gas purchase contracts directly with producers with the pipeline company acting solely as a gas transporter. The purpose of this paper is to examine the forces that have led to shorter term contracts and to examine the likely effect of these contract terms on reservoir development investment incentives. 5 refs., 3 figs
The changing roles of natural gas aggregators - a Pan-Alberta Gas perspective
International Nuclear Information System (INIS)
Field, D. L.
1999-01-01
Traditional roles played by the various forms of natural gas marketing entities (margin-marketers, aggregators, brokers) and the factors that influence a producer of natural gas to market its gas through one or more of these entities are the subject of this paper. The author also reviews current developments in the natural gas marketing industry, focusing on changes from the perspective of the gas aggregator.The most significant change has been the trend by aggregators to branch out to provide a broad range of services that meet the needs of individual producers including gas management services for non-pool gas supply, transportation management, fixed and indexed pricing for both pool and non-pool supply, market based pricing, financial services for producers, short-term sales arrangements and streaming specific supply sources to specific markets. As aggregators continue to move away from offering only the traditional aggregator services, the distinction between aggregators and margin-marketers and the services they provide is becoming less distinct. The principal differences that will remain will be the differences in corporate structures and the shareholders who share the costs and receive the benefits generated by business activities of the aggregator. Another difference that will continue to exist is that margin-marketers offer North American-based services whereas aggregators focus on marketing natural gas primarily in Western Canada
Energy Technology Data Exchange (ETDEWEB)
Mandil, C. [Institut Francais du Petrole (IFP), 92 - Rueil-Malmaison (France); Chabrelie, M.F. [Cedigaz, 92 - Rueil Malmaison (France); Streicher, C. [Prosernat, 92 - Paris la Defense (France)] [and others
2003-07-01
New developments in the area of gas treatment will be to a large extent driven by the need to find appropriate solutions to the fundamental need of sustainable development. New gas treatment processes are developed with the aim to minimise contaminant emissions and meet most stringent environmental specifications. A new major challenge for the industry will be to implement new cost effective technologies for reducing CO{sub 2} emissions. Industry has also to minimise its costs, and therefore, in order to ensure at the same time a better protection of the environment and a better safety, it is necessary to innovate. The purpose of this seminar is precisely to identify better the innovations which are required in the area of gas treatment. These proceedings comprise 8 papers and a summary of the contributions to a round-table discussion dealing with the options for CO{sub 2} capture and sequestration. The presentations treat of: the future prospects for the gas industry (M.F. Chabrelie, Cedigaz); the solutions for offshore gas treatment (C. Streicher, Prosernat); gas treatment with membranes (H. Meyer, GTI); the Axens Multibed{sub TM} technology for natural gas treatment (G. Jochem, Axens); the potentials and applications for the Propure co-current contactors (F.P. Nilsen, ProPure); the production of very-sour and super-sour large gas reserves: the new challenges (F. Lallemand, TotalFinaElf); Hybrisol, a new gas treatment process for sour natural gases (F. Lecomte, IFP); and the conception and building of large acid-gas removal units (J. Castel, Technip-Coflexip). (J.S.)
Energy Technology Data Exchange (ETDEWEB)
Kanagawa, A; Fujii, O; Nakamoto, H
1970-03-09
Counter currents in the rotary drum of a centrifugal gas separator are produced by providing, at either end of the drum in the vicinity of the circumferential and central positions, respectively, outflow and inflow holes with a communicating passage external to the drum there between whereby gaseous counter currents are caused to flow within the drum and travel through the passage which is provided with gas flow adjustment means. Furthermore, the space defined by the stationary portion of the passage and the rotor drum is additionally provided with a screw pump or throttling device at either its stationary side or drum side or both in order to produce a radially directed gas flow therewithin. A gas mixture is axially admitted into the drum while centrifugal force and a cooling element provided therebelow cause an increase in gas pressure along and a gaseous flow toward the wall member, whereupon the comparatively high pressured circumferentially distributed gas is extracted from the outlet holes, flows through the external gas passage and back into the lower pressured drum core through the inlet holes, thus producing the desired counter currents. The gases thus separated are withdrawn along axially provided discharge pipes. Accordingly, this invention permits heating elements which were formerly used to produce thermal convection currents to be disposed of and allows the length of the rotor drum to be more efficiently utilized to enhance separation efficiency.
International Nuclear Information System (INIS)
Chabrelie, M.F.
2000-01-01
The WOC 9 workshop of the CMG 2000 world gas congress was devoted to gas projects and economics. One round table chaired by G. Bouchard (Gaz de France) and T.H. Thorn (Enron) was devoted to the commercial and financial challenges the gas industry will have to face in the context of inter-region markets and investments. This article summarizes the discussion that took place during this round table: towards a progressive un-partitioning of regional markets, the strategic changes in the European gas market, the LNG industry: new actors and new markets, the gas producers at the crossroads. (J.S.)
Energy Technology Data Exchange (ETDEWEB)
1987-11-01
The intent and purpose of this manual is to describe the various guideliness and administrative procedures associated with the Alberta Rural Gas Program and to consolidate and expand upon the legislation under which the Program has been developed. It is intended primarily for the use and information of rural gas distributors, their agents, and other private or government parties having an interest in the Rural Gas Program. Information is presented on: rural gas franchises, technical applications, contracts and tenders, determination of system capital costs for grant support, grants, Gas Alberta brokerage arrangements, insurance coverage, utility rights-of-way, and lien notes.
World Gas Conference 1997. Sub-committee G 2. International classification for the gas industry
International Nuclear Information System (INIS)
1997-01-01
This international Gas Union classification is a documentary tool for the transfer of information relative to the gas industry. It is written in English and in French, official languages of the IGU. In a resource centre, the classification can be used to set up a manual index file of documentary references selected for subsequent information retrieval. In the case of computer file, the classification can be used for automatic classification of document references selected by field. The IGU classification is divided into ten chapters: O - Arts, science and technologies. A - Manufacture and treatment of gases. B - Gas supply. C - Gas utilizations. D - By-products of manufactures and natural gas. E - Personnel of the gas industry. F - Hygiene and safety in the gas industry. G - Administration and organization of the gas industry. H - Commercial questions of the gas industry. L - Geographical classification. Each chapter is subdivided into subjects, and each subject is further divided according to a hierarchical set of classification codes which correspond to a more detailed approach to the subject concerned. (EG)
SOHIO (Standard Oil Co. , Ohio) to sell Prudhoe gas to Northern Natural Gas Co
Energy Technology Data Exchange (ETDEWEB)
1979-08-20
Sohio has agreed to sell Vertical Bar3: 2 trillion cu ft of its Prudhoe Bay gas to Northern Natural Gas Co. for delivery at a rate of 170 million cu ft/day when the proposed Alaska Highway gas pipeline is completed. With the exception of approx. 4 trillion cu ft of Sohio's reserves committed to Columbia Gas System Inc., the agreement accounts for the sale of all the 26.5-27 trillion cu ft of Prudhoe Bay reserves. The contract, which is subject to approval of the U.S. Federal Energy Regulatory Commission, allows Alaska to take its one-eighth royalty share of the gas in kind or cash. Columbia Gas is the only firm planning to purchase Prudhoe Bay gas that is not participating as an equity owner in the pipeline project. According to a Columbia spokesman, it is still uncertain whether the proposed gas pipeline will be built; and the fact that Columbia has not yet signed a final agreement with Sohio does not indicate any decreasing interest in Prudhoe Bay gas.
Forecasting world natural gas supply
International Nuclear Information System (INIS)
Al-Fattah, S. M.; Startzman, R. A.
2000-01-01
Using the multi-cyclic Hubert approach, a 53 country-specific gas supply model was developed which enables production forecasts for virtually all of the world's gas. Supply models for some organizations such as OPEC, non-OPEC and OECD were also developed and analyzed. Results of the modeling study indicate that the world's supply of natural gas will peak in 2014, followed by an annual decline at the rate of one per cent per year. North American gas production is reported to be currently at its peak with 29 Tcf/yr; Western Europe will reach its peak supply in 2002 with 12 Tcf. According to this forecast the main sources of natural gas supply in the future will be the countries of the former Soviet Union and the Middle East. Between them, they possess about 62 per cent of the world's ultimate recoverable natural gas (4,880 Tcf). It should be noted that these estimates do not include unconventional gas resulting from tight gas reservoirs, coalbed methane, gas shales and gas hydrates. These unconventional sources will undoubtedly play an important role in the gas supply in countries such as the United States and Canada. 18 refs., 2 tabs., 18 figs
Energy Technology Data Exchange (ETDEWEB)
Demori, Marcio Bastos [PETROBRAS, Rio de Janeiro, RJ (Brazil). Coordenacao de Comercializacao de Gas e GNL; Santos, Edmilson Moutinho dos [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Eletrotecnica e Energia. Programa Interunidades de Pos-Graduacao em Energia (PIPGE)
2004-07-01
The transportation of large quantities of natural gas through long distances has been done more frequently by Liquefied Natural Gas (LNG). The increase of natural gas demand and the distance of major reserves, allied to technological improvements and cost reduction through LNG supply chain, have triggered the expressive increase of LNG world market This paper tries to evaluate the influence that LNG should cause on natural gas world market dynamic, analyzing the tendency of gas to become a world commodity, creating international price references, like oil and its derivates. For this, are shown data as natural gas world reserves, the participation of LNG in natural gas world market and their increase. Furthermore, will be analyzed the interaction between major natural gas reserves and their access to major markets, still considering scheduled LNG projects, the following impacts from their implementation and price arbitrage that should be provoked on natural gas markets. (author)
International Nuclear Information System (INIS)
Walker, Vornel
2000-01-01
The use of computer-aided 3-dimensional design tools to overcome problems associated with extraction of gas from unconventional gas deposits such as shale, sand and coal gas fields in landlocked nations is examined, and the economics of land based gas exploration in the USA, and the transport of the product to market are considered. The use of 3D design tools by the Pearl Development Company for providing engineering solutions for the recovery of natural gas liquids (NGL) for the Thunder Creek Gas Services company servicing the Powder River Basin in Wyoming and utilisation of the CADWorx/PIPE 3D piping design tool are reported. The benefits of the software package which allows easy visualisation of designs and produces 2D drawings from multi-discipline plant models are outlined
Energy Technology Data Exchange (ETDEWEB)
Byfield, M.
2010-07-15
The natural gas purification and pipeline sector is a major economic driver in Canada. Gas processing facilities are growing in number, and several large gas projects are being planned for future construction in the western provinces. This article outlined 5 gas plants in order to illustrate the sector's history and breadth in Canada. The Shell Jumping Pound gas complex was constructed in 1951 after a sulfur-rich gas discovery near Calgary in 1944. The Empress Straddle plant was built in 1971 in southeastern Alberta and is one of the largest single industrial consumers of electrical power in the province. The Fort Nelson gas processing plant is North America's largest sour gas processing facility. The Shell Caroline complex was built 1993. The Sable offshore energy project is located on the coast of Nova Scotia to handle gas produced from the Thebaud wells. A consortium is now considering the development of new gas fields in the Sable area. 5 figs.
Energy Technology Data Exchange (ETDEWEB)
Gubik, A. [RAG-AG Wien (Austria); Baffoe, J.; Schulze-Riegert, R. [SPT Group GmbH, Hamburg (Germany)
2013-08-01
Gas storages define a key contribution for building a reliable gas supply chain from production to consumers. In a competitive gas market with short reaction times to seasonal and other gas injection and extraction requirements, gas storages also receive a strong focus on availability and precise prediction estimates for future operation scenarios. Reservoir management workflows are increasingly built on reservoir simulation support for optimizing production schemes and estimating the impact of subsurface uncertainties on field development scenarios. Simulation models for gas storages are calibrated to geological data and accurate reproduction of historical production data are defined as a prerequisite for reliable production and performance forecasts. The underlying model validation process is called history matching, which potentially generates alternative simulation models due to prevailing geological uncertainties. In the past, a single basecase reference model was used to predict production capacities of a gas storage. The working gas volume was precisely defined over a contracted plateau delivery and the required cushion gas volume maintains the reservoir pressure during the operation. Cushion and working gas Volume are strongly dependent on reservoir parameters. In this work an existing depleted gas reservoir and the operation target as a gas storage is described. Key input data to the reservoir model description and simulation is reviewed including production history and geological uncertainties based on large well spacing, limited core and well data and a limited seismic resolution. Target delivery scenarios of the prospected gas storage are evaluated under uncertainty. As one key objective, optimal working gas and cushion gas volumes are described in a probabilistic context reflecting geological uncertainties. Several work steps are defined and included in an integrated workflow design. Equiprobable geological models are generated and evaluated based on
Technology and products of gas companies; Gas gaisha no Technology and Products
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-06-10
This paper presents the latest technology and products of gas companies. `Newly developed gas table for one-push automatic fish broiling` of Tokyo Gas Co. `Catalytic technology for decomposing dioxin generated by incinerator to make it harmless` of Osaka Gas Co. `Newly developed strong and kindly shower head` of Tokyo Gas Co. By laying fish on a sensor in a grill and appropriately setting upper and lower heating levers, user can skillfully broil fish only by pushing an ignition button. A temperature sensor attached to the center of a grill catches a change in surface temperature of fish, and automatically sets an appropriate broiling time according to the kind and volume of fish. A finish buzzer and automatic extinction mechanism are prepared. The technology decomposes dioxin in exhaust gas of incinerators to make it harmless. The catalyst is prepared by dispersing noble metal or oxide of several angstroms into activated carbon fibers. The shower head can switch hot water power by a control handle
International Nuclear Information System (INIS)
Shiry, J.
1992-01-01
The sale of natural gas to California is one of the most complex and contested trade disputes between the USA and Canada. The background and the issues involved are discussed. An oversupply of Canadian gas, combined with USA subsidies for producing coalbed methane and a general oversupply of gas in the USA, have made spot gas prices decline to unexpectedly low levels. California regulators have responded to this situation by trying to secure the lowest possible prices for consumers, thereby causing them to abandon long-standing trade policies with Canada. The main agent of this change is the California Public Utilities Commission (CPUC), whose actions have reduced the value of Canadian exports and Alberta government revenues by at least $250 million annually. CPUC supported buying from a supply pool (Alberta ampersand Southern Gas) since it provided monopoly purchasing power, and CPUC's policy against pipeline expansion produced the limited access to California that the CPUC now cites as evidence of a producer cartel. CPUC has interfered in contracts with Canadian producers in its pipeline access policies, its capacity brokering decision of 1991, and its reasonableness test for past sales. In its haste to force its own view of market results onto existing contractual relationships, the CPUC is not allowing open negotiations to reshape the relationship, and CPUC actions may be generating countermeasures by Alberta that are inappropriate under deregulation. 3 figs
Regulation of gas infrastructure expansion
International Nuclear Information System (INIS)
De Joode, J.
2012-01-01
The topic of this dissertation is the regulation of gas infrastructure expansion in the European Union (EU). While the gas market has been liberalised, the gas infrastructure has largely remained in the regulated domain. However, not necessarily all gas infrastructure facilities - such as gas storage facilities, LNG import terminals and certain gas transmission pipelines - need to be regulated, as there may be scope for competition. In practice, the choice of regulation of gas infrastructure expansion varies among different types of gas infrastructure facilities and across EU Member States. Based on a review of economic literature and on a series of in-depth case studies, this study explains these differences in choices of regulation from differences in policy objectives, differences in local circumstances and differences in the intrinsic characteristics of the infrastructure projects. An important conclusion is that there is potential for a larger role for competition in gas infrastructure expansion.
International Nuclear Information System (INIS)
Leprince, P.; Valais, M.
1993-01-01
This paper reports that large resources and growing markets are the salient prospects of natural gas for the coming decades. The greater impact of natural gas on the worldwide energy market can become a reality if several scientific disciplines can be mobilized in order to succeed in cutting production costs. Modeling, mechanics of complex fluids, and physical chemistry of interfaces are basic disciplines for understanding and mastering the gas processing technologies
Thermodynamic modelling of acid gas removal from natural gas using the Extended UNIQUAC model
DEFF Research Database (Denmark)
Sadegh, Negar; Stenby, Erling Halfdan; Thomsen, Kaj
2017-01-01
Thermodynamics of natural gas sweetening process needs to be known for proper design of natural gas treating plants. Absorption with aqueous N-Methyldiethanolamine is currently the most commonly used process for removal of acid gas (CO2 and H2S) impurities from natural gas. Model parameters...... for the Extended UNIQUAC model have already been determined by the same authors to calculate single acid gas solubility in aqueous MDEA. In this study, the model is further extended to estimate solubility of CO2 and H2S and their mixture in aqueous MDEA at high pressures with methane as a makeup gas....
Adding gas from biomass to the gas grid
Energy Technology Data Exchange (ETDEWEB)
Hagen, Martin; Polman, Erik [GASTEC NV (Netherlands); Jensen, Jan K.; Myken, Asger [Danish Gas Technology Center A/S, Hoersholm (Denmark); Joensson, Owe; Dahl, Anders [Swedish Gas Center AB, Malmoe (Sweden)
2001-07-01
The aim of this project carried out in the framework of the Altener programme is to provide an overview of technologies for cleaning and upgrading of biogas for remote use. A further aim is to determine to what extent gases produced from biomass (digestion or gasification)can be added to the gas grid and what additional safety regulations are necessary. Finally, existing European standards and national legislation have been studied in order to determine the possibility of conflicting and/or missing regulations with the intended approach.The information collected in this project can be used to select promising technologies and may serve as background information for developing harmonised standards. This report describes the various production and cleaning techniques and the present requirements for the use of biogas. The technology for adding gas from biomass to the gas grid on a larger scale can contribute to a higher share of biomass in the energy supply and will also allow a highly efficient use of the energy contained in the biomass.Moderate tax incentives will make the use of gas from biomass economically attractive for large groups of end-users.
Gas. Innovators talking; Gas. Innovators aan het woord
Energy Technology Data Exchange (ETDEWEB)
NONE
2013-02-15
Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on gas [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar gas.
Gas. Innovators talking; Gas. Innovators aan het woord
Energy Technology Data Exchange (ETDEWEB)
NONE
2013-02-15
Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on gas [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar gas.
Method of storing radioactive rare gas. [gas occupies spaces in the zeolite crystal lattice
Energy Technology Data Exchange (ETDEWEB)
Nagao, H; Miharada, H; Takiguchi, Y; Kanazawa, T; Soya, M
1975-05-15
A method is provided to prevent dispersion of radioactive rare gas atoms by sealing them in a pressurised state within zeolite and thereby confining them in position within the zeolite crystal lattice. Radioactive rare gas is separated from exhaust gas and concentrated by using a low temperature adsorption means or liquefaction distillation means and necessary accessory means, and then it is temporarily stored in a gas holder. When a predetermined quantity of storage is reached, the gas is led to a sealing tank containing zeolite heated to 300 to 400/sup 0/C and held at 3,000 to 4,000 atmospheres, and under this condition radioactive rare gas is brought to occupy the spaces in the zeolite crystal lattice. After equilibrium pressure is reached by the pressure in the tank at that temperature, the gas is cooled in the pressurised state down to room temperature. Subsequently, the rare gas remaining in the tank and duct is recovered by a withdrawal pump into the gas holder. Thereafter, the zeolite with radioactive rare gas sealed in it is taken out from the tank and sealed within a long period storage container, which is then housed in a predetermined place for storage.
International Nuclear Information System (INIS)
Campos Pinzon, Rafael
2000-01-01
The paper explores aspects of gas integration among Colombia, Venezuela, Ecuador and Peru. A comparison of the GDP is made, gas reserves are provided and the existent nets of gas-pipe are included in Colombia and Venezuela
A versatile gas interface for routine radiocarbon analysis with a gas ion source
Energy Technology Data Exchange (ETDEWEB)
Wacker, L., E-mail: wacker@phys.ethz.ch [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Fahrni, S.M. [Department of Chemistry and Biochemistry, University of Bern, 3012 Berne (Switzerland); Oeschger Centre for Climate Change Research, University of Bern, 3012 Berne (Switzerland); Paul Scherrer Institute (PSI), 5232 Villigen (Switzerland); Hajdas, I. [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Molnar, M. [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Institute of Nuclear Research, Hungarian Academy of Sciences, 4026 Debrecen (Hungary); Synal, H.-A. [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Szidat, S. [Department of Chemistry and Biochemistry, University of Bern, 3012 Berne (Switzerland); Oeschger Centre for Climate Change Research, University of Bern, 3012 Berne (Switzerland); Zhang, Y.L. [Department of Chemistry and Biochemistry, University of Bern, 3012 Berne (Switzerland); Oeschger Centre for Climate Change Research, University of Bern, 3012 Berne (Switzerland); Paul Scherrer Institute (PSI), 5232 Villigen (Switzerland)
2013-01-15
In 2010 more than 600 radiocarbon samples were measured with the gas ion source at the MIni CArbon DAting System (MICADAS) at ETH Zurich and the number of measurements is rising quickly. While most samples contain less than 50 {mu}g C at present, the gas ion source is attractive as well for larger samples because the time-consuming graphitization is omitted. Additionally, modern samples are now measured down to 5 per-mill counting statistics in less than 30 min with the recently improved gas ion source. In the versatile gas handling system, a stepping-motor-driven syringe presses a mixture of helium and sample CO{sub 2} into the gas ion source, allowing continuous and stable measurements of different kinds of samples. CO{sub 2} can be provided in four different ways to the versatile gas interface. As a primary method, CO{sub 2} is delivered in glass or quartz ampoules. In this case, the CO{sub 2} is released in an automated ampoule cracker with 8 positions for individual samples. Secondly, OX-1 and blank gas in helium can be provided to the syringe by directly connecting gas bottles to the gas interface at the stage of the cracker. Thirdly, solid samples can be combusted in an elemental analyzer or in a thermo-optical OC/EC aerosol analyzer where the produced CO{sub 2} is transferred to the syringe via a zeolite trap for gas concentration. As a fourth method, CO{sub 2} is released from carbonates with phosphoric acid in septum-sealed vials and loaded onto the same trap used for the elemental analyzer. All four methods allow complete automation of the measurement, even though minor user input is presently still required. Details on the setup, versatility and applications of the gas handling system are given.
Gas marketing strategies for Ontario producers
Energy Technology Data Exchange (ETDEWEB)
Walsh, P.R. [Energy Objective Ltd., London, ON (Canada)
2000-07-01
Activity in natural gas exploration and production in the province of Ontario has recently increased due to higher natural gas prices. This paper discussed the issue of how the gas from the new reserves should be marketed. A review of historical pricing and consumption patterns was also presented to better identify how prices of natural gas are determined in Ontario and to forecast the future demand for natural gas. The first trend of interest is the increased use of natural gas in generating electricity to meet cooling needs in the summer months. The second trend is the increase in gas consumption by the industrial sector resulting from increases in process load. Several marketing options are available to Ontario natural gas producers. They can market their gas to third parties at various trading points in the province or they can market it directly to Union Gas Limited, the local gas utility. This paper briefly described how a gas supply contract works with the union, how gas marketing agreement is conducted with a gas marketer, and how a gas marketing arrangement works with a consultant. Some of the pitfalls of marketing natural gas were also described and some recommended some strategies for selling natural gas in the future were presented. 7 figs.
Gas marketing strategies for Ontario producers
International Nuclear Information System (INIS)
Walsh, P.R.
2000-01-01
Activity in natural gas exploration and production in the province of Ontario has recently increased due to higher natural gas prices. This paper discussed the issue of how the gas from the new reserves should be marketed. A review of historical pricing and consumption patterns was also presented to better identify how prices of natural gas are determined in Ontario and to forecast the future demand for natural gas. The first trend of interest is the increased use of natural gas in generating electricity to meet cooling needs in the summer months. The second trend is the increase in gas consumption by the industrial sector resulting from increases in process load. Several marketing options are available to Ontario natural gas producers. They can market their gas to third parties at various trading points in the province or they can market it directly to Union Gas Limited, the local gas utility. This paper briefly described how a gas supply contract works with the union, how gas marketing agreement is conducted with a gas marketer, and how a gas marketing arrangement works with a consultant. Some of the pitfalls of marketing natural gas were also described and some recommended some strategies for selling natural gas in the future were presented. 7 figs
Gas associated to coal in Colombia. An energetic alternative of non-conventional gas fields
International Nuclear Information System (INIS)
Garcia Gonzalez, Mario
2005-01-01
Colombia possesses the biggest coal reserves of Latin America, in such a way that the potential reserves of Gas Associated to the Coal (GAC) they are of great magnitude; the paper includes topics like the generation of the gas associated to the coal, geologic factors that control the gas occurrence, development of the gas associated to the coal in the world, and potential reserves of gas associated to the coal in Colombia
Strategic implications of gas to liquids technology for the natural gas industry
International Nuclear Information System (INIS)
Russell, B. J.
1998-01-01
A new and economical gas to liquids (GTL) technology is described that promises to substantially increase industry's ability to exploit many trillions of cubic feet of largely unmarketable reserves of natural gas. The technology turns the gas into a form that overcomes prohibitive transportation costs, avoids long-term, high-risk, take-or-pay contracts, and helps satisfy the demand for cleaner liquid products. Widespread application of GTL technology is credited with having the power to ease the burden on every segment of the petroleum industry, from exploration through petrochemicals, and into allied industries such as electric power generation. It is claimed that in situations where GTL is the only economic option, it will create an entirely new set of opportunities. Among these are the monetization of known stranded gas and the early development of remote gas discoveries or of oil discoveries associated with gas. It will cause a re-evaluation of exploration strategies by upgrading gas prospects in remote locations and new investment options to countries with shut-in gas or heavy oil or tar sand reserves. The monetization of associated gas when reinjection is no longer needed or desired could occur. Extensive applications offshore and adjacent to coastal reserves and multiple options for refiners facing heavier, higher-sulfur crude slates are possible. The outlook for Syntroleum's version of the GTL process, and the 'grant-back' provisions of Syntroleum's license agreements with companies such as Texaco, ARCO, Marathon, Criterion Catalyst, Catalytica, and ABB, giving each licensee access to the improvements of the other licencees, and the joint development agreements with these companies, were also discussed. 6 refs
Mackenzie Gas Project : gas resource and supply study
International Nuclear Information System (INIS)
Harris, D.G.; Braaten, K.M.
2004-01-01
A study was conducted to assess the future gas supply for the Mackenzie Gas Project. The economically recoverable gas resources and deliverability in the region were assessed in order to support construction of the Mackenzie Valley pipeline and the associated gathering system. This supply study was based on a 25 year timeframe for resource development. Production forecasts were also prepared for 50 years following the date of the study. Natural gas forecasts for the general area to be served by the proposed pipeline were also presented. This report includes an introduction to the final gas resource and supply study as well as the regional geology relating to discovered and undiscovered resources. The following regions were included in the study area: onshore Mackenzie Delta including the Niglintgak, Parsons Lake and Taglu anchor fields; central Mackenzie Valley region extending from the Mackenzie Delta south to 63 degrees latitude; northern portion of the Yukon Territory; and, portions of the offshore Mackenzie Delta region limited to a water depth of 30 metres. Forecasts and economic analyses were prepared for the following 3 scenarios: contingent onshore resources only; contingent and prospective onshore resources; and, contingent and prospective onshore and offshore resources. Sensitivity forecasts were prepared for a fully expanded pipeline capacity of 1.8 bcf/day with an equal capacity gathering system. In addition, the National Energy Board estimates of resources for the 3 anchor field were used in place of the operator's estimates. A geological review was included for the plays in the study area. 15 refs., 43 tabs., 38 figs
Directory of Open Access Journals (Sweden)
Tomás Correa
2008-12-01
Full Text Available The largest reserves of natural gas worldwide are found in regions far of main cities, being necessary different alternatives to transport the fluid to the consumption cities, such as pipelines, CNG or ships, LNG, depending on distances between producing regions and demanding regions and the producing volumes. Consumption regions have three different markets to naturalgas; residential and commercial, industrial and power generation sector. The residential and commercial is highly seasonal and power generation sector is quite variable depending on increases of temperature during summer time. There are also external issuesthat affect the normal gas flow such as fails on the national system or unexpected interruptions on it, what imply that companies which distribute natural gas should design plans that allow supplying the requirements above mentioned. One plan is using underground natural gas storage with capacities and deliverability rates enough to supply demands. In Colombia there are no laws in this sense but it could be an exploration to discuss different ways to store gas either way as underground natural gas storage or above superficies. Existing basically three different types of underground natural gas storage; depleted reservoirs, salt caverns and aquifers. All ofthem are adequate according to geological characteristics and the needs of the distributors companies of natural gas. This paper is anexploration of technical and economical characteristics of different kind of storages used to store natural gas worldwide.
International Nuclear Information System (INIS)
Anon.
2008-01-01
In 1962, a major natural gas export system from Alberta to San Francisco was brought online. The $300 million, 2,200 km Alberta and Southern system was expected to transport 584 million cubic feet daily in its first year of operation, more than one-third the total volume of gas sold by Canadian producers the previous year. The new gas export market also served to create more gas for the Canadian market because the incentive to serve a large export market also encouraged producers to explore for and develop more gas. The pipeline system started in the foothills belt 200 km northwest of Edmonton, and spanned through Idaho, Washington, Oregon and California. One month before its official opening, a gas line explosion occurred during pressure testing of a lateral line. The Alberta portion of the Alberta and Southern system was also used 2 decades later as a tie-in to the Alaska Highway Gas Pipeline project. Other key events in 1962 included approval of the Great Canadian Oil Sands Limited; the manufacture of the first rock drill bits in western Canada; production of 90 million cubic feet of natural gas from 12 wells in Quebec; and, an increase in oil production from the Soviet Union. 1 tab., 1 fig
The future of UK gas producers
International Nuclear Information System (INIS)
Hallas, P.A.
1991-01-01
Traditionally, an oil company wishing to develop UK gas reserves almost always faced a protracted gas sales negotiation with British Gas. British Gas then had an effective monopoly in the resale of that gas to final consumers. This traditional pattern is now in a process of fundamental change, as a result of recent UK gas market re-regulation and the emergence of a new large scale opportunity to sell gas for power generation. The impact of these changes is still not very well understood outside a relatively small group of gas specialists but is likely to be significant for British Gas, consumers and UK gas producers. This paper outlines the background to the recent changes, the possible future of UK gas marketing and the likely impact on gas producers in the North Sea
International Nuclear Information System (INIS)
Teixeira, G.
2000-05-01
Natural gas in Canada represents 29% of the primary energy and 42% of the energy used in the industrial sector. The biggest users are the manufacturing industries for which the low cost of natural gas and the quality of products resulting from its use represent a serious advantage in a more and more competitive market. This document takes stock of the situation of natural gas and gas-related technologies in Quebec. The first part recalls the historical evolution of the gas distribution network in Quebec and its present day situation. Then, some technical-economical data about the consumption of natural gas in Quebec are presented according to the sectors of use. The third part treats of the R and D activities linked with the gas sector, in particular the activities of the two main research organizations: the technical centre of natural gas and the research group in gas technologies of the Polytechnique school of Montreal. (J.S.)
International Nuclear Information System (INIS)
Mary, Olivier
2013-01-01
This article describes the worrying situation of gas industry: thermal plants are being closed one after the other because of the concurrence of renewable energies and of consumption decrease. European gas industries outline that gas plants could be used for back-up production in case of consumption peaks, and criticize subsidies awarded to renewable energies. Several factors impact this situation: decrease of gross prices, decrease of energy consumption due to a better energy efficiency, development of shale gas production in the USA and in Canada, revival of coal plants (coal is now competitive with respect to gas, and CO 2 is very cheap on the ETS)
Natural gas potential in Canada
International Nuclear Information System (INIS)
1997-01-01
An independent assessment of the undiscovered gas potential in Canada was conducted by a group of volunteer geoscientists. This report is the first of a series of assessments that are planned to be issued every three to four years. Separate assessments were made of conventional gas resources, unconventional gas resources and frontier gas resources. The assessment for conventional gas resources was organized into three categories: (1) gas producing areas where new discoveries can be integrated into existing producing and transportation infrastructure, (2) frontier basins where gas discoveries have been made, but no production is currently underway, and (3) frontier areas where gas-containing sedimentary rocks are known to exist, but where no gas discoveries have been made to date. The committee used year-end 1993 reserves data from discovered pools in each exploration play to predict the undiscovered potential. Information about discovered pools, geological setting, geographic limits and pool sizes of undiscovered pools in each exploration play was provided. Results of the investigation led to the conclusion that the natural gas potential in Canada is in fact larger than hitherto expected. It was estimated that in the Western Canada Sedimentary Basin 47 per cent of the total volume of conventional gas is yet to be discovered. 152 figs
Increased use of gas in the country: Norway as a part of an European gas market
International Nuclear Information System (INIS)
Bjoerndalen, Joergen; Nese, Gjermund
2005-06-01
Norwegian authorities want natural gas to be increasingly used in Norway. The development and establishment of a Norwegian market for gas demands large investments in infrastructure. These investments would have to be done with a large uncertainty attached to future gas prices and - volumes in such a market. As a consequence of Norwegian gas participating in an international market many of the frame conditions for the extension of a future internal market for gas would be set by the international development. In this article several factors connected to the market structure and pricing principles in the European gas market are pointed out. The focus is on the historical development and on what is viewed as essential facts in the development of a future European gas market. The development seems firstly to influence the development in the EU work for an internal market for gas through a gradual liberalisation of the national markets. This work has apparently had a reducing effect on the gas prices to the customers in the liberalised parts of the markets. It is however, stressed that the approach of gradual liberalisation may prove to have some negative consequences for the development of efficient competition in the gas markets. Another aspect mentioned is the development towards spot markets for gas the so-called ''gas hubs'' and more short-term competition types. This type of gas trade is expected to more and more replace the traditional long-term take-on-pay-contracts. In reality it would be the prices noted in the ''gas hubs'' that represent the alternative profits for the Norwegian gas producers and therefore mainly would determine the prices on the future internal gas market. Consequently the Norwegian authorities may play a main role in determining the conditions for an increased use of gas in Norway but the price of gas and consequently the extent of such an internal market as to sold gas volume would mainly be determined by the development in the European
International Nuclear Information System (INIS)
Yan, Ke-Le; Liu, Huang; Sun, Chang-Yu; Ma, Qing-Lan; Chen, Guang-Jin; Shen, De-Ji; Xiao, Xiang-Jiao; Wang, Hai-Ying
2013-01-01
Highlights: • Volumetric properties of two reservoir fluid samples were measured with pressure up to 116 MPa. • Dew point pressures at four temperatures for condensate gas sample are obtained. • Correlations and thermodynamic model for describing gas compressibility factor under high pressure were compared. • The thermodynamic model recommended is most suitable for fluids produced from reservoirs with a wide pressure range. -- Abstract: The volumetric properties of two reservoir fluid samples collected from one condensate gas well and one natural gas well were measured under four groups of temperatures, respectively, with pressure up to 116 MPa. For the two samples examined, the experimental results show that the gas compressibility factor increases with the increase of pressure. But the influence of the temperature is related to the range of the experimental pressure. It approximately decreases with the increase of temperature when the pressure is larger than (45 to 50) MPa, while there is the opposite trend when the pressure is lower than (45 to 50) MPa. The dew point pressure was also determined for the condensate gas sample, which decreases with the increase of temperature. The capabilities of four empirical correlations and a thermodynamic model based on equation of state for describing gas compressibility factor of reservoir fluids under high pressure were investigated. The comparison results show that the thermodynamic model recommended is the most suitable for fluids whatever produced from high-pressure reservoirs or conventional mild-pressure reservoirs
[Poisoning by exhaust gas of the imperfect combustion of natural gas: 22 cases study].
Dong, Li-Min; Zhao, Hai; Zhang, Ming-Chang; He, Meng
2014-10-01
To analyze the case characteristics of poisoning by exhaust gas of the imperfect combustion of natural gas and provide references for forensic identification and prevention of such accidents. Twenty-two cases of poisoning by exhaust gas of the imperfect combustion of natural gas in Minhang District during 2004 to 2013 were collected. Some aspects such as general conditions of deaths, incidence time, weather, field investigation, and autopsy were retrospectively analyzed. In the 22 cases, there were 15 males and 16 females. The age range was between 2 and 82 years old. The major occurring time was in January or February (8 cases in each) and the cases almost occurred in small area room (21 cases). There was wide crack next to the exhaust port when the gas water heater was been used in all cases. There are more prone to occurrence of exhaust gas poisoning of imperfect combustion of natural gas in small area room with a ventilation window near the exhaust port of gas water heated. It shows that the scene of combustion exhaust gas poisoning should be more concerned in the cold season.
Schmid, Andreas K.; Mascaraque, Arantzazu; Santos, Benito; de la Figuera, Juan
2014-09-09
A gas sensor is described which incorporates a sensor stack comprising a first film layer of a ferromagnetic material, a spacer layer, and a second film layer of the ferromagnetic material. The first film layer is fabricated so that it exhibits a dependence of its magnetic anisotropy direction on the presence of a gas, That is, the orientation of the easy axis of magnetization will flip from out-of-plane to in-plane when the gas to be detected is present in sufficient concentration. By monitoring the change in resistance of the sensor stack when the orientation of the first layer's magnetization changes, and correlating that change with temperature one can determine both the identity and relative concentration of the detected gas. In one embodiment the stack sensor comprises a top ferromagnetic layer two mono layers thick of cobalt deposited upon a spacer layer of ruthenium, which in turn has a second layer of cobalt disposed on its other side, this second cobalt layer in contact with a programmable heater chip.
Energy Technology Data Exchange (ETDEWEB)
Van Velzen, T.
2011-09-02
Energy companies such as Shell in the United States win on a large scale shale gas . The industry has developed so rapidly that the gas price has fallen sharply. Lower production costs could take care of the price decrease, but then the extraction technology must be improved. By means of simulations the energy companies are searching for new methods. [Dutch] Energiebedrijven als Shell winnen in de Verenigde Staten op grote schaal gas uit schalie. De sector heeft zich zo snel ontwikkeld dat de gasprijs sterk is gedaald. Lagere productiekosten kunnen de prijsdaling opvangen, maar dan moet de winningstechnologie worden verbeterd. Via simulaties zoeken de energiebedrijven naar nieuwe methoden.
World Gas Conference 1997. Working committee J. World gas prospects, strategies and economics
International Nuclear Information System (INIS)
1997-01-01
This volume of the proceedings contains the report of the International Gas Union's Working Committee J - World gas prospects, strategies and economics - and 7 oral papers dealing with natural gas supply and demand and transmission. (LN)
Energy Technology Data Exchange (ETDEWEB)
Wethington, Jr, John A [Lawrence Radiation Laboratory, University of California, Livermore, CA (United States)
1970-05-15
Decontamination of the products from gas wells stimulated by nuclear explosions requires the removal of T, present as HT, CH{sub 3}T, C{sub 2}H{sub 5}T, etc., and {sup 85}Kr from the production stream. Flaring of large volumes of gas from the Gasbuggy well led to the replacement of radioactive cavity gas with inactive formation gas, but this would not be a satisfactory production procedure because it releases T and {sup 85}Kr into the atmosphere and wastes large amounts of product gas. Exchange reactions appear to offer promise for removing the tritium. For example, water or steam flowing countercurrent to tritiated gas in the presence of a suitable catalyst can participate in the exchange reactions CH{sub 3}T + H{sub 2}O {r_reversible} CH{sub 4} + HTO, HT + H{sub 2}O {r_reversible} H{sub 2} + HTO, resulting in the transfer of T from gas into water. Other possibilities for utilizing exchange reactions include exchange of the gas with ethylene glycol used in the gas dryer, with silicate rocks introduced into the gas stream, or with a countercurrent stream of NH{sub 3} or H{sub 2}S. As another approach, use of the contaminated gas for the manufacture of ammonia synthesis gas has potential for removal of both T and {sup 85}Kr. (author)
Privat, Romain; Jaubert, Jean-Noël; Moine, Edouard
2016-01-01
In many textbooks of chemical-engineering thermodynamics, a gas mixture obeying the fundamental law pV[subscript m] = RT is most often called ideal-gas mixture (in some rare cases, the term perfect-gas mixture can be found). These textbooks also define the fundamental concept of ideal solution which in theory, can be applied indifferently to…
Energy Technology Data Exchange (ETDEWEB)
Cho, Yong Sung [Korea Energy Economics Institute, Euiwang (Korea)
1999-04-01
With the increase of convenient and clean gas fuel consumption, the danger of gas safety accident is also increasing. Therefore, now is the time for requiring many thoughtful concerns and cares for the prevention of gas accident. In this study, the perception of city gas end users on use of city gas was studied and the economic value of improving gas safety was estimated by examining the intended amount paid for improving safety of city gas use. Although most of city gas end-users perceive that gas use is generally safe, they are concerned about a possibility of dander of accidents happened without any notice. On the other hand, about 97% of households using city gas know checking gas safety at a minimum, but only 60% among them are implementing self-checkup. The economic benefit of improving gas safety of city gas end-users in Korea is estimated from the lowest of 121.47 billion to the highest of 317.97 billion annually. (author). 38 refs., 5 figs., 45 tabs.
How would the gas exporting countries forum influence gas trade?
International Nuclear Information System (INIS)
Wagbara, O.N.
2007-01-01
The cleanest burning fossil fuel, today, is natural gas. While many businesses have gone global, it has remained an exception. An impending challenge facing the industry, however, is the evolution of a cartel from the 5-year-old Gas Exporting Countries Forum. How would this new organization influence the trade of gas globally? Does its existence imply a threat to the development of gas trade? The paper reviews this fairly new organization within the context of the above questions. It is mainly a comparative study of the body in relation to OPEC's historical, political and economic development. Subsequently, the author proposes probable influence options available to the Forum and the impending consequence of such actions on the market. The outcome of this study calls for further analysis and research on new issues and questions of interest. (author)
How would the gas exporting countries forum influence gas trade?
International Nuclear Information System (INIS)
Wagbara, Obindah N.
2007-01-01
The cleanest burning fossil fuel, today, is natural gas. While many businesses have gone global, it has remained an exception. An impending challenge facing the industry, however, is the evolution of a cartel from the 5-year-old Gas Exporting Countries Forum. How would this new organization influence the trade of gas globally? Does its existence imply a threat to the development of gas trade? The paper reviews this fairly new organization within the context of the above questions. It is mainly a comparative study of the body in relation to OPEC's historical, political and economic development. Subsequently, the author proposes probable influence options available to the Forum and the impending consequence of such actions on the market. The outcome of this study calls for further analysis and research on new issues and questions of interest
Water-saving liquid-gas conditioning system
Martin, Christopher; Zhuang, Ye
2014-01-14
A method for treating a process gas with a liquid comprises contacting a process gas with a hygroscopic working fluid in order to remove a constituent from the process gas. A system for treating a process gas with a liquid comprises a hygroscopic working fluid comprising a component adapted to absorb or react with a constituent of a process gas, and a liquid-gas contactor for contacting the working fluid and the process gas, wherein the constituent is removed from the process gas within the liquid-gas contactor.
A coupling model for gas diffusion and seepage in SRV section of shale gas reservoirs
Directory of Open Access Journals (Sweden)
Shusheng Gao
2017-03-01
Full Text Available A prerequisite to effective shale gas development is a complicated fracture network generated by extensive and massive fracturing, which is called SRV (stimulated reservoir volume section. Accurate description of gas flow behaviors in such section is fundamental for productivity evaluation and production performance prediction of shale gas wells. The SRV section is composed of bedrocks with varying sizes and fracture networks, which exhibit different flow behaviors – gas diffusion in bedrocks and gas seepage in fractures. According to the porosity and permeability and the adsorption, diffusion and seepage features of bedrocks and fractures in a shale gas reservoir, the material balance equations were built for bedrocks and fractures respectively and the continuity equations of gas diffusion and seepage in the SRV section were derived. For easy calculation, the post-frac bedrock cube was simplified to be a sphere in line with the principle of volume consistency. Under the assumption of quasi-steady flow behavior at the cross section of the sphere, the gas channeling equation was derived based on the Fick's laws of diffusion and the density function of gas in bedrocks and fractures. The continuity equation was coupled with the channeling equation to effectively characterize the complicated gas flow behavior in the SRV section. The study results show that the gas diffusivity in bedrocks and the volume of bedrocks formed by volume fracturing (or the scale of fracturing jointly determines the productivity and stable production period of a shale gas well. As per the actual calculation for the well field A in the Changning–Weiyuan Block in the Sichuan Basin, the matrix has low gas diffusivity – about 10−5 cm2/s and a large volume with an equivalent sphere radius of 6.2 m, hindering the gas channeling from bedrocks to fractures and thereby reducing the productivity of the shale gas well. It is concluded that larger scale of volume fracturing
Natural gas industry in Bulgaria
International Nuclear Information System (INIS)
Mashkin, L.
1994-01-01
An overview of the Bulgarian natural gas industry is presented. The starting point was the discovery of the indigenous Chiren gas-field in 1967. The first agreement with the ex-USSR for supply of natural gas and construction of main pipelines was signed in 1968. The state gas company BULGARGAZ is responsible for transportation, storage, distribution, processing and marketing of the gas to over 150 industrial companies in the country, as well as for the transportation services to gas importers in neighboring Turkey. The GAZSTROJMONTAZH company accomplish the construction of the local and transit pipelines to Turkey and Greece, as well as of some objects in Iran, Syria, Ukraine and Germany. In the past 20 years, 87890 million m 3 natural gas from Russia are supplied and 846 million m 3 - from domestic sources. The share of natural gas in the overall energy balance is 13.6% for 1992. The restructuring and further development of gas industry require to take into account some factors as: security in supply; investments for technical assurance; pricing policy for natural gas; development of private business. Some administrative problems are also mentioned. 2 tabs., 1 fig
Finland's leading natural gas company
International Nuclear Information System (INIS)
Anon.
2000-01-01
The ownership structure of Finland's leading natural gas company, Gasum, changed fundamentally in 1999, and the company is now no longer a subsidiary of Fortum Corporation. 'Our new strong and broad ownership base will enable us to develop the natural gas business and pipeline network in Finland in response to the requirements of our Finnish customers', says Antero Jaennes, Gasum's Chairman and CEO, who stresses that Gasum is committed to remaining the leading developer of the Finnish natural gas market and the number-one gas supplier. Natural gas usage in Finland in 1999 totalled 3.9 billion m 3 (38.7 TWh), unchanged from 1998. Natural gas accounted for 11% of Finland's total primary energy need, as it did in 1998. The proportion of natural gas used in district heating rose by 2% to 36%, and moved down 2% in power generation to 10%. Industry's use of natural gas fell 1% to 17%. 75% of natural gas was used in combined heat and power (CHP) generation in industry and district heating. In 2000, Gasum expects to sell 4 billion m 3 of natural gas (40 TWh)
International Nuclear Information System (INIS)
Hoelen, Q.E.J.J.M.; Bartholomeus, P.H.J.; Mallon, W.Ch.
1998-01-01
In 1992, Gasunie (Dutch natural gas trading company) started its marketing plan for the public natural gas supply (MOG, abbreviated in Dutch). The aim is to promote the use of natural gas in cooperation with gas utilities. For the commercial sector many different gas appliances are available: high-efficiency deep-frying pans for the catering sector, gas-fired air humidifiers for office and public buildings, gas-fired tumble dryers for small and medium-sized businesses, etc
Energy Technology Data Exchange (ETDEWEB)
Carre, I
1947-05-01
A short description of the process is given, with gas yields from various feedstocks, and the composition of the gas. Short descriptions of several batch digester designs are given: Algerian, Salubra, Betur, Baudot-Hardoll and Ofta, and Somagaz. The utilization and the economics of the process are discussed. Two diagrams of Ducellier and Isman designs are included.
International Nuclear Information System (INIS)
MacQuillin, I.
1998-01-01
A recent Landfill Directive, which aims to reduce the amount of biodegradable materials being disposed of in landfill sites, must necessarily, it is argued, cause gas supply problems for the fledgling landfill gas industry in the United Kingdom. Prospects for the new industry over the next twenty years are explored in the light of this setback. (UK)
Gas manufacture, processes for: condensers
Energy Technology Data Exchange (ETDEWEB)
Young, W
1876-11-29
In the production of illuminating gas from coal, shale, hydrocarbon oil, or other substance used in the production of gas, the volatile products inside the retort are agitated by means of moving pistons or jets of compressed gas, steam, or vapor in order to decompose them into permanent gases, and in some cases to increase the volume of gas by the decomposition of the injected gas, etc. or by blending or carburetting this gas with the decomposition products of the volatile matters. To separate the condensible hydrocarbons from the crude gas it is passed through heated narrow tortuous passages or is caused to impinge on surfaces. If the crude gases are cold these surfaces are heated and vice versa.
Energy Technology Data Exchange (ETDEWEB)
Harkness, R B; Evans, C S
1938-12-31
Part V of this annual report consists of four separate reports: Natural gas, petroleum, gas and oil fields in the Guelph and Medina (Grimsby) formations, and gas and oil in eastern Ontario. The natural gas report discusses production and distribution; changes and improvements; consumption and rates; gas wells and their production; and licenses issued. The logs of wells are also included, being presented alphabetically by counties, townships, and owners, respectively. The petroleum report presents information on production and drilling by township; expansion; and petroleum importation and refining operations.
International Nuclear Information System (INIS)
1992-01-01
The Natural Gas Annual provides information on the supply and disposition of natural gas to a wide audience including industry, consumers, Federal and State agencies, and educational institutions. The 1991 data are presented in a sequence that follows natural gas (including supplemental supplies) from its production to its end use. Tables summarizing natural gas supply and disposition form 1987 to 1991 are given for each Census Division and each State. Annual historical data are shown at the national level
International Nuclear Information System (INIS)
1994-01-01
The Natural Gas Annual provides information on the supply and disposition of natural gas to a wide audience including industry, consumers, Federal and State agencies, and educational institutions. The 1993 data are presented in a sequence that follows natural gas (including supplemental supplies) from its production to its end use. Tables summarizing natural gas supply and disposition from 1989 to 1993 are given for each Census Division and each State. Annual historical data are shown at the national level
A review of helium gas turbine technology for high-temperature gas-cooled reactors
International Nuclear Information System (INIS)
No, Hee Cheon; Kim, Ji Hwan; Kim, Hyeun Min
2007-01-01
Current High-Temperature Gas-cooled Reactors (HTGRs) are based on a closed brayton cycle with helium gas as the working fluid. Thermodynamic performance of the axial-flow helium gas turbines is of critical concern as it considerably affects the overall cycle efficiency. Helium gas turbines pose some design challenges compared to steam or air turbomachinery because of the physical properties of helium and the uniqueness of the operating conditions at high pressure with low pressure ratio. This report present a review of the helium Brayton cycle experiences in Germany and in Japan. The design and availability of helium gas turbines for HTGR are also presented in this study. We have developed a new throughflow calculation code to calculate the design-point performance of helium gas turbines. Use of the method has been illustrated by applying it to the GTHTR300 reference
Investigation of a combined gas-steam system with flue gas recirculation
Directory of Open Access Journals (Sweden)
Chmielniak Tadeusz
2016-06-01
Full Text Available This article presents changes in the operating parameters of a combined gas-steam cycle with a CO2 capture installation and flue gas recirculation. Parametric equations are solved in a purpose-built mathematical model of the system using the Ebsilon Professional code. Recirculated flue gases from the heat recovery boiler outlet, after being cooled and dried, are fed together with primary air into the mixer and then into the gas turbine compressor. This leads to an increase in carbon dioxide concentration in the flue gases fed into the CO2 capture installation from 7.12 to 15.7%. As a consequence, there is a reduction in the demand for heat in the form of steam extracted from the turbine for the amine solution regeneration in the CO2 capture reactor. In addition, the flue gas recirculation involves a rise in the flue gas temperature (by 18 K at the heat recovery boiler inlet and makes it possible to produce more steam. These changes contribute to an increase in net electricity generation efficiency by 1%. The proposed model and the obtained results of numerical simulations are useful in the analysis of combined gas-steam cycles integrated with carbon dioxide separation from flue gases.
Gas separation membrane module assembly
Wynn, Nicholas P [Palo Alto, CA; Fulton, Donald A [Fairfield, CA
2009-03-31
A gas-separation membrane module assembly and a gas-separation process using the assembly. The assembly includes a set of tubes, each containing gas-separation membranes, arranged within a housing. The housing contains a tube sheet that divides the space within the housing into two gas-tight spaces. A permeate collection system within the housing gathers permeate gas from the tubes for discharge from the housing.
International Nuclear Information System (INIS)
Samsam Bakhtiari, A.M.; Shahbudaghlou, F.
1998-01-01
This paper reviews the involvement of OPEC Member Countries in the natural gas industry in the past, present and future. It notes a tenfold increase in marketed production and a fourfold rise in re-injection since 1970. Collectively, Members now hold 41 per cent of the world's proven gas reserves and account for 20 per cent of exports. Individually, four of these countries hold position 2-5 in the world gas reserve rankings. Within OPEC, however, there remains an emphasis of oil over gas, not least because of oil's favourable position with regard to revenue-generation and profitability. As global demand continues on its upward growth curve in a more environmentally aware world, OPEC's gas horizons will widen. OPEC's strong reserve base will give its Members an undeniable role to play on the future global gas stage. However, these countries will give priority to domestic usage, particularly re-injection schemes
Gas turbines and operation of gas turbines 2011; Gasturbinen und Gasturbinenbetrieb 2011
Energy Technology Data Exchange (ETDEWEB)
NONE
2011-07-01
Within the VGB Conference at 11th and 12th May, 2011 in Offenbach/Main (Federal Republic of Germany), the following lectures were held: (1) The future of high temperature gas turbines in power plants (Konrad Vogeler); (2) Development of reliable thermal barrier coatings for high-loaded turbine and combustor parts (Hans-Peter Bossmann); (3) CCPP Irsching 4 with gas turbine SGT5-8000H, on the way to 60 % CC efficiency (Willibald Fischer); (4) First test results of MAN's new 6 MW gas turbine (Markus Beukenberg); (5) Design characteristics and key thermodynamic parameters of the recuperated 4 MW solar turbines Mercury 50 gas turbines: - Economics and environmental feasibility, - operating experience in combined cycle applications with recuperation (Ulrich Stang); (6) Medium size gas turbines - OEM concept for continued reduction of life cycle costs (Vladimir Navrotsky); (7) Fracture mechanical analysis on fatigue failures of gas turbine components: - Root cause analysis - fracture mechanics - stress corrosion cracking - examples of failure analysis (Peter Verstraete); (8) The effectiveness of blade superalloy reheat treatment (Michael Wood); (9) An innovative combustion technology for high efficient gas turbines (Christian Oliver Paschereit); (10) Damping of thermo-acoustic vibrations in gas turbine combustion chambers (Sermed Sadig); (11) Alstom GT13E2 combustor upgrade for Vattenfalls Berlin Mitte combined heat and power plant (Klaus Doebbeling); (12) Optimisation of air inlet filtration for dust, rain and humidity (Heiko Manstein); (13) Life cycle cost reduction through high efficiency membrane based air intake filters (Helmut Krah); (14) Status and impact of national, European and international standardization on GT plants; GT standardizing status quo? (Gerd Weber); (15) Technical and thermodynamic aspects of compresssed air energy storage (Peter Radgen); (16) Requirements on the gas turbine in the course of time - intelligent OEM-concepts to ensure reliable
Flue gas injection into gas hydrate reservoirs for methane recovery and carbon dioxide sequestration
International Nuclear Information System (INIS)
Yang, Jinhai; Okwananke, Anthony; Tohidi, Bahman; Chuvilin, Evgeny; Maerle, Kirill; Istomin, Vladimir; Bukhanov, Boris; Cheremisin, Alexey
2017-01-01
Highlights: • Flue gas was injected for both methane recovery and carbon dioxide sequestration. • Kinetics of methane recovery and carbon dioxide sequestration was investigated. • Methane-rich gas mixtures can be produced inside methane hydrate stability zones. • Up to 70 mol% of carbon dioxide in the flue gas was sequestered as hydrates. - Abstract: Flue gas injection into methane hydrate-bearing sediments was experimentally investigated to explore the potential both for methane recovery from gas hydrate reservoirs and for direct capture and sequestration of carbon dioxide from flue gas as carbon dioxide hydrate. A simulated flue gas from coal-fired power plants composed of 14.6 mol% carbon dioxide and 85.4 mol% nitrogen was injected into a silica sand pack containing different saturations of methane hydrate. The experiments were conducted at typical gas hydrate reservoir conditions from 273.3 to 284.2 K and from 4.2 to 13.8 MPa. Results of the experiments show that injection of the flue gas leads to significant dissociation of the methane hydrate by shifting the methane hydrate stability zone, resulting in around 50 mol% methane in the vapour phase at the experimental conditions. Further depressurisation of the system to pressures well above the methane hydrate dissociation pressure generated methane-rich gas mixtures with up to 80 mol% methane. Meanwhile, carbon dioxide hydrate and carbon dioxide-mixed hydrates were formed while the methane hydrate was dissociating. Up to 70% of the carbon dioxide in the flue gas was converted into hydrates and retained in the silica sand pack.
Primer on gas integrated resource planning
Energy Technology Data Exchange (ETDEWEB)
Goldman, C.; Comnes, G.A.; Busch, J.; Wiel, S. [Lawrence Berkeley Lab., CA (United States)
1993-12-01
This report discusses the following topics: gas resource planning: need for IRP; gas integrated resource planning: methods and models; supply and capacity planning for gas utilities; methods for estimating gas avoided costs; economic analysis of gas utility DSM programs: benefit-cost tests; gas DSM technologies and programs; end-use fuel substitution; and financial aspects of gas demand-side management programs.
Landfill gas: development guidelines
International Nuclear Information System (INIS)
1996-11-01
A Guide produced as part of the UK DTI's New and Renewable Energy Programme provides information which forms a framework enabling landfill gas to be exploited fully as a renewable energy resource. The eight chapters cover the resource base of landfill gas in the UK in the wider context, the technology for energy recovery from landfill gas, the utilisation options for landfill gas, the various project development arrangements and their implementation, the assessment of a site's landfill gas resource, the factors which influence the project economies, financing aspects and the management of project liabilities and finally the national waste disposal policy and required consents followed by the overall process for project mobilisation. (UK)
Will implementation of green gas into the gas supply be feasible in the future?
International Nuclear Information System (INIS)
Bekkering, J.; Hengeveld, E.J.; Gemert, W.J.T. van; Broekhuis, A.A.
2015-01-01
Highlights: • The relation between energy efficiency, greenhouse gas reduction and cost price of a green gas supply chain was analyzed. • Opportunities for improving a green gas supply chain were evaluated. • Fossil and renewable energy resources are made explicit in energy efficiency definition. • Switching to green electricity is the major contributor to improving the energy efficiency and greenhouse gas reduction. - Abstract: The energy efficiency, greenhouse gas reduction and cost price of a green gas supply chain were evaluated. The considered supply chain is based on co-digestion of dairy cattle manure and maize, biogas upgrading and injection into a distribution gas grid. A reference scenario was defined which reflects the current state of practice, assuming that input energy is from fossil origin. Possible improvements of this reference scenario were investigated. For this analysis two new definitions for energy input–output ratio were introduced; one based on input of primary energy from all origin, and one related to energy from fossil origin only. The influence of the improvements on greenhouse gas reduction and cost price was assessed too. Results show that electricity (from fossil origin) is the major contributor to energy input in the reference scenario. Switching to green electricity significantly improves the energy efficiency (both definitions) and greenhouse gas reduction. Preventing methane leakage during digestion and upgrading, and re-using heat within the supply chain also show improvements on these parameters as well as on cost price, although their influence is smaller. Decreasing the share of energy crops in the substrate mix shows a negative effect. It is shown that greenhouse gas reduction of more than 80% is possible with current technology. To meet this high sustainability level, multiple improvement options will have to be implemented in the green gas supply chain. Doing so will result in a modest decrease of the green gas
Natural gas - an alternative. Swedish electric power from Norwegian natural gas
International Nuclear Information System (INIS)
1986-10-01
The report describes the possible substitution of electric power by natural gas on the heat source market and how gas can be used for power production. The cost of distribution and means of supply are presented. 1/3 of the electric power produced by nuclear power plants can be replaced by the middle of the nineties. Transport techniques for gas and its total volume as well as transport cost from Norwegian North Sea are discussed
Short-term outlook for natural gas and natural gas liquids to 2006 : an energy market assessment
International Nuclear Information System (INIS)
2005-10-01
In recent years, natural gas markets in North America have seen a close balance between supply and demand, resulting in high and volatile natural gas prices. The National Energy Board monitors the supply of all energy commodities in Canada along with the demand for Canadian energy commodities in domestic and export markets. This is the NEB's first energy market assessment report that presents a combined short-term analysis and outlook of natural gas and natural gas liquids (NGLs), such as ethane, propane and butane. It provides comprehensive information on the complexity of natural gas and NGL industries and highlights recent developments and topical issues. As a major producer of natural gas, western Canada has a correspondingly large natural gas processing capability that was developed specifically to extract NGLs. A world-scale petrochemical industry was developed in Alberta to convert NGLs into even higher valued products such as ethylene. Since NGLs in Canada are sourced mostly from natural gas, changes to the supply and demand for natural gas would impact NGL supply. This report addressed the issue of commodity prices with reference to crude oil, natural gas and NGL prices. Natural gas supply in terms of North American production and natural gas from coal (NGC) was also reviewed along with natural gas demand for residential and commercial heating, industrial use, power generation, and enhanced recovery for oil sand operations. There are about 692 gas plants in Canada that process raw natural gas into marketable gas and NGLs. Most are small field plants that process raw natural gas production to remove impurities such as sulphur, water and other contaminants. This report also discussed this infrastructure, with reference to field plants, straddle plants, pipelines, distribution and storage, including underground NGL storage. 3 tabs., 27 figs., 5 appendices
International Nuclear Information System (INIS)
Hilt, R.H.
1990-01-01
The deliverability issue currently being discussed within the natural gas industry involves both near-term and long-term questions. In the near-term, over the next two or three years, it is probable that the natural gas industry will need to mobilize for much greater levels of investment than have been the experience over the past few years. In the longer-term, it is expected that new opportunities for gas will arise as the nation seeks to meet increasing energy requirements within new environmental constraints. Methane for emissions control, CNG vehicles, expanded gas-fired electricity generation, and increased efficiency of traditional energy services are just a few examples. The issues in the longer-term center on the ability of the gas industry to meet increasing supply requirements reliably and at cost-competitive prices for these markets. This paper begins by reviewing the historical situation of gas deliverability that is the capability of the gas producing and transportation portions of the industry. The delivery system's ability to handle shifts in the centers of consumption and production is discussed, with an emphasis on regional problems of gas deliverability and potential bottlenecks. On the production side, the paper reviews the capability and the required investment necessary to handle an orderly transition to a stable supply and demand balance once the elusive bubble had finally disappeared
2010-08-31
.... PHMSA-2010-0226] Liquefied Natural Gas Facilities: Obtaining Approval of Alternative Vapor-Gas... safety standards for siting liquefied natural gas (LNG) facilities. Those standards require that an..., and Handling of Liquefied Natural Gas. That consensus [[Page 53372
International Nuclear Information System (INIS)
Ronchi, M.
1993-01-01
With the aim of establishing realistic options for deregulation in the natural gas industry, this paper first considers the structural evolution of this industry and evidences how it differs from the petroleum industry with which it exhibits some essential characteristics in common. This comparison is made in order to stress that, contrary to popular belief, that which is without doubt good for the petroleum industry is not necessarily so also for the natural gas industry. The paper concludes with separate analyses of the natural gas markets in the principal industrialized countries. Arguments are provided to show that the 'soft' deregulation option for the natural gas industry is not feasible, and that 'total' deregulation instead, backed by the passing of a suitable package of anti-trust laws 'unbundling' the industry's four major activities, i.e., production, storage, primary and secondary distribution, is the preferable option. The old concept of guaranteed supplies for minor users of natural gas should give way to the laws of supply and demand governing inter-fuel competition ensured through the strict supervision of vigilance committees
International Nuclear Information System (INIS)
Romney, G.
1998-01-01
This presentation focused on the strategies used by Texaco Global Gas and Power in their international marketing and business development. The company is a fully integrated mid-stream company with natural gas sales of 3.6 billion cubic feet per day and operating revenues of $3.6 billion. The company operates 1,116 miles of interstate gas pipelines and owns a dominant NGL export facility in Washington. They also generate 2223 MW of electric power. An additional 2428 MW are currently under development. In Colombia, Texaco supplies 90 per cent of the marketed gas. In Trinidad and Tobago, Texaco is in a 50/50 joint venture in the Dolphin field. Texaco also has a significant downstream presence in Brazil and is pursuing opportunities of the Gas Apertura in Venezuela. Key to the company's success are a defined strategy, dedication to the market place, alliances based on common interests and complimentary strengths, acceptance of greater risk and regionally based solutions. The bulk of the paper is devoted to describing the company's priorities and strategies in each of the Latin American countries. 5 figs
Natural gas for utility generation
International Nuclear Information System (INIS)
Moore, T.
1992-01-01
Forecasters predict that natural gas will be the dominant fuel choice for utility capacity additions in the coming decade and that power generation will be by far the largest growth market for gas sales. While gas's low emissions, high efficiency potential, and present low cost argue persuasively for a surge in gas-fired generation, many utilities have been slow to commit to a gas future, citing reasoned concern about long-term price trends and the ability of gas suppliers to deliver the fuel where and when it will be needed. Meanwhile, the relatively low cost of gas-fired units is providing an opportunity for independent power producers to compete strongly with utilities for generation contracts. EPRI studies suggest that a sound, competitive strategy will be based not on how much gas a utility burns, but rather on how this capacity fits into its overall generating mix at various fuel price levels. Gas suppliers will need to pay special attention to the operating needs of power generators if they are to solidify this important market
International Nuclear Information System (INIS)
Jego, H.
2000-01-01
Though oil is the most widely used primary energy in Japan, its market share is decreasing steadily in favour of other energies such as natural gas. Around 80 % of the gas consumed in Japan is imported in the form of LNG, with locally produced natural gas accounting for 5 % and LPG 12%. Annual LNG supplies now total 48 million tons (720 TWh) and are forecast to rise to 57 million tons over the next ten years. However, only on third of the total volume of LNG, i.e., 242 TWh, is distributed to final consumers. The rest is imported directly by power companies to produce electricity. The 245 gas distribution companies, 70 in the public sector and 175 in the private sector (including three large firms: Tokyo Gas, Osaka Gas and Toho Gas) carry the gas through their own non-interconnected networks to around 25 million customers, though the gas supply area covers only 5 % of the country. This small percentage can be explained partly by Japan's topography: 80 % of the land is covered by mountains. This means that only 20 % of the country is suitable for industrial and residential development. Populations living outside the gas supply areas mainly use LPG. The number of LPG customers totals around 25 million, a similar number to those using mains gas. However, the share of mains gas is increasing each year due to the population increase in urban zones. Though gas represents only 11 % of the energy consumed in Japan, it is nevertheless present on practically all markets and holds the leading position for domestic hot water and cooking in the residential sector. However, for heating, it lags well behind oil. In industry, mains gas covers only 5% of energy needs. However, with the expansion of the pipeline network and market liberalization, the share of gas is set to increase. The price of gas for the residential sector is 2 to 3 times higher than in western countries. This can be attributed to the following factors: most natural gas is imported LNG; unit consumption in the
Productivity improvements in gas distribution
International Nuclear Information System (INIS)
Young, M.R.
1997-01-01
In 1993, the Hilmer Report resulted in the introduction of the National Competition Policy which, in the case of the gas industry, aims to promote gas-on-gas competition where to date it has been excluded. In response, and to prepare for wide gas industry reform, Gas and Fuel formed three fundamentally different core businesses on 1 July 1996 - Energy Retail, Network, and Contestable Services. In one productivity improvement initiative which is believed to be unique, Gas and Fuel appointed three companies as strategic alliance partners for distribution system maintenance. Gas and Fuel can now concentrate on its core role as asset manager which owns and operates the distribution system while procuring all services from what will become non-regulated businesses. This Paper details this initiative and the benefits which have resulted from overall changes and improvements, and outlines the challenges facing Gas and Fuel in the future. (au)
Fonollosa, Jordi; Rodríguez-Luján, Irene; Trincavelli, Marco; Vergara, Alexander; Huerta, Ramón
2014-10-16
Chemical detection systems based on chemo-resistive sensors usually include a gas chamber to control the sample air flow and to minimize turbulence. However, such a kind of experimental setup does not reproduce the gas concentration fluctuations observed in natural environments and destroys the spatio-temporal information contained in gas plumes. Aiming at reproducing more realistic environments, we utilize a wind tunnel with two independent gas sources that get naturally mixed along a turbulent flow. For the first time, chemo-resistive gas sensors are exposed to dynamic gas mixtures generated with several concentration levels at the sources. Moreover, the ground truth of gas concentrations at the sensor location was estimated by means of gas chromatography-mass spectrometry. We used a support vector machine as a tool to show that chemo-resistive transduction can be utilized to reliably identify chemical components in dynamic turbulent mixtures, as long as sufficient gas concentration coverage is used. We show that in open sampling systems, training the classifiers only on high concentrations of gases produces less effective classification and that it is important to calibrate the classification method with data at low gas concentrations to achieve optimal performance.
Bowers, Michael T
1979-01-01
Gas Phase Ion Chemistry, Volume 2 covers the advances in gas phase ion chemistry. The book discusses the stabilities of positive ions from equilibrium gas-phase basicity measurements; the experimental methods used to determine molecular electron affinities, specifically photoelectron spectroscopy, photodetachment spectroscopy, charge transfer, and collisional ionization; and the gas-phase acidity scale. The text also describes the basis of the technique of chemical ionization mass spectrometry; the energetics and mechanisms of unimolecular reactions of positive ions; and the photodissociation
International Nuclear Information System (INIS)
1996-11-01
The Natural Gas Annual provides information on the supply and disposition of natural gas to a wide audience including industry, consumers, Federal and State agencies, and educational institutions. The 1995 data are presented in a sequence that follows natural gas (including supplemental supplies) from its production to its end use. This is followed by tables summarizing natural gas supply and disposition from 1991 to 1995 for each Census Division and each State. Annual historical data are shown at the national level
Gas transport during in vitro and in vivo preclinical testing of inert gas therapies
Directory of Open Access Journals (Sweden)
Ira Katz
2016-01-01
Full Text Available New gas therapies using inert gases such as xenon and argon are being studied, which require in vitro and in vivo preclinical experiments. Examples of the kinetics of gas transport during such experiments are analyzed in this paper. Using analytical and numerical models, we analyze an in vitro experiment for gas transport to a 96 cell well plate and an in vivo delivery to a small animal chamber, where the key processes considered are the wash-in of test gas into an apparatus dead volume, the diffusion of test gas through the liquid media in a well of a cell test plate, and the pharmacokinetics in a rat. In the case of small animals in a chamber, the key variable controlling the kinetics is the chamber wash-in time constant that is a function of the chamber volume and the gas flow rate. For cells covered by a liquid media the diffusion of gas through the liquid media is the dominant mechanism, such that liquid depth and the gas diffusion constant are the key parameters. The key message from these analyses is that the transport of gas during preclinical experiments can be important in determining the true dose as experienced at the site of action in an animal or to a cell.
Natural gas pipeline technology overview.
Energy Technology Data Exchange (ETDEWEB)
Folga, S. M.; Decision and Information Sciences
2007-11-01
The United States relies on natural gas for one-quarter of its energy needs. In 2001 alone, the nation consumed 21.5 trillion cubic feet of natural gas. A large portion of natural gas pipeline capacity within the United States is directed from major production areas in Texas and Louisiana, Wyoming, and other states to markets in the western, eastern, and midwestern regions of the country. In the past 10 years, increasing levels of gas from Canada have also been brought into these markets (EIA 2007). The United States has several major natural gas production basins and an extensive natural gas pipeline network, with almost 95% of U.S. natural gas imports coming from Canada. At present, the gas pipeline infrastructure is more developed between Canada and the United States than between Mexico and the United States. Gas flows from Canada to the United States through several major pipelines feeding U.S. markets in the Midwest, Northeast, Pacific Northwest, and California. Some key examples are the Alliance Pipeline, the Northern Border Pipeline, the Maritimes & Northeast Pipeline, the TransCanada Pipeline System, and Westcoast Energy pipelines. Major connections join Texas and northeastern Mexico, with additional connections to Arizona and between California and Baja California, Mexico (INGAA 2007). Of the natural gas consumed in the United States, 85% is produced domestically. Figure 1.1-1 shows the complex North American natural gas network. The pipeline transmission system--the 'interstate highway' for natural gas--consists of 180,000 miles of high-strength steel pipe varying in diameter, normally between 30 and 36 inches in diameter. The primary function of the transmission pipeline company is to move huge amounts of natural gas thousands of miles from producing regions to local natural gas utility delivery points. These delivery points, called 'city gate stations', are usually owned by distribution companies, although some are owned by
Pricing of natural gas in Kazakhstan
International Nuclear Information System (INIS)
Zhapargaliev, I.K.
1996-01-01
Two state companies are in charge of natural gas supply in Kazakhstan. They buy, transport and sell natural gas and have monopolized the industry and provoked increase of gas prices. Ministry of Oil and gas Industry proposed demonopolization. The restructuring that took place caused new distribution of tasks in the gas industry. A more competitive environment was created leading to normalization of the natural gas prices. All economic subjects were granted the right to acquire gas regardless the type of ownership. Measures implemented for reorganization of gas companies contributed to the reduction of gas transport costs and prices by 50% and to decrease of gas prices in the southern regions by 50%. Despite these measures gas prices for household sector are still unchanged and are below the import prices, the main reason being the low average household income
International Nuclear Information System (INIS)
1993-01-01
The Natural Gas Annual 1991 provides information on the supply and disposition of natural gas to a wide audience including industry, consumers Federal and State agencies, and education institutions. This report, the Natural Gas Annual 1991 Supplement: Company Profiles, presents a detailed profile of selected companies
Dicty_cDB: Contig-U15045-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available e) Bacillus anthracis str. CDC 684... 286 2e-75 EU302126_1( EU302126 |pid:none) Luciola terminali... AE006470_46( AE006470 |pid:none) Chlorobium tepidum TLS, complete ... 207 2e-51 AM494956_128( AM494956 |pid...centrotus purpuratus clone R3-42P23, WOR... 36 0.051 11 ( EK354403 ) 1095468426890 Global-Ocean-Sampling_GS-...** SEQUENCI... 38 0.25 13 ( EJ594751 ) 1092961073324 Global-Ocean-Sampling_GS-29-01-01-1... 40 0.26 2 ( BA00...170 ) 1093018401251 Global-Ocean-Sampling_GS-36-01-01-2... 50 0.35 1 ( ER486373 ) 1093015301415 Global-Ocean-Sampli
Mathematical modeling of non-stationary gas flow in gas pipeline
Fetisov, V. G.; Nikolaev, A. K.; Lykov, Y. V.; Duchnevich, L. N.
2018-03-01
An analysis of the operation of the gas transportation system shows that for a considerable part of time pipelines operate in an unsettled regime of gas movement. Its pressure and flow rate vary along the length of pipeline and over time as a result of uneven consumption and selection, switching on and off compressor units, shutting off stop valves, emergence of emergency leaks. The operational management of such regimes is associated with difficulty of reconciling the operating modes of individual sections of gas pipeline with each other, as well as with compressor stations. Determining the grounds that cause change in the operating mode of the pipeline system and revealing patterns of these changes determine the choice of its parameters. Therefore, knowledge of the laws of changing the main technological parameters of gas pumping through pipelines in conditions of non-stationary motion is of great importance for practice.
Natural gas monthly, April 1999
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-05-06
The Natural Gas Monthly (NGM) highlights activities, events, and analyses of interest to public and private sector organizations associated with the natural gas industry. Volume and price data are presented each month for natural gas production, distribution, consumption, and interstate pipeline activities. Producer-related activities and underground storage data are also reported. From time to time, the NGM features articles designed to assist readers in using and interpreting natural gas information. There are two feature articles in this issue: Natural gas 1998: Issues and trends, Executive summary; and Special report: Natural gas 1998: A preliminary summary. 6 figs., 28 tabs.
Natural gas monthly, August 1993
Energy Technology Data Exchange (ETDEWEB)
1993-08-25
The Natural Gas Monthly (NGM) is prepared in the Data Operations Branch of the Reserves and Natural Gas Division, Office of Oil and Gas, Energy Information Administration (EIA), US Department of Energy (DOE). The NGM highhghts activities, events, and analyses of interest to public and private sector organizations associated with the natural gas industry. Volume and price data are presented each month for natural gas production, distribution, consumption, and interstate pipeline activities. Producer-related activities and underground storage data are also reported. From time to time, the NGM features articles designed to assist readers in using and interpreting natural gas information.
Gas supply and Yorkshire Electricity
Energy Technology Data Exchange (ETDEWEB)
Anon.
1995-04-01
Yorkshire Electricity, among other independent suppliers of gas, now competes for a share of the United Kingdom gas market, previously monopolised by British Gas. The experience of this successful electric utility company, expanding into the industrial and domestic gas supply market is described in the article. The company`s involvement stems partly from the fact that significant volumes of gas are landed at three terminals within its franchise area. The company will also seek to use subsidaries to generate electric power from gas turbine power plants and explore the possibilities of developing combined heat and power (CHP) plants where appropriate. (UK)
Gas in Attack and Gas in Defense
1919-07-01
and to the fact that it affects the skin, the eyes, the throat and lungs, as well as the digestive’ tract if’ food be eaten that has been exposed to...zfYx~r its firat uzje by the Germanic before tile first Allied mustard gas at- $ack took place, This was made by the Franch in the vicinity of Com...of bicarbonate of soda &Uxr and their eyes, ears, mouth and nasal pasa gee washed with the same, PROTECTING FOOD FROM MUSTARD GAS, ‘9 It was very
Natural gas markets and the creation of an export gas pipeline system in Eastern Russia
International Nuclear Information System (INIS)
Saneev, B.G.; Sokolov, A.D.; Popov, S.P.
2003-01-01
The world natural gas markets are analysed, with a special focus on the countries of Northeast Asia (NEA). The natural gas demands of China, Japan and South Korea, until the year 2020, is projected, considering a possible share of Russian gas. The resource potential of natural gas from the Siberian platform and the Sakhalin shelf is given as a sound basis for fuelling Russia's position in the natural gas market of NEA countries. Development of the powerful gas industry in the East of Russia faces some particular conditions that can decrease the effectiveness of investments. The eastern geopolitical direction is very important for Russia and the necessity to create a favourable political and economic environment for oil and gas export is of prime interest, as stressed in Energy Strategy for Russia till the Year 2020. In this context, the long-term market for natural gas in East Siberia and the Far East of Russia is investigated. Possible routes of natural gas export from Russia to NEA countries include three main directions: to the west of China with connection to the 'West-East gas pipeline', a route through and/or round Mongolia and, finally, a route along the Trans-Siberian or Baikal-Amur railroads to Russian ports in the Far East. As a result of complex studies, three stages in the creation of the unified gas pipeline system are suggested. Evaluation of the investments required for construction of such a natural gas pipeline system, expected gas volumes and prices on the markets show its high economic efficiency. In conclusion, the most valuable ideas are stressed. (author)
International Nuclear Information System (INIS)
Stephenson, Eleanor; Doukas, Alexander; Shaw, Karena
2012-01-01
Natural gas is widely considered to be the crucial “bridging fuel” in the transition to the low-carbon energy systems necessary to mitigate climate change. This paper develops a case study of the shale gas industry in British Columbia (BC), Canada to evaluate this assumption. We find that the transition fuel argument for gas development in BC is unsubstantiated by the best available evidence. Emissions factors for shale gas and LNG remain poorly characterized and contested in the academic literature, and context-specific factors have significant impacts on the lifecycle emissions of shale gas but have not been evaluated. Moreover, while the province has attempted to frame natural gas development within its ambitious climate change policy, this framing misrepresents substantive policy on gas production. The “transition fuel” and “climate solution” labels applied to development by the BC provincial government risk legitimizing carbon-intensive gas development. We argue that policy makers in BC and beyond should abandon the “transition fuel” characterization of natural gas. Instead, decision making about natural gas development should proceed through transparent engagement with the best available evidence to ensure that natural gas lives up to its best potential in supporting a transition to a low-carbon energy system. - Highlights: ► Transition fuel discourse may greenwash gas development. ► Gaps in research obscure emissions factors for LNG and shale gas. ► Climate solution label for shale gas and LNG development in BC is unsubstantiated.
Brandenberger, Robert H.
2008-01-01
String gas cosmology is a string theory-based approach to early universe cosmology which is based on making use of robust features of string theory such as the existence of new states and new symmetries. A first goal of string gas cosmology is to understand how string theory can effect the earliest moments of cosmology before the effective field theory approach which underlies standard and inflationary cosmology becomes valid. String gas cosmology may also provide an alternative to the curren...
Bland-Hawthorn, J.; Reynolds, R. J.
2000-01-01
The interstellar medium (ISM) can be thought of as the galactic atmosphere which fills the space between stars. When clouds within the ISM collapse, stars are born. When the stars die, they return their matter to the surrounding gas. Therefore the ISM plays a vital role in galactic evolution. The medium includes starlight, gas, dust, planets, comets, asteroids, fast moving charged particles (cosmic rays) and magnetic fields. The gas can be further divided into hot, warm and cold components, e...
Measurements of gas permeability and non-Darcy flow in gas-water-hydrate systems
Energy Technology Data Exchange (ETDEWEB)
Ersland, G.; Husebo, J.; Graue, A.; Kvamme, B. [Bergen Univ., Bergen (Norway). Dept. of Physics and Technology; Baldwin, B. [Green Country Petrophysics LLC, Dewey, OK (United States); Stevens, J.; Howard, J. [ConocoPhillips, OK (United States)
2008-07-01
Storage of carbon dioxide (CO{sub 2}) in natural gas hydrate reservoirs may offer stable long-term storage of a greenhouse gas while benefiting from methane production, without requiring heat. By exposing hydrate to a thermodynamically preferred hydrate former, CO{sub 2}, the hydrate may be maintained macroscopically in the solid state and retain the stability of the formation. However, there is concern over the flow capacity in such reservoirs. This depends on several factors, notably thermodynamic destabilization of hydrate in small pores due to capillary effects; the presence of liquid channels separating the hydrate from the mineral surfaces; and, the connectivity of gas or liquid filled pores and channels. This paper described a technique for measuring gas permeability in gas-water-hydrate systems. It reported on several experiments that measured gas permeability during stages of hydrate growth in sandstone core plugs. Interactions between minerals and surrounding molecules were also discussed. The formation of methane hydrate in porous media was monitored and quantified with magnetic resonance imaging (MRI). MRI images of hydrate growth within the porous rock were provided along with measurements of gas permeability and non-Darcy flow effects at various hydrate saturations. Gas permeability was measured at steady state flow of methane through the hydrate-bearing core sample. Significant gas permeability was recorded for porous sandstone even when hydrates occupied up to 60 per cent of the pore space. It was concluded that MRI imaging can be used effectively to map and quantify hydrate saturation in sandstone core plugs. 27 refs., 2 tabs., 10 figs.
International Nuclear Information System (INIS)
1993-11-01
The increase in natural gas demand and the associated expansions of most of the pipeline systems serving western Canada have reduced the excess deliverability or excess productive capacity that existed at the time of deregulation of the natural gas industry in 1985. Based on an industry survey, the responses of natural gas buyers and sellers to recent supply difficulties are described. Specific production, transportation, and contractual difficulties were encountered in winter 1992/93 as production was stretched to meet record levels of demand during periods of very cold temperatures and as short-term spot prices reached very high levels. Problems at this time included wellhead freezeups, pipeline outages, and inadequate contract terms and conditions. Methods used to maintain gas flows to end users are reviewed, including a discussion of force majeure, spot gas purchases, storage, supply curtailment, and special loan arrangements. In 1992/93, in most instances where the responsibility fell on the end-user to solve the supply problem, the difficulty was shifted to local distribution companies who have traditionally had more experience with such situations. No cases were identified where either a firm or interruptible end-user was forced to curtail gas consumption because of inadequate supply. New market mechanisms are emerging that will enable buyers and sellers of western Canadian gas to avoid many of the problems encountered in 1992/93. These include prearranged backstopping arrangements, short-term spot markets, access to other gas basins, standardized gas contracts, electronic trading, and price risk management tools. 11 figs
International Nuclear Information System (INIS)
Nese, Gjermund
2004-11-01
The report focuses on the pricing of natural gas. The motivation has been the wish of the Norwegian authorities to increase the use of natural gas and that this should follow market conditions. The pricing of gas occurs at present in various ways in the different markets. The report identifies to main factors behind the pricing. 1) The type of market i.e. how far the liberalization of the gas markets has gone in the various countries. 2) The development within the regulation, climate and tax policies. The gas markets are undergoing as the energy markets in general, a liberalization process where the traditional monopoly based market structures are replaced by markets based on competition. There are great differences in the liberalization development of the various countries, which is reflected in the various pricing principles applied for the trade of gas in the countries. The analysis shows that the net-back-pricing is predominant in some countries i.e. that the price is in various ways indexed towards and follow the development of the price of alternative energy carriers so that the gas may be able to compete. The development towards trade places for gas where the pricing is based on offer and demand is already underway. As the liberalization of the European gas markets progresses it is expected that the gas price will be determined increasingly at spot markets instead of through bilateral agreements between monopolistic corporations. The development within the regulation, climate and tax policies and to what extent this may influence the gas prices in the future, are also studied. There seem to be effects that may pull in both directions but it is evident that these political variables will influence the gas pricing in the international market to a large extent and thereby also the future internal natural gas market
Gas target neutron generator studies
International Nuclear Information System (INIS)
Chatoorgoon, V.
1978-01-01
The need for an intense neutron source for the study of radiation damage on materials has resulted in the proposal of various solid, liquid, and gas targets. Among the gas targets proposed have been the transonic gas target, two types of hypersonic gas target, and the subsonic gas target (SGT). It has been suggested that heat deposition in a subsonic channel might create a gas density step which would constitute an attractive gas target type. The first part of the present study examines this aspect of the SGT and shows that gas density gradients are indeed formed by heat deposition in subsonic flow. The variation of beam voltage, gas density, gas pressure, and gas temperature within the channel have been calculated as functions of the system parameters: beam voltage, beam current, channel diameter, stagnation tank temperature and pressure. The analysis is applicable to any beam particle and target gas. For the case of T + on D 2 , which is relevant to the fusion application, the 14 MeV neutron profiles are presented as a function of system parameters. It is found that the SGT is compatible with concentrated intense source operation. The possibility of instability was investigated in detail using a non-linear analysis which made it possible to follow the complete time development of the SGT. It was found that the SGT is stable against all small perturbations and certain types of large perturbations. It appears that the SGT is the most advantageous type of gas target, operating at a lower mass flow and less severe stagnation tank conditions than the other types. The second part of the thesis examines a problem associated with the straight hypersonic target, the deuterium spill into the tritium port. The regime of practical operation for this target is established. (auth)
Energy Technology Data Exchange (ETDEWEB)
1974-01-01
The Khadi and Village Industries Commission offers a gobar gas (methane gas) production scheme. The gas plant, available in sizes of 60 to 3000 cu ft, requires only low maintenance expenditures. The cow dung, which is at present being wasted or burned as domestic fuel, can be used for manufacturing methane for fuel gas. The residue will be a good fertilizer for increasing food production. There are now about 4000 gobar gas plants in India.
Materials For Gas Capture, Methods Of Making Materials For Gas Capture, And Methods Of Capturing Gas
Polshettiwar, Vivek
2013-06-20
In accordance with the purpose(s) of the present disclosure, as embodied and broadly described herein, embodiments of the present disclosure, in one aspect, relate to materials that can be used for gas (e.g., CO.sub.2) capture, methods of making materials, methods of capturing gas (e.g., CO.sub.2), and the like, and the like.
US crude oil, natural gas, and natural gas liquids reserves: 1990 annual report
International Nuclear Information System (INIS)
1991-09-01
The primary focus of this report is to provide an accurate estimate of US proved reserves of crude oil, natural gas, and natural gas liquids. These estimates were considered essential to the development, implementation, and evaluation of natural energy policy and legislation. In the past, the government and the public relied upon industry estimates of proved reserves. These estimates were prepared jointly by the American Petroleum Institute (API) and the American Gas Association (AGA) and published in their annual report, Reserves of Crude Oil, Natural Gas Liquids, and Natural Gas in the United States and Canada. However, API and AGA ceased publication of reserves estimates after their 1979 report. By the mid-1970's, various federal agencies had separately established programs to collect data on, verify, or independently estimate domestic proved reserves of crude oil or natural gas. Each program was narrowly defined to meet the particular needs of the sponsoring agency. In response to recognized need for unified, comprehensive proved reserves estimates, Congress in 1977 required the Department of Energy to prepare such estimates. To meet this requirement, the EIA's reserves program was undertaken to establish a unified, verifiable, comprehensive, and continuing statistical series for proved reserves of crude oil and natural gas. The program was expanded to include proved reserves of natural gas liquids in the 1979 report. 36 refs., 11 figs., 16 tabs
International Nuclear Information System (INIS)
Anon.
1992-01-01
This book is a directory of enterprises under the Ministry of Oil and Gas Industry of the former USSR and is published for winter 1991 through spring 1992. It contains names and addresses for associations, institutes, design and engineering offices, oil and gas drilling administrations, and gas processing plants
International Nuclear Information System (INIS)
Malherbe, Herve; Corbeau, Anne-Sophie; Lu, Long; Maire, Jacques; Verdier, Catherine; Bros, Thierry; Nyouki, Evariste; Astruc, Pierre; Katz, Richard; Jamme, Dominique; Rosier, Philippe; Salanson, Damien; Saniez, Thierry; Moraleda, Pedro; Le Gourrierec, M.
2012-01-01
After a brief introduction, this document contains the various contributions and interventions during round tables dealing with the evolution of gas price on American, Asian and European markets, an assessment of the organised gas market (model, references, members, and so on), an assessment of market gas opening, the point of view of consumers and providers on gas price. Then three articles address the issue of gas pricing in France, the developments of gas industry in the world (consumptions, production, perspectives for LNG) and the Mediterranean situation with respect to gas prices (trends and challenges)
Detector module for gas monitor
International Nuclear Information System (INIS)
1980-01-01
The invention relates to radioactive source detector module for use in a gas monitor. It is adapted to contain the source and other detector components to allow sealed coupling of those components with other portions of the gas monitor. It is particularly concerned with the use of radioactive materials used as electron sources in gas monitors. The module is used to detect changes in electron flow caused by partial absorption of the electron capture gas flowing between two electrodes. The assembly includes a gas flow source, a gas receiver and an electronic assembly for receiving a signal from the detector. The radioactive source and electrodes are housed so that they are connected to the gas flow source so as to prevent accidental or undesired disconnection. It is designed so that the detector module may be removed or replaced into the gas monitor assemblies by untrained personnel so as to prevent exposure to the radioactive material. Full details are given. (U.K.)
The Jarvis gas release incident
International Nuclear Information System (INIS)
Manocha, J.
1992-01-01
On 26 September, 1991, large volumes of natural gas were observed to be leaking from two water wells in the Town of Jarvis. Gas and water were being ejected from a drilled water well, at which a subsequent gas explosion occurred. Measurements of gas concentrations indicated levels far in excess of the lower flammability limit at several locations. Electrical power and natural gas services were cut off, and residents were evacuated. A state of emergency was declared, and gas was found to be flowing from water wells, around building foundations, and through other fractures in the ground. By 27 September the volumes of gas had reduced substantially, and by 30 September all residents had returned to their homes and the state of emergency was cancelled. The emergency response, possible pathways of natural gas into the aquifer, and public relations are discussed. It is felt that the likelihood of a similar incident occurring in the future is high. 11 figs
Natural gas in the European Community
International Nuclear Information System (INIS)
Kalim, Z.
1991-01-01
A report is presented on 'Natural Gas in the European Community'. Aspects discussed include the challenges facing the gas industry in the EC, the development of the European gas industry, the structure and role of European gas companies, the sources of European supply, gas contracts and the influences that operate on sales into end markets, electricity generation from natural gas, evolving markets for natural gas in the EC, life in the private sector using British Gas as a role model and country profiles for eleven European countries. (UK)
International Nuclear Information System (INIS)
1998-10-01
The Natural Gas Annual provides information on the supply and disposition of natural gas to a wide audience including industry, consumers, Federal and State agencies, and educational institutions. The 1997 data are presented in a sequence that follows natural gas (including supplemental supplies) from its production to its end use. This is followed by tables summarizing natural gas supply and disposition from 1993 to 1997 for each Census Division and each State. Annual historical data are shown at the national level. 27 figs., 109 tabs
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-10-01
The Natural Gas Annual provides information on the supply and disposition of natural gas to a wide audience including industry, consumers, Federal and State agencies, and educational institutions. The 1997 data are presented in a sequence that follows natural gas (including supplemental supplies) from its production to its end use. This is followed by tables summarizing natural gas supply and disposition from 1993 to 1997 for each Census Division and each State. Annual historical data are shown at the national level. 27 figs., 109 tabs.
Energy Technology Data Exchange (ETDEWEB)
Fujii, K [University of Shizuoka, Shizuoka (Japan). Faculty of Education
1996-09-01
Coal seam gas is also called coal bed methane gas, indicating the gas existing in coal beds. The gas is distinguished from the oil field based gas, and also called non-conventional type gas. Its confirmed reserve is estimated to be 24 trillion m {sup 3}, with the trend of its development seen worldwide as utilization of unused resource. For the necessity of cultivating relevant technologies in Japan, this paper considers processes of production, movement, stockpiling, and accumulation of the gas. Its productibility is controlled by thickness of a coal bed, degree of coalification, gas content, permeability, groundwater flow, and deposition structure. Gas generation potential is evaluated by existing conditions of coal and degree of coalification, and methane production by biological origin and thermal origin. Economically viable methane gas is mainly of the latter origin. Evaluating gas reserve potential requires identification of the whole mechanism of adsorption, accumulation and movement of methane gas. The gas is expected of effect on environmental aspects in addition to availability as utilization of unused energy. 5 figs.
International Nuclear Information System (INIS)
Saarni, T.
1996-01-01
Finnish natural gas usage topped the 3.3 billion cubic metre mark last year, up 3.6 % on the 1994 figure. Growth has increased now for 12 years in a row. Thanks to offtake by large individual users, the pipeline network has been expanded from South-East Finland to the Greater Helsinki area and central southern Finland. Natural gas plays a much larger role in this region than the 10 % accounted for by natural gas nationally would indicate. The growth in the share of Finland's energy use accounted for by natural gas has served to broaden the country's energy supply base. Natural gas has replaced coal and oil, which has considerably reduced the level of emissions resulting form energy generation
International Nuclear Information System (INIS)
Novoa, M.G.
1996-01-01
Environmental pollution and specially air pollution, it is produced in a wide range by exhaust gases of internal combustion engines, those which are used to generate energy. Direct use of fossil combustibles as petroleum derivatives and coal produces large quantities of harmful elements to ecology equilibrium. Whit the objective of reducing this pollutant load has been development thermoelectric plants whit turbine to gas or to steam, those which are moved by internal combustion engines. Gas engines can burn most of available gases, as both solid waste and wastewater treatment plants biogas, propane gas, oil-liquefied gas or natural gas. These gases are an alternative and clean energy source, and its efficiency in internal combustion engines is highest compared whit other combustibles as gasoline-motor or diesel
Natural gas hydrate formation and inhibition in gas/crude oil/aqueous systems
DEFF Research Database (Denmark)
Daraboina, Nagu; Pachitsas, Stylianos; von Solms, Nicolas
2015-01-01
Gas hydrate formation in multi phase mixtures containing an aqueous phase (with dissolved salts), reservoir fluid (crude oil) and natural gas phase was investigated by using a standard rocking cell (RC-5) apparatus. The hydrate formation temperature was reduced in the presence of crude oils...... can contribute to the safe operation of sub sea pipelines in the oil and gas industry....
Formation of submarine gas hydrates
Energy Technology Data Exchange (ETDEWEB)
Soloviev, V.; Ginsburg, G.D. (Reserch Institute of Geology and Mineral Resources of the Ocean ' ' VNII Okeangeologia' ' , St. Petersburg (Russian Federation))
1994-03-01
Submarine gas hydrates have been discoverd in the course of deep-sea drilling (DSDP and ODP) and bottom sampling in many offshore regions. This paper reports on expeditions carried out in the Black, Caspian and Okhotsk Seas. Gas hydrate accumulations were discovered and investigated in all these areas. The data and an analysis of the results of the deep-sea drilling programme suggest that the infiltration of gas-bearing fluids is a necessary condition for gas hydrate accumulation. This is confirmed by geological observations at three scale levels. Firstly, hydrates in cores are usually associated with comparatively coarse-grained, permeable sediments as well as voids and fractures. Secondly, hydrate accumulations are controlled by permeable geological structures, i.e. faults, diapirs, mud volcanos as well as layered sequences. Thirdly, in the worldwide scale, hydrate accumulations are characteristic of continental slopes and rises and intra-continental seas where submarine seepages also are widespread. Both biogenic and catagenic gas may occur, and the gas sources may be located at various distances from the accumulation. Gas hydrates presumably originate from water-dissolved gas. The possibility of a transition from dissolved gas into hydrate is confirmed by experimental data. Shallow gas hydrate accumulations associated with gas-bearing fluid plumes are the most convenient features for the study of submarine hydrate formation in general. These accumulations are known from the Black, Caspian and Okhotsk Seas, the Gulf of Mexico and off northern California. (au) (24 refs.)
Heterogeneous gas core reactor
International Nuclear Information System (INIS)
Han, K.I.
1977-01-01
Preliminary investigations of a heterogeneous gas core reactor (HGCR) concept suggest that this potential power reactor offers distinct advantages over other existing or conceptual reactor power plants. One of the most favorable features of the HGCR is the flexibility of the power producing system which allows it to be efficiently designed to conform to a desired optimum condition without major conceptual changes. The arrangement of bundles of moderator/coolant channels in a fissionable gas or mixture of gases makes a truly heterogeneous nuclear reactor core. It is this full heterogeneity for a gas-fueled reactor core which accounts for the novelty of the heterogeneous gas core reactor concept and leads to noted significant advantages over previous gas core systems with respect to neutron and fuel economy, power density, and heat transfer characteristics. The purpose of this work is to provide an insight into the design, operating characteristics, and safety of a heterogeneous gas core reactor system. The studies consist mainly of neutronic, energetic and kinetic analyses of the power producing and conversion systems as a preliminary assessment of the heterogeneous gas core reactor concept and basic design. The results of the conducted research indicate a high potential for the heterogeneous gas core reactor system as an electrical power generating unit (either large or small), with an overall efficiency as high as 40 to 45%. The HGCR system is found to be stable and safe, under the conditions imposed upon the analyses conducted in this work, due to the inherent safety of ann expanding gaseous fuel and the intrinsic feedback effects of the gas and water coolant
Gas industry development in Egypt
International Nuclear Information System (INIS)
Roze, J.; Longueville, P.
2000-01-01
Egypt is a country with major gas potential and its gas industry has grown rapidly over the last ten years. Proven natural gas reserves total an estimated 1,050 billion m 3 . According to the re-evaluation of reserves made in January 2000, probable reserves stand at 3,400 billion m 3 , placing Egypt in ninth position as a potential world producer. These reserves are contained in 120 fields located mainly in the Nile Delta and Mediterranean regions and, to a lesser extent, in the Western Desert and the Gulf of Suez. Over the last two years, 54 new gas field have been discovered and registered. Consumption of oil, Egypt's main primary energy source, has declined steadily since the early 1980's in favour of natural gas, which has enjoyed steady growth. The penetration of natural gas is due to the growth of industries consuming large quantities of gas (chemical, fertilizers, etc), the development of new gas fields and the use of gas as a substitute for oil and coal, especially in the power industry which accounts for a major share of energy consumption, i.e., two-thirds of production in 1997. However, as Egypt is currently neither an importer or exporter of natural gas, the growth in consumption has naturally followed that of production, and the lack of infrastructure explains the limited penetration of gas in the residential sector (less than 2 % in 1997). According to the gas development plan drawn up by the Egyptian authorities, internal consumption should increase from 13.5 billion m 3 per year in 1998 to around 45.5 billion m 3 per year in 2017. This consumption increase will be accelerated to respond to domestic needs and, in particular, to favour the implementation of the national redevelopment plan (distribution of the population over 25% of the country by 2020, compared to 4% day). The energy vector of this urban policy is gas. Moreover, this policy should offset the drop in income resulting from declining oil production. The Egyptian authorities, via a range
The Noble Gas Fingerprint in a UK Unconventional Gas Reservoir
McKavney, Rory; Gilfillan, Stuart; Györe, Domokos; Stuart, Fin
2016-04-01
In the last decade, there has been an unprecedented expansion in the development of unconventional hydrocarbon resources. Concerns have arisen about the effect of this new industry on groundwater quality, particularly focussing on hydraulic fracturing, the technique used to increase the permeability of the targeted tight shale formations. Methane contamination of groundwater has been documented in areas of gas production1 but conclusively linking this to fugitive emissions from unconventional hydrocarbon production has been controversial2. A lack of baseline measurements taken before drilling, and the equivocal interpretation of geochemical data hamper the determination of possible contamination. Common techniques for "fingerprinting" gas from discrete sources rely on gas composition and isotopic ratios of elements within hydrocarbons (e.g. δ13CCH4), but the original signatures can be masked by biological and gas transport processes. The noble gases (He, Ne, Ar, Kr, Xe) are inert and controlled only by their physical properties. They exist in trace quantities in natural gases and are sourced from 3 isotopically distinct environments (atmosphere, crust and mantle)3. They are decoupled from the biosphere, and provide a separate toolbox to investigate the numerous sources and migration pathways of natural gases, and have found recent utility in the CCS4 and unconventional gas5 industries. Here we present a brief overview of noble gas data obtained from a new coal bed methane (CBM) field, Central Scotland. We show that the high concentration of helium is an ideal fingerprint for tracing fugitive gas migration to a shallow groundwater. The wells show variation in the noble gas signatures that can be attributed to differences in formation water pumping from the coal seams as the field has been explored for future commercial development. Dewatering the seams alters the gas/water ratio and the degree to which noble gases degas from the formation water. Additionally the
Gas market prospects in Europe
International Nuclear Information System (INIS)
Rissanen, E.
1992-01-01
Gas demand in Europe may rise 50 to 70% during the next 20 years. The most weighty reasons for the increase would be a robust increase of gas-fuelled power generation, the gas use for abating environmental pollution and a remarkable replacement of coal and oil by gas. A dilemma will be whether a sufficient volume of gas is available particularly for Eastern Europe. The total indigenous production and the imports from existing sources cannot increase sufficiently. Other reasons for new imports are diversification and security of supplies and a short lifetime of domestic reserves. Potential sources to import incremental gas and their shares could be as follows: Algeria and Libya 15 - 20%, Russia 20 - 35%, overseas imports as LNG (liquefied natural gas) 20 - 35% and Iran by pipeline 20 - 25%. 1 tab
International Nuclear Information System (INIS)
Vermeer, B.
1997-01-01
A Dutch public utility (Obragas) introduces a new way to supply gas for their household clients in Helmond, Netherlands: the gas wall socket. The use of gas wall sockets must prevent the decrease of the market share for natural gas compared to the market share of electricity for households
The Researches on Reasonable Well Spacing of Gas Wells in Deep and low Permeability Gas Reservoirs
Bei, Yu Bei; Hui, Li; Lin, Li Dong
2018-06-01
This Gs64 gas reservoir is a condensate gas reservoir which is relatively integrated with low porosity and low permeability found in Dagang Oilfield in recent years. The condensate content is as high as 610g/m3. At present, there are few reports about the well spacing of similar gas reservoirs at home and abroad. Therefore, determining the reasonable well spacing of the gas reservoir is important for ensuring the optimal development effect and economic benefit of the gas field development. This paper discusses the reasonable well spacing of the deep and low permeability gas reservoir from the aspects of percolation mechanics, gas reservoir engineering and numerical simulation. considering there exist the start-up pressure gradient in percolation process of low permeability gas reservoir, this paper combined with productivity equation under starting pressure gradient, established the formula of gas well spacing with the formation pressure and start-up pressure gradient. The calculation formula of starting pressure gradient and well spacing of gas wells. Adopting various methods to calculate values of gas reservoir spacing are close to well testing' radius, so the calculation method is reliable, which is very important for the determination of reasonable well spacing in low permeability gas reservoirs.
Condensation in gas transmission pipelines. Phase behavior of mixtures of hydrogen with natural gas
Energy Technology Data Exchange (ETDEWEB)
Schouten, J.A.; Michels, J.P.J. [Amsterdam Univ. (Netherlands). Van der Waals-Zeeman Inst.; Rosmalen, R.J. van [Energy, Roden (Netherlands)
2005-05-01
Several pressure and temperature reductions occur along gas transmission lines. Since the pressure and temperature conditions of the natural gas in the pipeline are often close to the dew point curve, liquid dropout can occur. Injection of hydrogen into the natural gas will change the phase envelope and thus the liquid dropout. This condensation of the heavy hydrocarbons requires continuous operational attention and a positive effect of hydrogen may affect the decision to introduce hydrogen. In this paper we report on calculations of the amount of condensate in a natural gas and in this natural gas mixed with 16.7% hydrogen. These calculations have been performed at conditions prevailing in gas transport lines. The results will be used to discuss the difference in liquid dropout in a natural gas and in a mixture with hydrogen at pressure reduction stations, at crossings under waterways, at side-branching, and at separators in the pipelines. (author)
Holko, David A.
1982-01-01
Presents a complete computer program demonstrating the relationship between volume/pressure for Boyle's Law, volume/temperature for Charles' Law, and volume/moles of gas for Avagadro's Law. The programing reinforces students' application of gas laws and equates a simulated moving piston to theoretical values derived using the ideal gas law.…
NREL + Southern California Gas
Energy Technology Data Exchange (ETDEWEB)
Berdahl, Sonja E [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-10-09
NREL and Southern California Gas Company are evaluating a new 'power-to-gas' approach - one that produces methane through a biological pathway and uses the expansive natural gas infrastructure to store it. This approach has the potential to change how the power industry approaches renewable generation and energy storage.
Lee, Arum; Park, Eun-Byeol; Lee, Janghyun; Choi, Byong-Seok; Kang, Suk-Jo
2017-03-01
Cyclic GMP-AMP synthase (cGAS) is a DNA-sensing enzyme in the innate immune system. Recent studies using core-cGAS lacking the N terminus investigated the mechanism for binding of double-stranded (ds) DNA and synthesis of 2',3'-cyclic GMP-AMP (cGAMP), a secondary messenger that ultimately induces type I interferons. However, the function of the N terminus of cGAS remains largely unknown. Here, we found that the N terminus enhanced the activity of core-cGAS in vivo. Importantly, the catalytic activity of core-cGAS decreased as the length of double-stranded DNA (dsDNA) increased, but the diminished activity was restored by addition of the N terminus. Furthermore, the N terminus de-oligomerized the 2 : 2 complex of core-cGAS and dsDNA into a 1 : 1 complex, suggesting that the N terminus enhanced the activity of core-cGAS by facilitating formation of a monomeric complex of cGAS and DNA. © 2017 Federation of European Biochemical Societies.
International Nuclear Information System (INIS)
Julius, D.; Mashayekhi, A.
1990-01-01
Natural gas resembles oil in fulfilling a wide variety of uses as both a source of energy and a feedstock, but the proportion of world production that is traded internationally is very much lower, and insufficient for a world price of gas to be established. Written specifically for economists interested in energy, development and industrial economics; oil and gas industry personnel; officials of developing countries; and intergovernmental organizations concerned with development. This book addresses the issues of how the economic price of gas is determined within individual countries with different characteristics and which factors should be taken into account by governments in the formulation of pricing policies that are appropriate for gas. These are illustrated with estimates of the costs of exploration and production of gas, and of the benefits to be derived from its use in various economic sectors for a number of Third World countries. The book also presents a detailed case study of the development of gas pricing in Bangladesh, and an analytical framework for the development of a formal gas planning model that could be applied to the cases of actual countries contemplating the development of gas use in the future
Incremental natural gas resources through infield reserve growth/secondary natural gas recovery
Energy Technology Data Exchange (ETDEWEB)
Finley, R.J.; Levey, R.A.; Hardage, B.A.
1993-12-31
The primary objective of the Infield Reserve Growth/Secondary Natural Gas Recovery (SGR) project is to develop, test, and verify technologies and methodologies with near- to midterm potential for maximizing the recovery of natural gasfrom conventional reservoirs in known fields. Additional technical and technology transfer objectives of the SGR project include: To establish how depositional and diagenetic heterogeneities in reservoirs of conventional permeability cause reservoir compartmentalization and, hence, incomplete recovery of natural gas. To document examples of reserve growth occurrence and potential from fluvial and deltaic sandstones of the Texas gulf coast basin as a natural laboratory for developing concepts and testing applications to find secondary gas. To demonstrate how the integration of geology, reservoir engineering, geophysics, and well log analysis/petrophysics leads to strategic recompletion and well placement opportunities for reserve growth in mature fields. To transfer project results to a wide array of natural gas producers, not just as field case studies, but as conceptual models of how heterogeneities determine natural gas flow units and how to recognize the geologic and engineering clues that operators can use in a cost-effective manner to identify incremental, or secondary, gas.
International Nuclear Information System (INIS)
Patterson, W.
1999-01-01
Changes in our electricity systems provoked by natural gas power generation technology are paving the way for large-scale renewables use in the future. Natural gas and gas turbines are now such a cheap and easy option for electricity generation that they appear to cast a pall over renewables. The market share of gas-fired generation continues expanding inexorably. Its cost continues to fall, setting renewables an ever more demanding competitive target. Nevertheless, paradoxical though this may sound, natural gas is actually the natural ally of renewables. Despite the fierce competitive challenge it represents, natural gas may even be the most important single factor shaping a bright future for renewables. (author)
CO Emissions from Gas Engines Operating on Biomass Producer Gas
DEFF Research Database (Denmark)
Ahrenfeldt, Jesper; Jensen, T. K.; Henriksen, Ulrik Birk
2004-01-01
High carbon monoxide (CO) emission from gas engines fueled by producer gas is a concerning problem in the struggle to make biomass gasification for heat and power production a success. CO emissions from engines operating on biomass producer gases are high, especially at very lean conditions where...
Perez, [No Value; Freeman, K
In this paper we test the idea that the low-metallicity hot gas in the centre of NGC 1291 is heated via a dynamical process. In this scenario, the gas from the outer gas-rich ring loses energy through bar-driven shocks and falls to the centre. Heating of the gas to X-ray temperatures comes from the
Out of gas: Tenneco in the era of natural gas regulation, 1938--1978
Raley, David
2011-12-01
Federal regulation over the natural gas industry spanned 1938--1978, during which time both the industry and the nature of the regulation changed. The original intent of the law was to reform an industry stagnating because of the Depression, but regulation soon evolved into a public-private partnership to win World War II, then to a framework for the creation and management of a nationwide natural gas grid in the prosperous post-war years, and finally to a confused and chaotic system of wellhead price regulation which produced shortages and discouraged new production during the 1950s and 1960s. By the 1970s, regulation had become ineffective, leading to deregulation in 1978. The natural gas industry operated under the oversight of the Federal Power Commission (FPC) which set gas rates, regulated profits and competition, and established rules for entry and exit into markets. Over the course of four decades, the FPC oversaw the development of a truly national industry built around a system of large diameter pipelines. Tennessee Gas Transmission Company (later Tenneco) was an integral part of this industry. At first, Tenneco prospered under regulation. Regulation provided Tenneco with the means to build its first pipeline and a secure revenue stream for decades. A series of conflicts with the FPC and the difficulties imposed by the Phillips vs. Wisconsin case in 1954 soon interfered with the ambitious long-term goals of Tenneco CEO and president Gardiner Symonds. Tenneco first diversified into unregulated businesses in the 1940s, which accelerated as regulatory changes constrained the company's growth. By the 1960s the company was at the forefront of the conglomeration movement, when Tenneco included a variety of disparate businesses, including oil and gas production, chemicals, consumer packaging, manufacturing, shipbuilding, and food production, among others. Gas transmission became a minority interest in Tenneco's portfolio as newer and larger divisions
Solar-gas systems impact analysis study
Neill, C. P.; Hahn, E. F.; Loose, J. C.; Poe, T. E.; Hirshberg, A. S.; Haas, S.; Preble, B.; Halpin, J.
1984-07-01
The impacts of solar/gas technologies on gas consumers and on gas utilities were measured separately and compared against the impacts of competing gas and electric systems in four climatic regions of the U.S. A methodology was developed for measuring the benefits or penalties of solar/gas systems on a combined basis for consumers sand distribution companies. It is shown that the combined benefits associated with solar/gas systems are generally greatest when the systems are purchased by customers who would have otherwise chosen high-efficiency electric systems (were solar/gas systems not available in the market place). The role of gas utilities in encouraging consumer acceptance of solar/gas systems was also examined ion a qualitative fashion. A decision framework for analyzing the type and level of utility involvement in solar/gas technologies was developed.
Impact of airway gas exchange on the multiple inert gas elimination technique: theory.
Anderson, Joseph C; Hlastala, Michael P
2010-03-01
The multiple inert gas elimination technique (MIGET) provides a method for estimating alveolar gas exchange efficiency. Six soluble inert gases are infused into a peripheral vein. Measurements of these gases in breath, arterial blood, and venous blood are interpreted using a mathematical model of alveolar gas exchange (MIGET model) that neglects airway gas exchange. A mathematical model describing airway and alveolar gas exchange predicts that two of these gases, ether and acetone, exchange primarily within the airways. To determine the effect of airway gas exchange on the MIGET, we selected two additional gases, toluene and m-dichlorobenzene, that have the same blood solubility as ether and acetone and minimize airway gas exchange via their low water solubility. The airway-alveolar gas exchange model simulated the exchange of toluene, m-dichlorobenzene, and the six MIGET gases under multiple conditions of alveolar ventilation-to-perfusion, VA/Q, heterogeneity. We increased the importance of airway gas exchange by changing bronchial blood flow, Qbr. From these simulations, we calculated the excretion and retention of the eight inert gases and divided the results into two groups: (1) the standard MIGET gases which included acetone and ether and (2) the modified MIGET gases which included toluene and m-dichlorobenzene. The MIGET mathematical model predicted distributions of ventilation and perfusion for each grouping of gases and multiple perturbations of VA/Q and Qbr. Using the modified MIGET gases, MIGET predicted a smaller dead space fraction, greater mean VA, greater log(SDVA), and more closely matched the imposed VA distribution than that using the standard MIGET gases. Perfusion distributions were relatively unaffected.
Developing the east coast gas industry
International Nuclear Information System (INIS)
Stedman, C.
1998-01-01
Development of a natural gas industry on Canada's east coast was discussed. The various stages of near-term and long-term development were outlined. Opportunities were identified in the areas of Grand Banks gas utilization, third party gas and natural gas liquids transportation and processing, cogeneration, petrochemicals and in energy marketing and services. As an example of this industry development, a corporate review of Novagas Canada Ltd., was presented. The company was formed in January 1994 and is wholly owned by Nova Gas International. Novagas Canada has ultimate resources of 62.9 Tcf of natural gas of which 48.9 Tcf remains to be discovered. The company focuses on non-regulated mid-stream operations of the natural gas/natural gas liquid value chain. Some 800 million dollars have been invested so far in gas processing, liquids and olefins businesses in Nova Scotia and the Grand Banks/Labrador area. The pending Nova/TCPL merger will combine Novagas Canada's and TransCanada Gas Services' midstream assets. The general conclusion was that the resource base is large enough to support development throughout the gas and natural gas liquids value chain, and that a critical mass is required to support development of the necessary gas infrastructure. A sizeable challenge remains in encouraging gas utilization, and in encouraging competition, open access and unbundling of energy services. 2 tabs., 2 figs
Gas Cylinder Safety, Course 9518
Energy Technology Data Exchange (ETDEWEB)
Glass, George [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-10-27
This course, Gas Cylinder Safety (#9518), presents an overview of the hazards and controls associated with handling, storing, using, and transporting gas cylinders. Standard components and markings of gas cylinders are also presented, as well as the process for the procurement, delivery, and return of gas cylinders at Los Alamos National Laboratory (LANL).
PHIBSS: Unified Scaling Relations of Gas Depletion Time and Molecular Gas Fractions
Tacconi, L. J.; Genzel, R.; Saintonge, A.; Combes, F.; García-Burillo, S.; Neri, R.; Bolatto, A.; Contini, T.; Förster Schreiber, N. M.; Lilly, S.; Lutz, D.; Wuyts, S.; Accurso, G.; Boissier, J.; Boone, F.; Bouché, N.; Bournaud, F.; Burkert, A.; Carollo, M.; Cooper, M.; Cox, P.; Feruglio, C.; Freundlich, J.; Herrera-Camus, R.; Juneau, S.; Lippa, M.; Naab, T.; Renzini, A.; Salome, P.; Sternberg, A.; Tadaki, K.; Übler, H.; Walter, F.; Weiner, B.; Weiss, A.
2018-02-01
This paper provides an update of our previous scaling relations between galaxy-integrated molecular gas masses, stellar masses, and star formation rates (SFRs), in the framework of the star formation main sequence (MS), with the main goal of testing for possible systematic effects. For this purpose our new study combines three independent methods of determining molecular gas masses from CO line fluxes, far-infrared dust spectral energy distributions, and ∼1 mm dust photometry, in a large sample of 1444 star-forming galaxies between z = 0 and 4. The sample covers the stellar mass range log(M */M ⊙) = 9.0–11.8, and SFRs relative to that on the MS, δMS = SFR/SFR(MS), from 10‑1.3 to 102.2. Our most important finding is that all data sets, despite the different techniques and analysis methods used, follow the same scaling trends, once method-to-method zero-point offsets are minimized and uncertainties are properly taken into account. The molecular gas depletion time t depl, defined as the ratio of molecular gas mass to SFR, scales as (1 + z)‑0.6 × (δMS)‑0.44 and is only weakly dependent on stellar mass. The ratio of molecular to stellar mass μ gas depends on (1+z{)}2.5× {(δ {MS})}0.52× {({M}* )}-0.36, which tracks the evolution of the specific SFR. The redshift dependence of μ gas requires a curvature term, as may the mass dependences of t depl and μ gas. We find no or only weak correlations of t depl and μ gas with optical size R or surface density once one removes the above scalings, but we caution that optical sizes may not be appropriate for the high gas and dust columns at high z. Based on observations of an IRAM Legacy Program carried out with the NOEMA, operated by the Institute for Radio Astronomy in the Millimetre Range (IRAM), which is funded by a partnership of INSU/CNRS (France), MPG (Germany), and IGN (Spain).
Gas, the energy for transition?
International Nuclear Information System (INIS)
Pigenet, Yaroslav
2014-01-01
The author describes gas as the less polluting fossil energy. He outlines that new gas fields have been discovered, notably non conventional gas fields. He notices that whatever conventional or not conventional, a gas field produces methane, and that there is therefore no difference for the end user. However, he notices that reserve assessments by the IAE are a matter of discussion, and that hydraulic fracturing has resulted in important environmental and human damages. Anyway, gas will be needed to face energy demand
International Nuclear Information System (INIS)
Anon.
1996-01-01
Gas fuels are the petroleum substitution fuels that have received the best agreement in most parts of the world. This success is due to the existence of natural gas fields or LPG reserves in several countries and to the possibility of fast development of these resources. Countries with various size and economic policy such as New Zealand, USA, Argentina, Japan or Italy have developed a very significant fleet of gas fuel vehicles. This paper summarizes the consumption of gas fuels, the number of gas fuel equipped vehicles and of gas fuel stations in the principal consuming countries. The size and composition of vehicle fleets varies from one country to the other and depends on the economical and environmental incitements and constraints from the governments. Details are given separately for LPG and natural gas vehicle fuels. (J.S.)
International Nuclear Information System (INIS)
Halverson, T.G.
1977-01-01
The design and operation of the two radioactive gas processing systems at the Fast Flux Test Facility (FFTF) exemplifies the concept that will be used in the first generation of Liquid Metal Fast Breeder Reactors (LMFBR's). The two systems, the Radioactive Argon Processing System (RAPS) and the Cell Atmosphere Processing System (CAPS), process the argon and nitrogen used in the FFTF for cover gas on liquid metal systems and as inert atmospheres in steel lined cells housing sodium equipment. The RAPS specifically processes the argon cover gas from the reactor coolant system, providing for decontamination and eventual reuse. The CAPS processes radioactive gasses from inerted cells and other liquid metal cover gas systems, providing for decontamination and ultimate discharge to the atmosphere. The cryogenic processing of waste gas by both systems is described
International Nuclear Information System (INIS)
1999-01-01
The General Auditor in the Netherlands studied the natural gas policy in the Netherlands, as has been executed in the past decades, in the period 1997-1999. The purpose of the study is to inform the Dutch parliament on the planning and the backgrounds of the natural gas policy and on the policy risks with respect to the benefits for the Dutch State, taking into account the developments in the policy environment. The final conclusion is that the proposed liberalization of the national natural gas market will result in a considerable deprivation of income for the State in case the benefit policy is not adjusted. This report includes a reaction of the Dutch Minister of Economic Affairs and an afterword of the General Auditor. In the appendix an outline is given of the natural gas policy
A blow-in windowless gas target
International Nuclear Information System (INIS)
Sagara, K.; Motoshima, A.; Fujita, T.; Akiyoshi, H.; Nishimori, N.
1996-01-01
A new-type windowless gas target has been developed to realize a dense target with a low gas flow rate. The target is similar to the conventional differentially pumped windowless gas target except that the target gas is blown into the target region from both the side holes of the beam entrance and exit. Due to the gas-confining action caused by the blown-in gas, the target thickness is about twice increased and the target density sharply falls in the holes. Most of the target gas is at rest and the density is uniform. The gas flow rate is the same as that of the conventional target and is about an order of magnitude lower than that of the dense gas-jet target. (orig.)
International Nuclear Information System (INIS)
Anon.
1999-01-01
The experts of energy policy agree to predict a brilliant future for natural gas. Among fossil energies, natural gas produces the least quantity of CO 2 . Geological reserves are estimated to 65 years for gas and 43 years for petroleum. Throughout the world, industrial infrastructures of gas production, transport and distribution are being developed, for instance 430000 km of gas pipeline are planned. In western Europe half the increase of gas demand by 2010 will be due to electricity production. Innovative techniques using natural gas are studied in various fields: cogeneration, transport, urban heating and fuel cells. The gas-fed fuel cell is based on a reversed electrolysis: hydrogen produced by the decomposition of natural gas interacts with oxygen and yields electricity. (A.C.)
Gas tagging system development in Japan
International Nuclear Information System (INIS)
Sekiguchi, N.; Rindo, H.; Akiyama, T.; Miyazawa, T.; Heki, H.
1981-05-01
The Gas tagging method has been considered to be most desirable for a failed fuel location system for the fast breeder reactor, regarding the component reduction in the reactor vessel and rapid location during reactor operation. The gas tagging system has been designed by referring to R and D results obtained in Japan and other countries. The designed system is comprised of tag gas filling pins, cover gas sampling system, tag gas recovery and enrichment system, tag gas analyzer and system control and data handling computers. The main specifications for this system have been decided as follows; 1) Main function is location of failed fuels in core and a part of blanket region, 2) Identification capability is each subassembly, 3) Time for identification is within a few days, 4) Continuous operation with automatic start at fuel failure, 5) Detection sensitivity must cover both gas leak and pin burst. In designing the gas tagging system, the following R and D items were selected; 1) System design study, 2) Tag gas capsule development, 3) Modeling the tag gas behavior in reactor primary cooling system, 4) Tag gas recovery and enrichment system, 5) Computer code development for tag gas isotope ratio change estimation. Details of the Japanese gas tagging system development appear in this paper. (author)
Laboratory Connections--Gas Monitoring Transducers Part III: Combustible Gas Sensors.
Powers, Michael H.; Dahman, Doug
1989-01-01
Describes an interface that uses semiconductor metal oxides to detect low gas concentrations. Notes the detector has long life, high stability, good reproducibility, low cost, and is able to convert the gas concentration to an electrical signal with a simple circuit. Theory, schematic, and applications are provided. (MVL)
Energy Technology Data Exchange (ETDEWEB)
Anon,
1985-09-12
The content of a flexible rectangular septic tank is stirred under the pressure produced by the gas generated by the rotting mass by means of integrated gas and stirring bellows. Their volume is indirectly connected via a gas pipe with the volume of the container, so that the gas formed in the septic tank can reach the bellows via this pipe and can expand this, which causes mixing and at the same time the rotting liquid exerts a pressure on the gas in the bellows. In this way, one can provide gas constantly under pressure. The formation of sinking and floating layers is prevented.
Market prospective of natural gas 2010-2025; Prospectiva del mercado de gas natural 2010-2025
Energy Technology Data Exchange (ETDEWEB)
Diaz Bautista, Alejandro; Doniz Gonzalez, Virginia; Navarrete Barbosa, Juan Ignacio [Secretaria de Energia, Mexico, D.F. (Mexico)
2010-07-01
The Ministry of Energy, in compliance to Article 109 of the Natural Gas Regulations, publishes the Prospective natural gas market 2010-2025, which contains the most current information about the historical evolution and growth prospects of the domestic market country's natural gas and its role in the international context. This foresight is attached to the lines of action established in the National Energy Strategy, ratified by Congress in April 2010 in regard to strengthening the transportation infrastructure of natural gas, in order to ensure the supply of this fuel, therefore remains congruence with the instruments of power sector planning. The first one concerns the international panorama of natural gas in the different producing and consuming regions around the world. Chapter two provides a current perspective of those actions in the sector within the regulatory framework for natural gas in Mexico. The third chapter details the issues that occurred in the natural gas market during the period 1999-2009 and the fourth chapter discusses the expected evolution of demand and domestic supply of natural gas by 2025. [Spanish] La Secretaria de Energia, en el cumplimiento al Articulo 109 del Reglamento de Gas Natural, publica la Prospectiva del mercado de gas natural 2010-2025, la cual contiene la informacion mas actualizada acerca de la evolucion historica y las expectativas de crecimiento del mercado interno de gas natural del pais y su papel en el contexto internacional. Esta Prospectiva se apega a las lineas de accion establecidas en la Estrategia Nacional de Energia, ratificada por el Congreso en abril de 2010, en lo relativo a fortalecer la infraestructura de transporte de gas natural, con el fin de asegurar el suministro de este combustible, por lo cual se mantiene congruencia con los instrumentos de planeacion del sector energetico. La Prospectiva esta integrada por cuatro capitulos. El primero se refiere al panorama internacional del gas natural en las
International Nuclear Information System (INIS)
Ferrari, A.
2004-01-01
The first meeting of the French gas association (AFG) of the year 2004 was devoted to the Italian gas market. Two experts of this market were invited: A. Ferrari, general director of the Italian gas and electricity regulation authority, and D. Dispenza, vice-general director of Eni Division Gas and Power. This conference was the occasion to compare the French and Italian gas industries. France and Italy have a border in common and also a series of common structural characteristics: the dependence with respect to foreign supplies, the position of the public company, the sensitiveness with respect to the security of supplies, to the role of storage and to the public utility. The French and Italian decisions are inter-dependent. The liberalization taking place with an unpredictable rate, it is necessary for the gas industry to anticipate its effects. When the political, legal and regulatory decisions are enforced, the initiative comes back to the hands of the industry. In this context, the trend of the transfrontier industries becomes particularly important for the regulatory authority. (J.S.)
Retained gas inventory comparison
International Nuclear Information System (INIS)
BARTON, W.B.
1999-01-01
Gas volume data derived from four different analytical methods were collected and analyzed for comparison to volumes originally used in the technical basis for the Basis for Interim Operations (BIO). The original volumes came from Hodgson (1996) listed in the reference section of this document. Hodgson (1996) screened all 177 single and double-shell tanks for the presence of trapped gas in waste via two analytical methods: Surface Level Rise (SLR), and Barometric Pressure Effect (BPE). More recent gas volume projections have been calculated using different analytical techniques along with updates to the parameters used as input to the SLR and BPE models. Gas volumes derived from new analytical instruments include those as measured by the Void Fraction Instrument (VFI) and Retained Gas Sampler (RGS). The results of this comparison demonstrate that the original retained gas volumes of Hodgson (1996) used as a technical basis in developing the BIO were conservative, and were conservative from a safety analysis standpoint. These results represent only comparisons to the original reported volumes using the limited set of newly acquired data that is available
Landfill gas from environment to energy
International Nuclear Information System (INIS)
Gendebien, A.; Pauwels, M.; Constant, M.; Ledrut-Damanet, M.J.; Nyns, E.J.; Fabry, R.; Ferrero, G.L.; Willumsen, H.C.; Butson, J.
1992-01-01
Landfill gas is an alternative source of energy which can be commercially exploited wherever municipal solid wastes are disposed of in sanitary landfills. In this context, it was decided to launch a comprehensive study on the subject of energy valorization of landfill gas. The main topics dealt with in the study, which is supported by a comprehensive literature survey and six detailed case-studies, include; (i) the environmental impact of landfill gas, (ii) the process of landfill gas genesis and the technology of landfill gas control by its exploitation, (iii) the monitoring of landfill gas emissions, (iv) the policies and legal aspects of landfill gas in the European Community and in the world, (v) the estimation of landfill gas potentials and economics of landfill gas control and exploitation, (vi) the status of landfill gas exploitation in the European Community and in the world. (authors). refs., figs., tabs
Are tight gas resources overstated?
Energy Technology Data Exchange (ETDEWEB)
Roche, P.
2004-11-01
According to conventional wisdom, North America's tight gas resources are continuous, regional accumulations of water-free methane, trapped in low-permeability rock, and involving very little exploration risk. Backing up conventional wisdom, EnCana Corporation is investing heavily in technology-intensive and capital-intensive tight gas plays in Western Canada and the Rocky Mountain regions of the United States. On the other hand, a recent study in the Greater Green River Basin of southwestern Wyoming says that tight gas resources have been significantly overestimated, by as much as three to five times too high, and the risks of exploration are every bit as high as those for conventional exploration. This study essentially dismisses the whole idea of tight gas, or basin-centred gas as a myth, the authors being firmly convinced that tight gas formations should be viewed as conventional hydrocarbon systems, with the usual risks of exploration. This paper discusses the controversy created by this recent study and the implications for natural gas reserves on a basin and individual company level, and the risks associated with exploration. The views of EnCana Corporation, being the company most heavily involved in tight gas and coalbed methane, and those of John Masters, co-founder of Canadian Hunter Exploration Ltd., and discoverer of the blockbuster Elsmworth tight gas deposit in northeastern Alberta in the mid-1970s, are explained in considerable detail, in an effort to dismiss the doubters. EnCana officials and Masters argue that the points raised by the authors of the Greater Green River study do not hold water: Tight gas or basin gas is a distinct hydrocarbon formation, characterized by low permeability, therefore it is to be expected that the gas will take longer to come out of the ground. Neither is the role of water in basin-centred gas systems the major problem as claimed by the doubters. They also characterize it as imprudent to claim to know what the
Mulchaey, John
Most galaxy formation models predict that massive low-redshift disk galaxies are embedded in extended hot halos of externally accreted gas. Such gas appears necessary to maintain ongoing star formation in isolated spirals like the Milky Way. To explain the large population of red galaxies in rich groups and clusters, most galaxy evolution models assume that these hot gas halos are stripped completely when a galaxy enters a denser environment. This simple model has been remarkably successful at reproducing many observed properties of galaxies. Although theoretical arguments suggest hot gas halos are an important component in galaxies, we know very little about this gas from an observational standpoint. In fact, previous observations have failed to detect soft X-ray emission from such halos in disk galaxies. Furthermore, the assumption that hot gas halos are stripped completely when a galaxy enters a group or cluster has not been verified. We propose to combine proprietary and archival XMM-Newton observations of galaxies in the field, groups and clusters to study how hot gas halos are impacted by environment. Our proposed program has three components: 1) The deepest search to date for a hot gas halo in a quiescent spiral galaxy. A detection will confirm a basic tenet of disk galaxy formation models, whereas a non-detection will seriously challenge these models and impose new constraints on the growth mode and feedback history of disk galaxies. 2) A detailed study of the hot gas halos properties of field early-type galaxies. As environmental processes such as stripping are not expected to be important in the field, a study of hot gas halos in this environment will allow us to better understand how feedback and other internal processes impact hot gas halos. 3) A study of hot gas halos in the outskirts of groups and clusters. By comparing observations with our suite of simulations we can begin to understand what role the stripping of hot gas halos plays in galaxy
International Nuclear Information System (INIS)
Jenner, Steffen; Lamadrid, Alberto J.
2013-01-01
The aim of this paper is to examine the major environmental impacts of shale gas, conventional gas and coal on air, water, and land in the United States. These factors decisively affect the quality of life (public health and safety) as well as local and global environmental protection. Comparing various lifecycle assessments, this paper will suggest that a shift from coal to shale gas would benefit public health, the safety of workers, local environmental protection, water consumption, and the land surface. Most likely, shale gas also comes with a smaller GHG footprint than coal. However, shale gas extraction can affect water safety. This paper also discusses related aspects that exemplify how shale gas can be more beneficial in the short and long term. First, there are technical solutions readily available to fix the most crucial problems of shale gas extraction, such as methane leakages and other geo-hazards. Second, shale gas is best equipped to smoothen the transition to an age of renewable energy. Finally, this paper will recommend hybrid policy regulations. - Highlights: ► We examine the impacts of (un)conventional gas and coal on air, water, and land. ► A shift from coal to shale gas would benefit public health. ► Shale gas extraction can affect water safety. ► We discuss technical solutions to fix the most crucial problems of shale gas extraction. ► We recommend hybrid regulations.
Natural gas monthly, August 1995
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-08-24
The Natural Gas Monthly (NGM) highlights activities, events, and analyses of interest to public and private sector organizations associated with the natural gas industry. Volume and price data are presented each month for natural gas production, distribution, consumption, and interstate pipeline activities. Producer-related activities and underground storage data are also reported. From time to time, the NGM features articles designed to assist readers in using and interpreting natural gas information. This month`s feature article is on US Natural Gas Imports and Exports 1994.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-05-01
The Natural Gas Monthly highlights activities, events, and analyses of interest to public and private sector organizations associated with the natural gas industry. Volume and price data are presented each month for natural gas production, distribution, consumption, and interstate pipeline activities. Producer-related activities and underground storage data are also reported. From time to time, the NGM features articles designed to assist readers in using and interpreting natural gas information. The feature article this month is ``Restructuring energy industries: Lessons from natural gas.`` 6 figs., 26 tabs.
Gas independence in France in 2050. A 100% renewable gas mix in 2050? Study summary
International Nuclear Information System (INIS)
Chapelon, Guillain; Rabetsimamanga, Ony; Bosso, Valerie; Frederic, Sylvain; Leboul-Proust, Catherine; Legrand, Stephanie; Monin, William; Singly, Bertrand de; Combet, Emmanuel; Marchal, David; Meunier, Laurent; Varet, Anne; Vincent, Isabelle; Antoine, Loic; Bardinal, Marc; Bastide, Guillaume; Bodineau, Luc; Canal, David; El Khamlichi, Aicha; Gagnepain, Bruno; Mainsant, Arnaud; Parrouffe, Jean-Michel; Pouet, Jean-Christophe; Theobald, Olivier; Vidalenc, Eric; Thomas, Alban; Madiec, Philippe; Meradi, Sabra; Boure, Quentin; Cherrey, Marc; Coupe, Florian; Couturier, Christian; Metivier, Simon; Chiche, Alice
2018-01-01
ADEME contributes to the discussions on France's proactive strategy, notably by examining possible trajectories for the French energies of the future and has been publishing energy-climate scenarios on a regular basis since 2013. This study, 'A 100% renewable gas mix in 2050?', conducted by ADEME in collaboration with GRDF and GRTgaz, follows on from the works published in 2016 - 2017, and concerns the second most consumed energy in France, gas. Herein, ADEME explores the conditions of the technical and economic feasibility of a gas system in 2050 based on 100% renewable gas. The work is based on ADEME's 2035-2050 energy scenario, with a level of final demand for gas in 2050 of around 300 TWh, compared with today's figure of 460 TWh. The results, based on sensitivity analyses and various renewable gas production mix scenarios, reveal that there is a theoretical potential source of renewable gas that could fulfil this lower demand for energy in 2050 at an overall cost of gas between euros 116 and euros 153/MWh. It would involve making some modifications to the gas system and notably development of the complementarity between the gas network and the electric grid. This confirms that to improve the sustainability of our energy system, we must strengthen the interactions between the energy vectors and optimise their synergies, at various territorial scales
DEFF Research Database (Denmark)
Haglind, Fredrik
2010-01-01
The part-load performance of gas and steam turbine combined cycles intended for naval use is of great importance, and it is influenced by the gas turbine configuration and load control strategy. This paper is aimed at quantifying the effects of variable geometry on the gas turbine part...... of various components within gas turbines. Two different gas turbine configurations are studied, a two-shaft aero-derivative configuration and a single-shaft industrial configuration. When both gas turbine configurations are running in part-load using fuel flow control, the results indicate better part......-load performance for the two-shaft gas turbine. Reducing the load this way is accompanied by a much larger decrease in exhaust gas temperature for the single-shaft gas turbine than for the two-shaft configuration. As used here, the results suggest that variable geometry generally deteriorates the gas turbine part...
Market fundamentals, competition and natural-gas prices
International Nuclear Information System (INIS)
Hulshof, Daan; Maat, Jan-Pieter van der; Mulder, Machiel
2016-01-01
After the liberalisation of the gas industry, trading hubs have emerged in Europe. Although these hubs appear to be liquid market places fostering gas-to-gas competition, the efficiency of the gas market remains a topic of interest as a fair share of gas is still traded through long-term contracts with prices linked to the oil price while the number of gas suppliers to the European market is limited. In order to assess the efficiency of the gas market, we analyse the day-ahead spot price at the Dutch gas hub over the period 2011–2014. We find that the oil price had a small positive impact on the gas price. Changes in the concentration on the supply side did not affect the movement in gas prices. The availability of gas in storages and the outside temperature negatively influenced the gas price. We also find that the gas price was related to the production of wind electricity. Overall, we conclude that the day-ahead gas prices are predominantly determined by gas-market fundamentals. Policies to further integrate gas markets within Europe may extend this gas-to-gas competition to a larger region. - Highlights: •We analyse the development of the day-ahead spot price at TTF over 2011–2014. •The oil price had a small impact on the gas price, while the coal price had no effect. •Changes in the concentration on the supply side did not affect the gas prices. •The gas prices are predominantly determined by weather and storage availability. •Policies to integrate gas markets foster gas-to-gas competition.
Peter, Tilo; Polonskyi, Oleksandr; Gojdka, Björn; Mohammad Ahadi, Amir; Strunskus, Thomas; Zaporojtchenko, Vladimir; Biederman, Hynek; Faupel, Franz
2012-12-01
We quantitatively assessed the influence of reactive gases on the formation processes of transition metal clusters in a gas aggregation cluster source. A cluster source based on a 2 in. magnetron is used to study the production rate of titanium and cobalt clusters. Argon served as working gas for the DC magnetron discharge, and a small amount of reactive gas (oxygen and nitrogen) is added to promote reactive cluster formation. We found that the cluster production rate depends strongly on the reactive gas concentration for very small amounts of reactive gas (less than 0.1% of total working gas), and no cluster formation takes place in the absence of reactive species. The influence of discharge power, reactive gas concentration, and working gas pressure are investigated using a quartz micro balance in a time resolved manner. The strong influence of reactive gas is explained by a more efficient formation of nucleation seeds for metal-oxide or nitride than for pure metal.
Laser-induced gas plasma machining
Energy Technology Data Exchange (ETDEWEB)
Elhadj, Selim; Bass, Isaac Louis; Guss, Gabriel Mark; Matthews, Manyalibo J.
2017-10-17
Techniques for removing material from a substrate are provided. A laser beam is focused at a distance from the surface to be treated. A gas is provided at the focus point. The gas is dissociated using the laser energy to generate gas plasma. The substrate is then brought in contact with the gas plasma to enable material removal.
Gas-rise velocities during kicks
Energy Technology Data Exchange (ETDEWEB)
White, D.B. (Sedco Forex (FR))
1991-12-01
This paper reports on experiments to examine gas migration rates in drilling muds that were performed in a 15-m-long, 200-mm-ID inclinable flow loop where air injection simulates gas entry during a kick. These tests were conducted using a xanthum gum (a common polymer used in drilling fluids) solution to simulate drilling muds as the liquid phase and air as the gas phase. This work represents a significant extension of existing correlations for gas/liquid flows in large pipe diameters with non- Newtonian fluids. Bubbles rise faster in drilling muds than in water despite the increased viscosity. This surprising result is caused by the change in the flow regime, with large slug-type bubbles forming at lower void fractions. The gas velocity is independent of void fraction, thus simplifying flow modeling. Results show that a gas influx will rise faster in a well than previously believed. This has major implications for kick simulation, with gas arriving at the surface earlier than would be expected and the gas outflow rate being higher than would have been predicted. A model of the two-phase gas flow in drilling mud, including the results of this work, has been incorporated into the joint Schlumberger Cambridge Research (SCR)/BP Intl. kick model.
Radioactive krypton gas separation
International Nuclear Information System (INIS)
Martin, J.R.
1976-01-01
Radioactive krypton is separated from a gas mixture comprising nitrogen and traces of carbon dioxide and radioactive krypton by selective adsorption and then cryogenic distillation of the prepurified gas against nitrogen liquid to produce krypton bottoms concentrate liquid, using the nitrogen gas from the distillation for two step purging of the adsorbent. 16 Claims, 8 Drawing Figures
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-07-01
This preliminary report analyses the desirable evolutions of gas transport tariffing and examines some questions relative to the opening of competition on the French gas market. The report is made of two documents: a synthesis of the previous report with some recommendations about the tariffing of gas transport, about the modalities of network access to third parties, and about the dissociation between transport and trade book-keeping activities. The second document is the progress report about the opening of the French gas market. The first part presents the European problem of competition in the gas supply and its consequences on the opening and operation of the French gas market. The second part presents some partial syntheses about each topic of the mission letter of the Ministry of Economics, Finances and Industry: future evolution of network access tariffs, critical analysis of contractual documents for gas transport and delivery, examination of auxiliary services linked with the access to the network (modulation, balancing, conversion), consideration about the processing of network congestions and denied accesses, analysis of the metering dissociation between the integrated activities of gas operators. Some documents are attached in appendixes: the mission letter from July 9, 2001, the detailed analysis of the new temporary tariffs of GdF and CFM, the offer of methane terminals access to third parties, the compatibility of a nodal tariffing with the presence of three transport operators (GdF, CFM and GSO), the contract-type for GdF supply, and the contract-type for GdF connection. (J.S.)
International Nuclear Information System (INIS)
Heidari, Hassan; Katircioglu, Salih Turan; Saeidpour, Lesyan
2013-01-01
This paper examines the relationship between natural gas consumption and economic growth in Iran within a multivariate production model. We also investigate the effects of natural gas price on its consumption and economic growth using a demand side model. The paper employs bounds test approach to level relationship over the period of 1972–007. We find evidence of bidirectional positive relationship between natural gas consumption and economic growth in short-run and long-run, based on the production model. The findings also suggest that real GDP growth and natural gas have positive and negative impacts on gross fixed capital formation, respectively. Employment, however, was found to have negative but insignificant impact on gross fixed capital formation. Moreover, the estimation results of demand side model suggest that natural gas price has negative and significant impact on natural gas consumption only in the long-run, though there is insignificant impact on economic growth. These results imply that the Iranian government's decision for natural gas price liberalization has the adverse effects on economic growth and policy makers should be cautious in doing this policy. - Highlights: • Iran has been considered as a major natural gas producer in the world. • This paper examines the relationship between gas consumption and growth in Iran. • Positive impact of gas consumption on growth has been obtained. • The paper finds that gas consumption and income reinforce each other in Iran. • Natural gas price has also negative and significant impact on natural gas consumption in Iran
International Nuclear Information System (INIS)
Dorogan, V.; Korotchenkov, Gh.; Vieru, T.; Prodan, I.
2003-01-01
The invention relates to the gas sensors on base of metal-oxide films (SnO, InO), which may be used for enviromental control, in the fireextinguishing systema etc. The gas includes an insulating substrate, an active layer, a resistive layer with ohmic contacts. The resistive layer has two or more regions with dofferent resistances , and on the active layer are two or more pairs of ohmic contacts
High potential recovery -- Gas repressurization
Energy Technology Data Exchange (ETDEWEB)
Madden, M.P.
1998-05-01
The objective of this project was to demonstrate that small independent oil producers can use existing gas injection technologies, scaled to their operations, to repressurize petroleum reservoirs and increase their economic oil production. This report gives background information for gas repressurization technologies, the results of workshops held to inform small independent producers about gas repressurization, and the results of four gas repressurization field demonstration projects. Much of the material in this report is based on annual reports (BDM-Oklahoma 1995, BDM-Oklahoma 1996, BDM-Oklahoma 1997), a report describing the results of the workshops (Olsen 1995), and the four final reports for the field demonstration projects which are reproduced in the Appendix. This project was designed to demonstrate that repressurization of reservoirs with gas (natural gas, enriched gas, nitrogen, flue gas, or air) can be used by small independent operators in selected reservoirs to increase production and/or decrease premature abandonment of the resource. The project excluded carbon dioxide because of other DOE-sponsored projects that address carbon dioxide processes directly. Two of the demonstration projects, one using flue gas and the other involving natural gas from a deeper coal zone, were both technical and economic successes. The two major lessons learned from the projects are the importance of (1) adequate infrastructure (piping, wells, compressors, etc.) and (2) adequate planning including testing compatibility between injected gases and fluids, and reservoir gases, fluids, and rocks.
Low-Cost Resonant Cavity Raman Gas Probe for Multi-Gas Detection
Thorstensen, J.; Haugholt, K. H.; Ferber, A.; Bakke, K. A. H.; Tschudi, J.
2014-12-01
Raman based gas sensing can be attractive in several industrial applications, due to its multi-gas sensing capabilities and its ability to detect O_2 and N_2. In this article, we have built a Raman gas probe, based on low-cost components, which has shown an estimated detection limit of 0.5 % for 30 second measurements of N_2 and O_2. While this detection limit is higher than that of commercially available equipment, our estimated component cost is approximately one tenth of the price of commercially available equipment. The use of a resonant Fabry-Pérot cavity increases the scattered signal, and hence the sensitivity, by a factor of 50. The cavity is kept in resonance using a piezo-actuated mirror and a photodiode in a feedback loop. The system described in this article was made with minimum-cost components to demonstrate the low-cost principle. However, it is possible to decrease the detection limit using a higher-powered (but still low-cost) laser and improving the collection optics. By applying these improvements, the detection limit and estimated measurement precision will be sufficient for e.g. the monitoring of input gases in combustion processes, such as e.g. (bio-)gas power plants. In these processes, knowledge about gas compositions with 0.1 % (absolute) precision can help regulate and optimize process conditions. The system has the potential to provide a low-cost, industrial Raman sensor that is optimized for specific gas-detection applications.
International Nuclear Information System (INIS)
Lagrasta, F.; Kaminski, V.; Prevatt, R.
1999-01-01
This chapter presents a brief history of the natural gas market highlighting the changes in the gas market and examining risk management in practice detailing the types of price risks, and the use of hedging using forwards and swaps. Options to manage risk are identified, and the role of risk management in financing, the role of the intermediary, and the market outlook are discussed. Panels describing the market structure, storage and natural gas risk management, the art of risk management, the winter 1995-96 basis blowout, spark spreads, the UK gas market and Europe, and weather derivatives are presented
Recent trends in Belgium's gas activities
International Nuclear Information System (INIS)
Cuijpers, Ch.; Woitrin, D.
2010-01-01
This article brings various recent trends together to provide a view of the natural gas activities in Belgium. Belgium has a strategic position as an important nodal point in the North-Western European gas grids. This is illustrated by the high interconnection rate with adjacent networks. Gas volumes are attracted for international transit from border point to border point and to supply the national market. Natural gas represents more than a quarter of Belgium's energy mix and is completely dependent on foreign gas supplies. The Belgian gas market and transmission grid are broken down for H-gas (high calorific value, average of 11,630 kWh/m 3 (n)) and for L-gas (low calorific value, average of 9,769 kWh/m 3 (n)). This article is intended to disclose some statistics in order to contribute to the understanding and benchmarking of Belgium's gas flows, gas consumption, supply diversification and import capacity. (authors)
Natural Gas Multi-Year Program Plan
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-01
This document comprises the Department of Energy (DOE) Natural Gas Multi-Year Program Plan, and is a follow-up to the `Natural Gas Strategic Plan and Program Crosscut Plans,` dated July 1995. DOE`s natural gas programs are aimed at simultaneously meeting our national energy needs, reducing oil imports, protecting our environment, and improving our economy. The Natural Gas Multi-Year Program Plan represents a Department-wide effort on expanded development and use of natural gas and defines Federal government and US industry roles in partnering to accomplish defined strategic goals. The four overarching goals of the Natural Gas Program are to: (1) foster development of advanced natural gas technologies, (2) encourage adoption of advanced natural gas technologies in new and existing markets, (3) support removal of policy impediments to natural gas use in new and existing markets, and (4) foster technologies and policies to maximize environmental benefits of natural gas use.
Secondary biogenic coal seam gas reservoirs in New Zealand: A preliminary assessment of gas contents
Energy Technology Data Exchange (ETDEWEB)
Butland, Carol I. [Department of Geological Sciences, University of Canterbury, Private Bag 4800, Christchurch (New Zealand); Moore, Tim A. [Department of Geological Sciences, University of Canterbury, Private Bag 4800, Christchurch (New Zealand); Solid Energy NZ Ltd., P.O. Box 1303, Christchurch (New Zealand)
2008-10-02
Four coal cores, one from the Huntly (Eocene), two from the Ohai (Cretaceous) and one from the Greymouth (Cretaceous) coalfields, were sampled and analysed in terms of gas content and coal properties. The coals vary in rank from subbituminous B-A (Huntly) to subbituminous C-A (Ohai), and high volatile A bituminous (Greymouth). Average gas contents were 1.60 m{sup 3}/t (s 0.2) in the Huntly core, 4.80 m{sup 3}/t (s = 0.8) in the Ohai cores, and 2.39 m{sup 3}/t (s = 0.8) in the Greymouth core. The Ohai core not only contained more gas but also had the highest saturation (75%) compared with the Huntly (33%) and Greymouth (45%) cores. Carbon isotopes indicate that the Ohai gas is more mature, containing higher {delta}{sup 13}C isotopes values than either the Huntly or Greymouth gas samples. This may indicate that the gas was derived from a mixed biogenic and thermogenic source. The Huntly and Greymouth gases appear to be derived solely from a secondary biogenic (by CO{sub 2} reduction) source. Although the data set is limited, preliminary analysis indicates that ash yield is the dominant control on gas volume in all samples where the ash yield was above 10%. Below 10%, the amount of gas variation is unrelated to ash yield. Although organic content has some influence on gas volume, associations are basin and/or rank dependent. In the Huntly core total gas content and structured vitrinite increase together. Although this relationship does not appear for the other core data for the Ohai SC3 core, lost gas and fusinite are associated whereas gelovitrinite (unstructured vitrinite) correlates positively with residual gas for the Greymouth data. (author)
Understanding vented gas explosions
Energy Technology Data Exchange (ETDEWEB)
Lautkaski, R. [VTT Energy, Espoo (Finland). Energy Systems
1997-12-31
The report is an introduction to vented gas explosions for nonspecialists, particularly designers of plants for flammable gases and liquids. The phenomena leading to pressure generation in vented gas explosions in empty and congested rooms are reviewed. The four peak model of vented gas explosions is presented with simple methods to predict the values of the individual peaks. Experimental data on the external explosion of dust and gas explosions is discussed. The empirical equation relating the internal and external peak pressures in vented dust explosions is shown to be valid for gas explosion tests in 30 m{sup 3} and 550 m{sup 3} chambers. However, the difficulty of predicting the internal peak pressure in large chambers remains. Methods of explosion relief panel design and principles of vent and equipment layout to reduce explosion overpressures are reviewed. (orig.) 65 refs.
Bravo, Jose Luis [Houston, TX; Harvey, III, Albert Destrehan; Vinegar, Harold J [Bellaire, TX
2012-04-03
Systems and methods of treating a gas stream are described. A method of treating a gas stream includes cryogenically separating a first gas stream to form a second gas stream and a third stream. The third stream is cryogenically contacted with a carbon dioxide stream to form a fourth and fifth stream. A majority of the second gas stream includes methane and/or molecular hydrogen. A majority of the third stream includes one or more carbon oxides, hydrocarbons having a carbon number of at least 2, one or more sulfur compounds, or mixtures thereof. A majority of the fourth stream includes one or more of the carbon oxides and hydrocarbons having a carbon number of at least 2. A majority of the fifth stream includes hydrocarbons having a carbon number of at least 3 and one or more of the sulfur compounds.
Energy Technology Data Exchange (ETDEWEB)
Freestone, N P; Phillips, P S; Hall, R [Nene College of Higher Education, Northampton (United Kingdom)
1994-01-01
Millions of visitors to the 1985 International Garden Festival in Liverpool were probably unaware that the landscape gardens they had come to enjoy were on top of approximately 10m t of domestic rubbish. Nor were they aware that this rubbish was generating a methane-rich gas that had necessitated installing a special extraction system to remove it from the site. At first this gas - landfill gas - was simply flared (burnt), but once it was realised that extraction would be need for at least 15 years it was decided to use the gas to generate electricity. This development is a good example of the potential, especially in the developed world, for using landfill gas produced in refuse tips as an additional and versatile energy source. This potential is analysed and the problems of exploitation examined. (2 figures). (author)
Understanding vented gas explosions
Energy Technology Data Exchange (ETDEWEB)
Lautkaski, R [VTT Energy, Espoo (Finland). Energy Systems
1998-12-31
The report is an introduction to vented gas explosions for nonspecialists, particularly designers of plants for flammable gases and liquids. The phenomena leading to pressure generation in vented gas explosions in empty and congested rooms are reviewed. The four peak model of vented gas explosions is presented with simple methods to predict the values of the individual peaks. Experimental data on the external explosion of dust and gas explosions is discussed. The empirical equation relating the internal and external peak pressures in vented dust explosions is shown to be valid for gas explosion tests in 30 m{sup 3} and 550 m{sup 3} chambers. However, the difficulty of predicting the internal peak pressure in large chambers remains. Methods of explosion relief panel design and principles of vent and equipment layout to reduce explosion overpressures are reviewed. (orig.) 65 refs.
Gundersen, Pål Lee
2013-01-01
Master's thesis in Petroleum engineering Gas condensate flow behaviour below the dew point in low permeable formations can make accurate fluid sampling a difficult challenge. The objective of this study was to investigate the producing oil-gas ratio behaviour in the infinite-acting period for a low permeable gas condensate reservoir. Compositional isothermal flow simulations were performed using a single-layer, radial and two-dimensional, gas condensate reservoir model with low permeabili...
Bosteels, Michel; Haider, S
2001-01-01
Both LHCb RICH will be operated with fluorocarbon as gas radiator. RICH 1 will be filled with 4m^3 of C4F10 and RICH 2 with 100m^3 of CF4. The gas systems will run as a closed loop circulation and a gas recovery system within the closed loop is planned for RICH 1, where the recovery of the CF4 will only be realised during filling and emptying of the detector. Inline gas purification is foreseen for the gas systems in order to limit water and oxygen impurities.
Canadian gas - where's it headed?
International Nuclear Information System (INIS)
Dominy, D.
1998-01-01
The evolution of gas transportation in Canada was described. The issue of what is needed and what can change in the current North American market for gas transportation was also discussed. The transportation values of natural gas from the Western Canadian Sedimentary Basin (WCSB) to New York, Chicago and California for 1993 to 1997 were reviewed. Export and domestic capacity additions and WCSB gas completions were also outlined. The question of how much new capacity is needed, where the gas will come from, and where will it go, was also discussed
Natural gas monthly, June 1994
Energy Technology Data Exchange (ETDEWEB)
1994-06-01
The Natural Gas Monthly (NGM) highlights activities, events, and analyses of interest to public and private sector organizations associated with the natural gas industry. Volume and price data are presented each month for natural gas production, distribution, consumption, and interstate pipeline activities. Producer-related activities and underground storage data are also reported. From time to time, the NGM features articles designed to assist readers in using and interpreting natural gas information. The feature article this month is the executive summary from Natural Gas 1994: Issues and Trends. 6 figs., 31 tabs.
Future forecast for life-cycle greenhouse gas emissions of LNG and city gas 13A
International Nuclear Information System (INIS)
Okamura, Tomohito; Furukawa, Michinobu; Ishitani, Hisashi
2007-01-01
The objective of this paper is to analyze the most up-to-date data available on total greenhouse-gas emissions of a LNG fuel supply chain and life-cycle of city gas 13A based on surveys of the LNG projects delivering to Japan, which should provide useful basic-data for conducting life-cycle analyses of other product systems as well as future alternative energy systems, because of highly reliable data qualified in terms of its source and representativeness. In addition, the life-cycle greenhouse-gas emissions of LNG and city-gas 13A in 2010 were also predicted, taking into account not only the improvement of technologies, but also the change of composition of LNG projects. As a result of this analysis, the total amount of greenhouse-gas emissions of the whole city-gas 13A chain at present was calculated to be 61.91 g-CO 2 /MJ, and the life-cycle greenhouse-gas emissions of LNG and city-gas 13A in 2010 could be expected to decrease by about 1.1% of the current emissions
Policy subjects of the LP gas industry; LP gas sangyo no seisaku kadai
Energy Technology Data Exchange (ETDEWEB)
Murata, K. [Agency of Natural Resources and Energy, Tokyo (Japan)
1996-09-01
The paper commented on current environmental changes in the LP gas industry and the measures for reinforcement of the physical constitution. When correction of the high cost structure in Japan is now the problem, waves of deregulation and rationalization reach to not only to LP gas but energy competitive with LP gas such as petroleum, electric power and town gas. With this, it is expected that LP gas will be faced with severe competition with other energy media. In the LP gas industry, business becomes more and more in number and smaller and smaller in scale as it extends downstream. Therefore, the resulting complicatedness in the distribution sector is the problem. It is necessary to realize scale profit in each distribution stage and to heighten productivity by expanding the scale in the retailing stage, especially. It is also important to tackle scale merit, improvement of productivity, and cost reduction by concentrating functions on either of wholesalers or retailers in every function of delivery, safety, free from each distribution stage.
Gas in the former Soviet Union
International Nuclear Information System (INIS)
Anon.
1995-01-01
An in-depth review of the current situation in the Russian gas industry is presented in this document, which is a collaborative publication from the editors of the British journals Petroleum Economist and Gas World International and the Russian gas magazine Gazovaya Promyshlennost. This fourth special annual supplement considers the current and potential impact of the Russian gas industry on European gas markets, and also highlights recent energy-related technology developments. Economic aspects of the Russian gas industry, such as investment and privatisation are addressed as well as technological advances in areas such as gas-powered vehicles and diagnostic systems. The particular role of gas production in the Asian republic is also discussed. (UK)
International Nuclear Information System (INIS)
Wilkinson, P.L.
1992-01-01
This chapter examines the concept of combined-cycle repowering with natural gas as one possible solution to the impending dilemma facing electric utilities - tight capacity margins in the 1990s and the inordinate expense of traditional powerplants. Combined-cycle repowering refers to the production of electricity through the integration of new and used equipment at an existing site, with the final equipment configuration resembling a new gas-fired combined-cycle unit (i.e., gas turbine, waste heat recovery unit and steam turbine/generator). Through the utilization of improved waste heat recovery and gas-fired equipment, repowering provides both additional capacity and increased generating efficiency. Three modes of repowering are considered: (1) peak turbine repowering refers to the addition of a steam turbine and heat recovery unit to an existing gas turbine, with the efficiency improvement allowing the unit to convert from peaking to baseload operation; (2) heat recovery repowering is the replacement of an old coal boiler with a gas turbine and heat recovery unit, leaving the existing steam turbine in place; and (3) boiler repowering, in which the exhaust from a new gas turbine is fed into an existing coal boiler, replacing existing forced-draft fans and air heaters. These three options are compared with the option of adding new coal-fired boilers on the basis of economics, energy efficiency and environmental impacts
Alternative Fuels Data Center: Natural Gas
Natural Gas Printable Version Share this resource Send a link to Alternative Fuels Data Center : Natural Gas to someone by E-mail Share Alternative Fuels Data Center: Natural Gas on Facebook Tweet about Alternative Fuels Data Center: Natural Gas on Twitter Bookmark Alternative Fuels Data Center: Natural Gas on
2014-01-01
This book provides an overview on the particular development steps of gas insulated high-voltage switchgear, and is based on the information given with the editor's tutorial. The theory is kept low only as much as it is needed to understand gas insulated technology, with the main focus of the book being on delivering practical application knowledge. It discusses some introductory and advanced aspects in the meaning of applications. The start of the book presents the theory of Gas Insulated Technology, and outlines reliability, design, safety, grounding and bonding, and factors for choosing GIS. The third chapter presents the technology, covering the following in detail: manufacturing, specification, instrument transformers, Gas Insulated Bus, and the assembly process. Next, the book goes into control and monitoring, which covers local control cabinet, bay controller, control schemes, and digital communication. Testing is explained in the middle of the book before installation and energization. Importantly, ...
International Nuclear Information System (INIS)
Jego, H.
1999-01-01
This short presentation of the Spanish gas industry looks at the industry's different players including Gas Natural, which controls almost all of the gas distribution in Spain. Natural gas, almost all of which is imported, accounts for an ever-growing share in the country's energy balance and has undergone great developments, particularly in industry and in thermal generating plants. (author)
Greenhouse gas and energy analysis of substitute natural gas from biomass for space heat
International Nuclear Information System (INIS)
Pucker, Johanna; Zwart, Robin; Jungmeier, Gerfried
2012-01-01
In this paper, the greenhouse gas and energy balances of the production and use for space heating of substitute natural gas from biomass (bio-SNG) for space heat are analysed. These balances are compared to the use of natural gas and solid biomass as wood chips to provide the same service. The reduction of the greenhouse gas emissions (CO 2 -eq.) – carbon dioxide, methane and nitrous oxide – and of the fossil primary energy use is investigated in a life cycle assessment (LCA). This assessment was performed for nine systems for bio-SNG; three types of gasification technologies (O 2 -blown entrained flow, O 2 -blown circulating fluidised bed and air–steam indirect gasification) with three different types of feedstock (forest residues, miscanthus and short rotation forestry). The greenhouse gas analysis shows that forest residues using the air–steam indirect gasification technology result in the lowest greenhouse gas emissions (in CO 2 -eq. 32 kg MWh −1 of heat output). This combination results in 80% reduction of greenhouse gas emissions when compared to natural gas and a 29% reduction of greenhouse gases if the forest residues were converted to wood chips and combusted. The gasification technologies O 2 -blown entrained flow and O 2 -blown circulating fluidised bed gasification have higher greenhouse gas emissions that range between in CO 2 -eq. 41 to 75 kg MWh −1 of heat output depending on the feedstock. When comparing feedstocks in the bio-SNG systems, miscanthus had the highest greenhouse gas emissions bio-SNG systems producing in CO 2 -eq. 57–75 kg MWh −1 of heat output. Energy analysis shows that the total primary energy use is higher for bio-SNG systems (1.59–2.13 MWh MWh −1 of heat output) than for the reference systems (in 1.37–1.51 MWh MWh −1 of heat output). However, with bio-SNG the fossil primary energy consumption is reduced compared to natural gas. For example, fossil primary energy use is reduced by 92% when air
Energy Technology Data Exchange (ETDEWEB)
Villar, M. V.; Gutierre-Rodrigo, V.; Martin, P. I.; Romero, F. J.; Barcala, J. M.
2013-07-01
The gas permeability of the Spanish FEBEX bentonite compacted at dry densities of between 1.4 and 1.8 g/cm{sup 3} with high water contents was measured for different confining, injection and back pressures. The results were compared with results obtained in previous investigations for lower degrees of saturation. It was checked that gas permeability was greatly affected by dry density, decreasing about three orders of magnitude when it increased from 1.5 to 1.8 g/cm{sup 3} for similar water content. The increase of water content caused also a decrease in gas permeability. It was found that both gas permeability and the relative gas permeability were mainly related to the accessible porosity. These relationships could be fitted to potential expressions with exponents between 3 and 4, as well as the relationship between intrinsic permeability and void ratio. For gas pressures below 1.2 MPa no effect of the injection or confining pressures on the value of permeability was detected. For a given confining pressure the permeability value decreased as the effective pressure increased, especially if the increase in effective pressure was due to a decrease in gas back pressure. It was checked that the Klinkenberg effect was not significant for this material in the range of pressures applied in the tests. The gas breakthrough pressure values in FEBEX saturated bentonite were determined for different dry densities. They increased clearly with dry density and were always higher than the swelling pressure of the bentonite. In high density samples gas flow tended to stop abruptly after breakthrough, whereas in lower density samples gas flow decreased gradually until a given pressure gradient was reached. The permeabilities computed after breakthrough (which usually did not stabilise) were inversely related to dry density. This would indicate that, even if the flow took place predominantly through preferential pathways that sometimes closed quickly after breakthrough and others
International Nuclear Information System (INIS)
Villar, M. V.; Gutierrez-Rodrigo, V.; Martin, P. L.; Romero, F. J.; Barcala, J. M.
2013-01-01
The gas permeability of the Spanish FEBEX bentonite compacted at dry densities of between 1.4 and 1.8 g/cm 3 with high water contents was measured for different confining, injection and back pressures. The results were compared with results obtained in previous investigations for lower degrees of saturation. It was checked that gas permeability was greatly affected by dry density, decreasing about three orders of magnitude when it increased from 1.5 to 1.8 g/cm 3 for similar water content. The increase of water content caused also a decrease in gas permeability. It was found that both gas permeability and the relative gas permeability were mainly related to the accessible porosity. These relationships could be fitted to potential expressions with exponents between 3 and 4, as well as the relationship between intrinsic permeability and void ratio. For gas pressures below 1.2 MPa no effect of the injection or confining pressures on the value of permeability was detected. For a given confining pressure the permeability value decreased as the effective pressure increased, especially if the increase in effective pressure was due to a decrease in gas back pressure. It was checked that the Klinkenberg effect was not significant for this material in the range of pressures applied in the tests. The gas breakthrough pressure values in FEBEX saturated bentonite were determined for different dry densities. They increased clearly with dry density and were always higher than the swelling pressure of the bentonite. In high density samples gas flow tended to stop abruptly after breakthrough, whereas in lower density samples gas flow decreased gradually until a given pressure gradient was reached. The permeabilities computed after breakthrough (which usually did not stabilise) were inversely related to dry density. This would indicate that, even if the flow took place predominantly through preferential pathways that sometimes closed quickly after breakthrough and others remained
Decoupling the Oil and Gas Prices. Natural Gas Pricing in the Post-Financial Crisis Market
International Nuclear Information System (INIS)
Kanai, Miharu
2011-01-01
This paper looks into natural gas pricing in the post-financial crisis market and, in particular, examines the question whether the oil-linked gas pricing system has outlived its utility as global gas markets mature and converge more rapidly than expected and as large new resources of unconventional gas shift the gas terms-of-trade. Two opposing natural gas pricing systems have coexisted for the last two decades. On the one hand, there is traditional oil-linked pricing, used in pipeline gas imports by Continental European countries and in LNG imports by the countries in Far East. The other is the system led by futures exchanges in deregulated, competitive markets largely in the UK and the US. World gas markets are changing and the basis and mechanisms of price formation are changing with them. There is no reason to expect a revolution in gas pricing, but formulas designed to address the challenges of the 1970's will need to adjust to the realities of the present and expectations for the 21. century. Because such changes will imply a redistribution of costs and benefits, vested shareholders will defend the status quo. But hopefully and ultimately, appropriately regulated markets will assert themselves and shareholders along the entire value chain will have their interests served
Natural gas demand prospects in Korea
Energy Technology Data Exchange (ETDEWEB)
Kwon, Young-Jin [Korea Electric Power Corp. (KEPCO), Seoul (Korea, Republic of)
1997-06-01
Korea s natural gas demand has increase enormously since 1986. Natural gas demand in Korea will approach to 29 million tonnes by the year 2010, from little over 9 million tonnes in 1996. This rapid expansion of natural gas demand is largely due to regulations for environmental protection by the government as well as consumers preference to natural gas over other sources of energy. Especially industrial use of gas will expand faster than other use of gas, although it will not be as high as that in European and North America countries. To meet the enormous increase in demand, Korean government and Korea Gas Corporation (KOGAS) are undertaking expansion of capacities of natural gas supply facilities, and are seeking diversification of import sources, including participation in major gas projects, to secure the import sources on more reliable grounds. (Author). 5 tabs.
Natural gas demand prospects in Korea
International Nuclear Information System (INIS)
Young-Jin Kwon
1997-01-01
Korea s natural gas demand has increase enormously since 1986. Natural gas demand in Korea will approach to 29 million tonnes by the year 2010, from little over 9 million tonnes in 1996. This rapid expansion of natural gas demand is largely due to regulations for environmental protection by the government as well as consumers preference to natural gas over other sources of energy. Especially industrial use of gas will expand faster than other use of gas, although it will not be as high as that in European and North America countries. To meet the enormous increase in demand, Korean government and Korea Gas Corporation (KOGAS) are undertaking expansion of capacities of natural gas supply facilities, and are seeking diversification of import sources, including participation in major gas projects, to secure the import sources on more reliable grounds. (Author). 5 tabs
A model-based analysis of the implications of shale gas developments for the European gas market
Energy Technology Data Exchange (ETDEWEB)
De Joode, J.; Plomp, A.J.; Ozdemir, O. [ECN Policy Studies, Petten (Netherlands)
2012-04-15
Shale gas in Europe could potentially be a big thing, especially in particular regions. Whereas test drillings need to confirm the technical recoverability of deposits and further research is needed on the environmental and safety aspects of shale gas production, this paper illustrates that shale gas developments may have substantial implications for regional gas balances, gas flows, and infrastructure requirements throughout Europe in the next decades.
Gas at work. Vision on decentralized gas appliances in the built environment
International Nuclear Information System (INIS)
Van Gastel, M.; Hooijschuur, J.; De Jong, A.; De Visser, I.; Overdiep, H.; Bakker, E.J.; Van Wolferen, H.
2008-04-01
Various platforms operate within the SenterNovem programme Creative Energy. This report is the first version of the vision document of the working group Decentralized gas appliances of the Platform New Gas, in which the following aspects of the various promising innovative gas appliances are indicated: the development stage, the intended energy saving, the CO2 reduction, the bottlenecks for large scale market introduction and the solutions for these bottlenecks. [mk] [nl
Hahs, Charles A.; Burbage, Charles H.
1984-01-01
The invention is a pneumatically operated valve assembly for simultaneously (1) closing gas-transfer lines connected to a gas centrifuge or the like and (2) establishing a recycle path between two of the lines so closed. The valve assembly is especially designed to be compact, fast-acting, reliable, and comparatively inexpensive. It provides large reductions in capital costs for gas-centrifuge cascades.
International Nuclear Information System (INIS)
Prieur, A.
2006-01-01
Following a decade-long upsurge in the use of natural gas in the energy sector (heating and especially electricity), new outlets for natural gas are being developed in the transport sector. For countries endowed with substantial local resources, development in this sector can help reduce oil dependence. In addition, natural gas is often used to reduce pollution, particularly in cities
Natural gas supply - a producer's perspective
International Nuclear Information System (INIS)
Papa, M.G.
1994-01-01
The supply of natural gas from the producers standpoint is discussed. The following factors in the marketing demand for natural gas are considered to be important: gas demand is growing, U.S. gas resource base is large, chronic gas bubble has shrunk, and North American supply is more resilient than expected
The gas release programs to increase competition in the European gas market
International Nuclear Information System (INIS)
Clastres, Cedric
2005-01-01
Regulators have implemented asymmetric regulation measures, such as gas release programs and market share targets, because of European gas supply features and gas market specificities. Empirical experiences show in line with economic theory that these regulation measures favour entry and competition without deterring investments. If we look at impacts on competition, they are mitigated. Some positive effects result from the increase in consumption or in importation and transportation infrastructure developments. But these regulations can also encourage anti-competitive behaviours like collusion, cream-skimming, reverse cherry picking or inefficient entries. Gas release measures establish a link between the incumbent and its competitors. A system of constraints on operators capacities can also appear. Thus, pricing or quantity strategies are more complex. Equilibrium prices are more volatile and very different of competition mark-up. The incumbent, for high gas release quantities and low supplies, can increase its costs to make more profit. This Raising Rivals' Costs strategy often occur if the gas release price is closer to supply costs. This strategy does not impact on consumers surplus but decreases welfare. The regulator can restore incentives to efficiency by setting gas release proportion function of incumbent's supplies. This proportion must be high enough to have a positive impact on the market because of incumbent's incentives to efficiency and greater total quantities sold by the two operators. But, on another way, it must not be too high as it could, thus, increase the probability of Raising Rivals' Costs or favour collusive strategies. (author) [fr
Seafloor geomorphic manifestations of gas venting and shallow subbottom gas hydrate occurrences
Paull, C K; Caress, D W; Thomas, Hans; Lundsten, Eve M.; Anderson, Kayce; Gwiazda, Roberto; Riedel, M; McGann, Mary; Herguera, J C
2015-01-01
High-resolution multibeam bathymetry data collected with an autonomous underwater vehicle (AUV) complemented by compressed high-intensity radar pulse (Chirp) profiles and remotely operated vehicle (ROV) observations and sediment sampling reveal a distinctive rough topography associated with seafloor gas venting and/or near-subsurface gas hydrate accumulations. The surveys provide 1 m bathymetric grids of deep-water gas venting sites along the best-known gas venting areas along the Pacific margin of North America, which is an unprecedented level of resolution. Patches of conspicuously rough seafloor that are tens of meters to hundreds of meters across and occur on larger seafloor topographic highs characterize seepage areas. Some patches are composed of multiple depressions that range from 1 to 100 m in diameter and are commonly up to 10 m deeper than the adjacent seafloor. Elevated mounds with relief of >10 m and fractured surfaces suggest that seafloor expansion also occurs. Ground truth observations show that these areas contain broken pavements of methane-derived authigenic carbonates with intervening topographic lows. Patterns seen in Chirp profiles, ROV observations, and core data suggest that the rough topography is produced by a combination of diagenetic alteration, focused erosion, and inflation of the seafloor. This characteristic texture allows previously unknown gas venting areas to be identified within these surveys. A conceptual model for the evolution of these features suggests that these morphologies develop slowly over protracted periods of slow seepage and shows the impact of gas venting and gas hydrate development on the seafloor morphology.
Development of high purity CO gas recovery system for BOF gas by modified PSA process
Energy Technology Data Exchange (ETDEWEB)
Sakuraya, Toshikazu; Fujii, Tetsuya; Yaji, Motoyasu; Matsuki, Takao; Matsui, Shigeo; Hayashi, Shigeki
1985-01-01
COPISA process (where two processes for separating CO-adsorptive gases and desorbing desorption-difficult gas are added to conventional PSA gas separation process) is outlined. In two units of PSA, CO/sub 2/ gas is adsorbed and separated in first PSA unit. The gas excluding CO/sub 2/ is fed to second PSA unit, where CO is adsorbed and separated from N/sub 2/ and H/sub 2/, and then desorbed and recovered under reduced pressure. For optimizing the process, a pilot plant was operated for about 1000 hrs. in a half year. The results confirm possibility of simplifying pre-treatment of coal gas. CO-PSA pressure swing pattern suitable for elimination of Co-adsorptive N/sub 2/ is established. Recovery of CO gas is enhanced. Optimization of gas flow pattern between adsorption towers required for reduction in operating cost is performed. (7 figs, 1 tab, 8 refs)
Energy Technology Data Exchange (ETDEWEB)
Moridis, George; Freeman, Craig
2013-09-30
We developed two new EOS additions to the TOUGH+ family of codes, the RealGasH2O and RealGas . The RealGasH2O EOS option describes the non-isothermal two-phase flow of water and a real gas mixture in gas reservoirs, with a particular focus in ultra-tight (such as tight-sand and shale gas) reservoirs. The gas mixture is treated as either a single-pseudo-component having a fixed composition, or as a multicomponent system composed of up to 9 individual real gases. The RealGas option has the same general capabilities, but does not include water, thus describing a single-phase, dry-gas system. In addition to the standard capabilities of all members of the TOUGH+ family of codes (fully-implicit, compositional simulators using both structured and unstructured grids), the capabilities of the two codes include: coupled flow and thermal effects in porous and/or fractured media, real gas behavior, inertial (Klinkenberg) effects, full micro-flow treatment, Darcy and non-Darcy flow through the matrix and fractures of fractured media, single- and multi-component gas sorption onto the grains of the porous media following several isotherm options, discrete and fracture representation, complex matrix-fracture relationships, and porosity-permeability dependence on pressure changes. The two options allow the study of flow and transport of fluids and heat over a wide range of time frames and spatial scales not only in gas reservoirs, but also in problems of geologic storage of greenhouse gas mixtures, and of geothermal reservoirs with multi-component condensable (H2O and CH4) and non-condensable gas mixtures. The codes are verified against available analytical and semi-analytical solutions. Their capabilities are demonstrated in a series of problems of increasing complexity, ranging from isothermal flow in simpler 1D and 2D conventional gas reservoirs, to non-isothermal gas flow in 3D fractured shale gas reservoirs involving 4 types of fractures, micro-flow, non-Darcy flow and gas
Collett, T.S.; Ladd, J.
2000-01-01
Let 164 of the Ocean Drilling Program was designed to investigate the occurrence of gas hydrate in the sedimentary section beneath the Blake Ridge on the southeastern continental margin of North America. Site 994, and 997 were drilled on the Blake Ridge to refine our understanding of the in situ characteristics of natural gas hydrate. Because gas hydrate is unstable at surface pressure and temperature conditions, a major emphasis was placed on the downhole logging program to determine the in situ physical properties of the gas hydrate-bearing sediments. Downhole logging tool strings deployed on Leg 164 included the Schlumberger quad-combination tool (NGT, LSS/SDT, DIT, CNT-G, HLDT), the Formation MicroScanner (FMS), and the Geochemical Combination Tool (GST). Electrical resistivity (DIT) and acoustic transit-time (LSS/SDT) downhole logs from Sites 994, 995, and 997 indicate the presence of gas hydrate in the depth interval between 185 and 450 mbsf on the Blake Ridge. Electrical resistivity log calculations suggest that the gas hydrate-bearing sedimentary section on the Blake Ridge may contain between 2 and 11 percent bulk volume (vol%) gas hydrate. We have determined that the log-inferred gas hydrates and underlying free-gas accumulations on the Blake Ridge may contain as much as 57 trillion m3 of gas.
An analysis of the lifecycle greenhouse gas (GHG) emissions associated with natural gas use recently published by Howarth et al. (2011) stated that use of natural gas produced from shale formations via hydraulic fracturing would generate greater lifecycle GHG emissions than petro...
Energy Technology Data Exchange (ETDEWEB)
Bock, Jucemara [Companhia de Gas do Estado do Rio Grande do Sul (Sulgas), Porto Alegre, RS (Brazil). Coordenacao de Segmento Veicular; Rickmann, Cristiano [Companhia de Gas do Estado do Rio Grande do Sul (Sulgas), Porto Alegre, RS (Brazil). Gerencia de Novos Negocios; Maestri, Juares [Companhia de Gas do Estado do Rio Grande do Sul (Sulgas), Porto Alegre, RS (Brazil). Gerencia de Mercado de Grandes Consumidores
2008-07-01
This work emphasizes the Compressed Natural Gas (CNG) as modal of transport, used by the Company of Gas of the State of Rio Grande do Sul - Sulgas, through experience in pioneering project in Brazil: the introduction of the technology of Compressed Natural Gas (CNG) to assist areas where there is not the infrastructure of pipeline for the transport. The article offers a display of the project of expansion of the Natural gas in Rio Grande do Sul, through the supply of CNG to the company Tramontina in Carlos Barbosa's city in the year of 2002. The last aspect focused by this article demonstrates as the use of this transport technology impelled the development of the transport market in the State and it has been used as an important strategy for the development of the market of Natural Gas Vehicle (NGV) in the state. (author)
International Nuclear Information System (INIS)
Vakilian, M.
1977-05-01
The present study is the second part of a general survey of Gas Cooled Reactors (GCRs). In this part, the course of development, overall performance and present development status of High Temperature Gas Cooled Reactors (HTCRs) and advances of HTGR systems are reviewed. (author)
Consistency Analysis and Data Consultation of Gas System of Gas-Electricity Network of Latvia
Zemite, L.; Kutjuns, A.; Bode, I.; Kunickis, M.; Zeltins, N.
2018-02-01
In the present research, the main critical points of gas transmission and storage system of Latvia have been determined to ensure secure and reliable gas supply among the Baltic States to fulfil the core objectives of the EU energy policies. Technical data of critical points of the gas transmission and storage system of Latvia have been collected and analysed with the SWOT method and solutions have been provided to increase the reliability of the regional natural gas system.
Leidinger, Martin; Schultealbert, Caroline; Neu, Julian; Schütze, Andreas; Sauerwald, Tilman
2018-01-01
This article presents a test gas generation system designed to generate ppb level gas concentrations from gas cylinders. The focus is on permanent gases and volatile organic compounds (VOCs) for applications like indoor and outdoor air quality monitoring or breath analysis. In the design and the setup of the system, several issues regarding handling of trace gas concentrations have been considered, addressed and tested. This concerns not only the active fluidic components (flow controllers, valves), which have been chosen specifically for the task, but also the design of the fluidic tubing regarding dead volumes and delay times, which have been simulated for the chosen setup. Different tubing materials have been tested for their adsorption/desorption characteristics regarding naphthalene, a highly relevant gas for indoor air quality monitoring, which has generated high gas exchange times in a previous gas mixing system due to long time adsorption/desorption effects. Residual gas contaminations of the system and the selected carrier air supply have been detected and quantified using both an analytical method (GC-MS analysis according to ISO 16000-6) and a metal oxide semiconductor gas sensor, which detected a maximum contamination equivalent to 28 ppb of carbon monoxide. A measurement strategy for suppressing even this contamination has been devised, which allows the system to be used for gas sensor and gas sensor system characterization and calibration in the low ppb concentration range.
Jackson, Robert B; Vengosh, Avner; Darrah, Thomas H; Warner, Nathaniel R; Down, Adrian; Poreda, Robert J; Osborn, Stephen G; Zhao, Kaiguang; Karr, Jonathan D
2013-07-09
Horizontal drilling and hydraulic fracturing are transforming energy production, but their potential environmental effects remain controversial. We analyzed 141 drinking water wells across the Appalachian Plateaus physiographic province of northeastern Pennsylvania, examining natural gas concentrations and isotopic signatures with proximity to shale gas wells. Methane was detected in 82% of drinking water samples, with average concentrations six times higher for homes gas wells (P = 0.0006). Ethane was 23 times higher in homes gas wells (P = 0.0013); propane was detected in 10 water wells, all within approximately 1 km distance (P = 0.01). Of three factors previously proposed to influence gas concentrations in shallow groundwater (distances to gas wells, valley bottoms, and the Appalachian Structural Front, a proxy for tectonic deformation), distance to gas wells was highly significant for methane concentrations (P = 0.007; multiple regression), whereas distances to valley bottoms and the Appalachian Structural Front were not significant (P = 0.27 and P = 0.11, respectively). Distance to gas wells was also the most significant factor for Pearson and Spearman correlation analyses (P gas wells was the only statistically significant factor (P gas (4)He to CH4 in groundwater were characteristic of a thermally postmature Marcellus-like source in some cases. Overall, our data suggest that some homeowners living gas wells have drinking water contaminated with stray gases.
Radioactive gas waste processing device
International Nuclear Information System (INIS)
Soma, Koichi.
1996-01-01
The present invention concerns a radioactive gas waste processing device which extracts exhaust gases from a turbine condensator in a BWR type reactor and releases them after decaying radioactivity thereof during temporary storage. The turbine condensator is connected with an extracting ejector, a preheater, a recombiner for converting hydrogen gas into steams, an off gas condensator for removing water content, a flow rate control valve, a dehumidifier, a hold up device for removing radiation contaminated materials, a vacuum pump for sucking radiation decayed-off gases, a circulation water tank for final purification and an exhaustion cylinder by way of connection pipelines in this order. An exhaust gas circulation pipeline is disposed to circulate exhaust gases from an exhaust gas exit pipeline of the recycling water tank to an exhaust gas exit pipeline of the exhaust gas condensator, and a pressure control valve is disposed to the exhaust gas circulation pipeline. This enable to perform a system test for the dehumidification device under a test condition approximate to the load of the dehumidification device under actual operation state, and stabilize both of system flow rate and pressure. (T.M.)
International Nuclear Information System (INIS)
Valais, M.R.
1991-01-01
Two main development could gradually modify these traditional features of natural gas markets and prices. First, environmental pressures and the tightening of emission standards and of the quality specifications for fuels should work in favor of natural gas. Second the increasing distance of resources in relation to the major consuming zones should bring about a considerable development of international natural gas trade. International expansion should mark the development of the gas industry in the coming decades. This evolution will give natural gas an importance and a role appreciably closer to those of oil on the world energy scene. But it is obvious that such a development can come about only at the cost of considerable investments for which the economic viability is and will remain dependent on the level of the prices of natural gas as the inlet to its consuming markets. This paper attempts to answer the questions: Will these markets accept a new scale of value for gas in relation to other fossil fuels, including oil, which will take into account new environmental constraints and which will be able to fulfill the formidable financial needs of the gas industry in the coming decades?
Buffer gas cooling and mixture analysis
Patterson, David S.; Doyle, John M.
2018-03-06
An apparatus for spectroscopy of a gas mixture is described. Such an apparatus includes a gas mixing system configured to mix a hot analyte gas that includes at least one analyte species in a gas phase into a cold buffer gas, thereby forming a supersaturated mixture to be provided for spectroscopic analysis.
French natural gas industry statistics
International Nuclear Information System (INIS)
2004-01-01
The opening of the French natural gas market is effective since August 2000. In this context, some information, which were published in the past, have become confidential and strategic and can no longer be revealed. The data published in this 2004 edition concern only the years 2001 and 2002 for which data are available. The year 2000 inquiry could not be exploited. A first part presents the natural gas industry in France (consumption, supplies, production, storage, distribution, definition of gases, information sources, energy equivalence, map of transportation networks, storage, compression and production facilities). The statistical data are summarized in the second part in the form of tables: resources and uses in 1999, 2001 and 2002; sectoral use of the network distributed gas since 1972; regional distribution of gas production; domestic production and imports since 1972; sectoral distribution of network gas supplies; pipelines and distribution systems; personnel in the gas industry; gas supplies in 2002; supplies to the residential-tertiary sector in 2002; supplies to the industry in 2002; regional supplies in 2002; share of gas supplies per use in each region; regional distribution of gas supplies for each use. A comparison between the 2002 inquiry results and the provisional status is given in appendix. The 2002 energy status and the 2002 questionnaire are also given in appendixes. (J.S.)
Economics of natural gas upgrading
International Nuclear Information System (INIS)
Hackworth, J.H.; Koch, R.W.
1995-01-01
Natural gas could be an important alternative energy source in meeting some of the market demand presently met by liquid products from crude oil. This study was initiated to analyze three energy markets to determine if greater use could be made of natural gas or natural gas derived products and if those products could be provided on an economically competitive basis. The three markets targeted for possible increases in gas use were motor fuels, power generation, and the chemical feedstocks market. The economics of processes to convert natural gas to transportation fuels, chemical products, and power were analyzed. The economic analysis was accomplished by drawing on a variety of detailed economic studies, updating them and bringing the results to a common basis. The processes analyzed included production of methanol, MTBE, higher alcohols, gasoline, CNG, and LNG for the transportation market. Production and use of methanol and ammonia in the chemical feedstock market and use of natural gas for power generation were also assessed. Use of both high and low quality gas as a process feed stream was evaluated. The analysis also explored the impact of various gas price growth rates and process facility locations, including remote gas areas. In assessing the transportation fuels market the analysis examined production and use of both conventional and new alternative motor fuels
Natural gas market assessment: Long-term Canadian natural gas contracts
International Nuclear Information System (INIS)
1992-08-01
A descriptive analysis is presented of the changes which have occurred and the developing trends in the long-term Canadian contracts governing the sale of western Canadian gas into the domestic and export markets from 1985 to 1991. The report is limited to domestic and export contracts for Canadian gas and does not include imported gas under contract. Contract structures prior to deregulation, the changing role of long-term contracts, size and duration of long-term contracts, and terms and conditions of long-term contracts are discussed. Important changes since the mid-1980s include: increased flexibility in long-term contracts enabling the parties to respond more readily to changing supply and demand conditions; greater balance between the buyer's obligation to purchase and the seller's obligation to deliver; flexible and increasingly simple pricing terms that track competitive market conditions; shorter contract terms; reduced contract volumes as smaller end-users and producer/marketers enter the market; and unbundling of gas sales and transportation service providing a wider range of contracting choices and options. 36 figs., 2 tabs
Fabrication of a P3HT-ZnO Nanowires Gas Sensor Detecting Ammonia Gas
Directory of Open Access Journals (Sweden)
Chin-Guo Kuo
2017-12-01
Full Text Available In this study, an organic-inorganic semiconductor gas sensor was fabricated to detect ammonia gas. An inorganic semiconductor was a zinc oxide (ZnO nanowire array produced by atomic layer deposition (ALD while an organic material was a p-type semiconductor, poly(3-hexylthiophene (P3HT. P3HT was suitable for the gas sensing application due to its high hole mobility, good stability, and good electrical conductivity. In this work, P3HT was coated on the zinc oxide nanowires by the spin coating to form an organic-inorganic heterogeneous interface of the gas sensor for detecting ammonia gas. The thicknesses of the P3HT were around 462 nm, 397 nm, and 277 nm when the speeds of the spin coating were 4000 rpm, 5000 rpm, and 6000 rpm, respectively. The electrical properties and sensing characteristics of the gas sensing device at room temperature were evaluated by Hall effect measurement and the sensitivity of detecting ammonia gas. The results of Hall effect measurement for the P3HT-ZnO nanowires semiconductor with 462 nm P3HT film showed that the carrier concentration and the mobility were 2.7 × 1019 cm−3 and 24.7 cm2∙V−1∙s−1 respectively. The gas sensing device prepared by the P3HT-ZnO nanowires semiconductor had better sensitivity than the device composed of the ZnO film and P3HT film. Additionally, this gas sensing device could reach a maximum sensitivity around 11.58 per ppm.
Assessing the Greenhouse Gas Emissions from Natural Gas Fired Power Plants
Hajny, K. D.; Shepson, P. B.; Rudek, J.; Stirm, B. H.; Kaeser, R.; Stuff, A. A.
2017-12-01
Natural gas is often discussed as a "bridge fuel" to transition to renewable energy as it only produces 51% the amount of CO2 per unit energy as coal. This, coupled with rapid increases in production fueled by technological advances, has led to a near tripling of natural gas used for electricity generation since 2005. One concern with this idea of a "bridge fuel" is that methane, the primary component of natural gas, is itself a potent greenhouse gas with 28 and 84 times the global warming potential of CO2 based on mass over a 100 and 20 year period, respectively. Studies have estimated that leaks from the point of extraction to end use of 3.2% would offset the climate benefits of natural gas. Previous work from our group saw that 3 combined cycle power plants emitted unburned CH4 from the stacks and leaked additional CH4 from equipment on site, but total loss rates were still less than 2.2%. Using Purdue's Airborne Laboratory for Atmospheric Research (ALAR) we completed additional aircraft based mass balance experiments combined with passes directly over power plant stacks to expand on the previous study. In this work, we have measured at 12 additional natural gas fired power plants including a mix of operation types (baseload, peaking, intermediate) and firing methods (combined cycle, simple thermal, combustion turbine). We have also returned to the 3 plants previously sampled to reinvestigate emissions for each of those, to assess reproducibility of the results. Here we report the comparison of reported continuous emissions monitoring systems (CEMS) data for CO2 to our emission rates calculated from mass balance experiments, as well as a comparison of calculated CH4 emission rates to estimated emission rates based on the EPA emission factor of 1 g CH4/mmbtu natural gas and CEMS reported heat input. We will also discuss emissions from a coal-fired plant which has been sampled by the group in the past and has since converted to natural gas. Lastly, we discuss the
Natural gas 1995: Issues and trends
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-11-01
Natural Gas 1995: Issues and Trends addresses current issues affecting the natural gas industry and markets. Highlights of recent trends include: Natural gas wellhead prices generally declined throughout 1994 and for 1995 averages 22% below the year-earlier level; Seasonal patterns of natural gas production and wellhead prices have been significantly reduced during the past three year; Natural gas production rose 15% from 1985 through 1994, reaching 18.8 trillion cubic feet; Increasing amounts of natural gas have been imported; Since 1985, lower costs of producing and transporting natural gas have benefitted consumers; Consumers may see additional benefits as States examine regulatory changes aimed at increasing efficiency; and, The electric industry is being restructured in a fashion similar to the recent restructuring of the natural gas industry.
What future for gas in Europe?
International Nuclear Information System (INIS)
Lescoeur, Bruno; Noilhan, Fabrice
2011-01-01
In 2009 the fundamentals of the European gas industry were challenged by the break-through of shale gas in the United-States and a drop in gas demand in Europe. De-correlation of gas markets and oil indexed long term contracts prices challenged the historical means to finance needed infrastructures. In the years to come, gas will play in increasing role in electricity generation, driven by CO_2 emission reduction targets and the need for renewables intermittency backup. The gas industry has to re-invent tools to allow infrastructures development. Among those, indexing long term gas contracts to de-carbonised electricity production could more accurately reflect the final market of such gas as well as maintain the long term producer/customer relationships
International Nuclear Information System (INIS)
Icart, Laura
2016-01-01
World gas market is entering a new era: the LNG advent, the discovery of new fields and the development of unconventional gases have revealed an undeniable gas potential. This potential, present in significant quantities over the world, raises economical, technical and environmental issues. This dossier provides an overview of these new markets: shale gas and oil in the USA and the US energy strategy trend reversal; the Australian LNG rush and its environmental impact; the deep-sea gas fields exploitation and Technips' know-how; the South-American gas resources and the role of LNG; the Eastern Mediterranean offshore gas potential and the energy transition in the Mediterranean area
International Nuclear Information System (INIS)
Le Floch-Prigent, L.
1992-01-01
The different factors affecting gas supply and demand in Europe are examined and the strategies considered necessary to ensure a successful European gas market in the 21st century are outlined. A number of conclusions are drawn. Even though a significant rise in the total demand for gas in Europe is forecast, there are enough sources to cover this demand. However, to think that this gas will be available at cheap conditions is an illusion. These sources are located further and further away which means that their costs will increase. Given the risks inherent in exploring, producing, transporting and marketing these reserves, all the concerned parties must be allowed an acceptable rate of return on their investment. The environmental positive assets inherent in natural gas will guarantee the industry a bright future if they can be fully exploited. New regulations must not hinder the development of new markets or the construction of new infrastructures. The transit directive already permits the softening of the rules regarding transportation; but in order for it to come into real effect there must be gas available on the market. (author)
International Nuclear Information System (INIS)
Ebel, R.E.
1991-01-01
The economic collapse of the Soviet Union has seen the decline of its oil and gas industry through a lack of capital investment, idle wells, shortages of equipment and spare parts, worker apathy, and a leaky pipeline network. Natural gas reserves controlled by the Soviet Union total some 50 trillion m 3 , over 70% of which are in western Siberia. A total of just 19 gas deposits hold 70% of the total reserves and account for over 75% of national output. Natural gas production in 1990 was 815 billion m 3 or 38% of world output; exports reached 109 billion m 3 , divided roughly equally between eastern and western Europe, and all transported by pipeline. The Soviet Union is also a major gas consumer, at around 709 billion m 3 /y, and uses about half this amount for generating electricity. In the early 1980s, a crash program to expand the gas industry raised production from 435 billion m 3 in 1980 to 643 billion m 3 in 1985, but at the cost of hastily built pipelines and facilities, and a premature exhaustion of major gas fields. A prohibition on import of western-made compressors, due to the Afghanistan invasion, forced the installation of unreliable domestic compressors. Slow growth in gas ouput and unreliability of the current gas supply and transmission system has threatened the stability of supply to domestic and export customers, and gas delivery shortfalls of 50-60 billion m 3 were thought possible. The industry's future depends on development of additional fields, and a revived interest in Soviet natural gas is being shown by foreign investors. Since many of these fields are in remote or geologically unfavorable areas, large investments and lead times will be needed
Fixed target flammable gas upgrades
International Nuclear Information System (INIS)
Schmitt, R.; Squires, B.; Gasteyer, T.; Richardson, R.
1996-12-01
In the past, fixed target flammable gas systems were not supported in an organized fashion. The Research Division, Mechanical Support Department began to support these gas systems for the 1995 run. This technical memo describes the new approach being used to supply chamber gasses to fixed target experiments at Fermilab. It describes the engineering design features, system safety, system documentation and performance results. Gas mixtures provide the medium for electron detection in proportional and drift chambers. Usually a mixture of a noble gas and a polyatomic quenching gas is used. Sometimes a small amount of electronegative gas is added as well. The mixture required is a function of the specific chamber design, including working voltage, gain requirements, high rate capability, aging and others. For the 1995 fixed target run all the experiments requested once through gas systems. We obtained a summary of problems from the 1990 fixed target run and made a summary of the operations logbook entries from the 1991 run. These summaries primarily include problems involving flammable gas alarms, but also include incidents where Operations was involved or informed. Usually contamination issues were dealt with by the experimenters. The summaries are attached. We discussed past operational issues with the experimenters involved. There were numerous incidents of drift chamber failure where contaminated gas was suspect. However analyses of the gas at the time usually did not show any particular problems. This could have been because the analysis did not look for the troublesome component, the contaminant was concentrated in the gas over the liquid and vented before the sample was taken, or that contaminants were drawn into the chambers directly through leaks or sub-atmospheric pressures. After some study we were unable to determine specific causes of past contamination problems, although in argon-ethane systems the problems were due to the ethane only
Suitability of gas flare locations for Mini Gas-To-Liquid Technology ...
African Journals Online (AJOL)
Sultan
three can deliver power to the grid via cables and 6 can support local energy and allied industry development. ... impacts of gas flaring e.g. Anikpo et al. (2013). While new ... of the popular ones include cogeneration, GTL and natural gas ...
Energy Technology Data Exchange (ETDEWEB)
Mathias, Melissa Cristina [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil); Szklo, Alexandre Salem [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia (COPPE). Programa de Planejamento Energetico
2008-07-01
The growth of the international natural gas trade during the last decade resulted in the expectation that this product would be traded as a commodity. This expectation created a boom in the investments related to the commercialization of natural gas between borders, especially in the distinct segments of the chain of liquefied natural gas (LNG). Different agents launched themselves into liquefaction and regasification enterprises, and the ordering of ships also showed significant growth. Despite that, the natural gas market still cannot be considered global, and international gas transactions are primarily done within regional markets. This article investigates the challenges posed to the constitution of a global natural gas market. These challenges represent risks to the commercialization of this product in spot bases, for the agents that launch themselves into projects to export or import LNG to be commercialized through short term contracts in the international market for this product. (author)