Determination of the Mutant Selection Window and Evaluation of the Killing of Mycoplasma gallisepticum by Danofloxacin, Doxycycline, Tilmicosin, Tylvalosin and Valnemulin.

Directory of Open Access Journals (Sweden)

Nan Zhang

Full Text Available Mycoplasma gallisepticum is a common etiological cause of a chronic respiratory disease in chickens; its increasing antimicrobial resistance compromises the use of tetracyclines, macrolides and quinolones in the farm environment. Mutant selection window (MSW determination was used to investigate the propensity for future resistance induction by danofloxacin, doxycycline, tilmicosin, tylvalosin and valnemulin. Killing of M. gallisepticum strain S6 by these antimicrobials was also studied by incubating M. gallisepticum into medium containing the compounds at the minimal concentration that inhibits colony formation by 99% (MIC99 and the mutant prevention concentration (MPC. Based on the morphology and colony numbers of M. gallisepticum on agar plates, the four kinds of sera in the order of the applicability for culturing M. gallisepticum were swine serum > horse serum > bovine serum > mixed serum. The MPC/MIC99 values for each agent were as follows: danofloxacin > tilmicosin > tylvalosin > doxycycline > valnemulin. MPC generated more rapid and greater magnitude killing than MIC99 against M. gallisepticum. Under exposure of 105-109 CFU/mL at MPC drug levels, valnemulin had the slowest rate of reduction in viable organisms and danofloxacin had the highest rate of reduction.

Mutations in 23S rRNA gene associated with decreased susceptibility to tiamulin and valnemulin in Mycoplasma gallisepticum.

Science.gov (United States)

Li, Bei-Bei; Shen, Jian-Zhong; Cao, Xing-Yuan; Wang, Yang; Dai, Lei; Huang, Si-Yang; Wu, Cong-Ming

2010-07-01

Mycoplasma gallisepticum is a major etiological agent of chronic respiratory disease (CRD) in chickens and sinusitis in turkeys. The pleuromutilin antibiotics tiamulin and valnemulin are currently used in the treatment of M. gallisepticum infection. We studied the in vitro development of pleuromutilin resistance in M. gallisepticum and investigated the molecular mechanisms involved in this process. Pleuromutilin-resistant mutants were selected by serial passages of M. gallisepticum strains PG31 and S6 in broth medium containing subinhibitory concentrations of tiamulin or valnemulin. A portion of the gene encoding 23S rRNA gene (domain V) and the gene encoding ribosome protein L3 were amplified and sequenced. No mutation could be detected in ribosome protein L3. Mutations were found at nucleotide positions 2058, 2059, 2061, 2447 and 2503 of 23S rRNA gene (Escherichia coli numbering). Although a single mutation could cause elevation of tiamulin and valnemulin MICs, combinations of two or three mutations were necessary to produce high-level resistance. All the mutants were cross-resistant to lincomycin, chloramphenicol and florfenicol. Mutants with the A2058G or the A2059G mutation exhibited cross-resistance to macrolide antibiotics erythromycin, tilmicosin and tylosin.

Experimental infection of chickens and turkeys with Mycoplasma gallisepticum reference strain S6 and North Carolina field isolate RAPD type B.

Science.gov (United States)

Sanei, B; Barnes, H J; Vaillancourt, J P; Leyc, D H

2007-03-01

During an epidemic of mycoplasmosis in chicken and turkey flocks in North Carolina between 1999 and 2001, isolates of Mycoplasma gallisepticum (MG) from affected flocks were characterized by random amplification of polymorphic DNA (RAPD), and eight distinct RAPD types were identified. MG RAPD type B accounted for more than 90% of the isolates and was associated with moderate-to-severe clinical signs and mortality. The virulence of MG RAPD type B for chickens and turkeys was compared with sham-inoculated negative controls and MG S6 (a virulent strain)-inoculated positive controls. Clinical signs occurred in chickens and turkeys inoculated with either MG RAPD type B or MG S6. However, they were not as frequent or severe as those seen in naturally affected flocks, and there was no mortality in the experimental groups. Based on gross and microscopic findings, MG RAPD type B was equal to or more virulent than MG S6. All MG-inoculated birds were culture and PCR positive at 7 and 14 days postinoculation (PI). Among serological tests, the serum plate agglutination test was positive for the majority of chickens and turkeys (58%-100%) infected with either strain of MG at both 7 and 14 days PI. The hemagglutination inhibition test was negative for all birds at 7 days PI and positive for a few chickens (8%-17%) and several turkey sera (40%-60%) at 14 days PI. Only a single serum was positive by enzyme-linked immunosorbent assay (an MG S6-infected turkey) at 14 days PI.

Isolation of Mycoplasma gallopavonis from free-ranging wild turkeys in coastal North Carolina seropositive and culture-negative for Mycoplasma gallisepticum.

Science.gov (United States)

Cobb, D T; Ley, D H; Doerr, P D

1992-01-01

Serum samples and choanal cleft swabs were collected from livetrapped and hunter killed wild turkeys (Meleagris gallopavo) from Martin and Bertie counties, North Carolina (USA). Sera were tested for antibodies to Mycoplasma gallisepticum, Mycoplasma synoviae and Mycoplasma meleagridis by hemagglutination inhibition (HI). Sera from 33% (five of 15) of livetrapped turkeys were positive for antibodies to M. gallisepticum by HI, and all were negative for antibodies to M. synoviae and M. meleagridis. Choanal cleft swabs from 22 livertrapped and five hunter killed wild turkeys cultured in Frey's broth medium resulted in 23 mycoplasma isolations. Using direct immunofluorescence, 74% (17/23) were M. gallopavonis, and 26% (six of 23) were unidentified; no isolate was identified as M. gallisepticum, M. synoviae or M. meleagridis.

Overlay accuracy fundamentals

Science.gov (United States)

Kandel, Daniel; Levinski, Vladimir; Sapiens, Noam; Cohen, Guy; Amit, Eran; Klein, Dana; Vakshtein, Irina

2012-03-01

Currently, the performance of overlay metrology is evaluated mainly based on random error contributions such as precision and TIS variability. With the expected shrinkage of the overlay metrology budget to DBO (1st order diffraction based overlay). It is demonstrated that the sensitivity of DBO to overlay mark asymmetry is larger than the sensitivity of imaging overlay. Finally, we show that a recently developed measurement quality metric serves as a valuable tool for improving overlay metrology accuracy. Simulation results demonstrate that the accuracy of imaging overlay can be improved significantly by recipe setup optimized using the quality metric. We conclude that imaging overlay metrology, complemented by appropriate use of measurement quality metric, results in optimal overlay accuracy.

Determination of the Mutant Selection Window and Evaluation of the Killing of Mycoplasma gallisepticum by Danofloxacin, Doxycycline, Tilmicosin, Tylvalosin and Valnemulin

OpenAIRE

Zhang, Nan; Ye, Xiaomei; Wu, Yuzhi; Huang, Zilong; Gu, Xiaoyan; Cai, Qinren; Shen, Xiangguang; Jiang, Hongxia; Ding, Huanzhong

2017-01-01

Mycoplasma gallisepticum is a common etiological cause of a chronic respiratory disease in chickens; its increasing antimicrobial resistance compromises the use of tetracyclines, macrolides and quinolones in the farm environment. Mutant selection window (MSW) determination was used to investigate the propensity for future resistance induction by danofloxacin, doxycycline, tilmicosin, tylvalosin and valnemulin. Killing of M. gallisepticum strain S6 by these antimicrobials was also studied by i...

Overlay improvement methods with diffraction based overlay and integrated metrology

Science.gov (United States)

Nam, Young-Sun; Kim, Sunny; Shin, Ju Hee; Choi, Young Sin; Yun, Sang Ho; Kim, Young Hoon; Shin, Si Woo; Kong, Jeong Heung; Kang, Young Seog; Ha, Hun Hwan

2015-03-01

To accord with new requirement of securing more overlay margin, not only the optical overlay measurement is faced with the technical limitations to represent cell pattern's behavior, but also the larger measurement samples are inevitable for minimizing statistical errors and better estimation of circumstance in a lot. From these reasons, diffraction based overlay (DBO) and integrated metrology (IM) were mainly proposed as new approaches for overlay enhancement in this paper.

Semi-automated curation of metabolic models via flux balance analysis: a case study with Mycoplasma gallisepticum.

Directory of Open Access Journals (Sweden)

Eddy J Bautista

Full Text Available Primarily used for metabolic engineering and synthetic biology, genome-scale metabolic modeling shows tremendous potential as a tool for fundamental research and curation of metabolism. Through a novel integration of flux balance analysis and genetic algorithms, a strategy to curate metabolic networks and facilitate identification of metabolic pathways that may not be directly inferable solely from genome annotation was developed. Specifically, metabolites involved in unknown reactions can be determined, and potentially erroneous pathways can be identified. The procedure developed allows for new fundamental insight into metabolism, as well as acting as a semi-automated curation methodology for genome-scale metabolic modeling. To validate the methodology, a genome-scale metabolic model for the bacterium Mycoplasma gallisepticum was created. Several reactions not predicted by the genome annotation were postulated and validated via the literature. The model predicted an average growth rate of 0.358±0.12[Formula: see text], closely matching the experimentally determined growth rate of M. gallisepticum of 0.244±0.03[Formula: see text]. This work presents a powerful algorithm for facilitating the identification and curation of previously known and new metabolic pathways, as well as presenting the first genome-scale reconstruction of M. gallisepticum.

The effect of individually-induced processes on image-based overlay and diffraction-based overlay

Science.gov (United States)

Oh, SeungHwa; Lee, Jeongjin; Lee, Seungyoon; Hwang, Chan; Choi, Gilheyun; Kang, Ho-Kyu; Jung, EunSeung

2014-04-01

In this paper, set of wafers with separated processes was prepared and overlay measurement result was compared in two methods; IBO and DBO. Based on the experimental result, theoretical approach of relationship between overlay mark deformation and overlay variation is presented. Moreover, overlay reading simulation was used in verification and prediction of overlay variation due to deformation of overlay mark caused by induced processes. Through this study, understanding of individual process effects on overlay measurement error is given. Additionally, guideline of selecting proper overlay measurement scheme for specific layer is presented.

Sensitivity of some local isolates of Mycoplasma gallisepticum against antibiotics

Directory of Open Access Journals (Sweden)

Sutiastuti Wahyuwardani

1998-03-01

Full Text Available Sensitivity of five local isolates ofMycoplasma gallisepticum (MG strain and two standard MG isolates obtained from Australia were tested against antibiotics of oxytetracycline, doxycycline, erythromycin, bacitracin, vancomycin, methicillin and penicillin using antibiogram disc method. The result showed that one, 2 and 3 local MG isolates were resistent to doxycycline, erythromycin and oxytetracycline respectively . MG isolate of ADA7 from Australia was found to be resistent to all antibiotics tested. None ofthe local MG isolates were sensitive against bacitracin, vancomycin, methicillin and penicillin.

Diffraction based overlay and image based overlay on production flow for advanced technology node

Science.gov (United States)

Blancquaert, Yoann; Dezauzier, Christophe

2013-04-01

One of the main challenges for lithography step is the overlay control. For the advanced technology node like 28nm and 14nm, the overlay budget becomes very tight. Two overlay techniques compete in our advanced semiconductor manufacturing: the Diffraction based Overlay (DBO) with the YieldStar S200 (ASML) and the Image Based Overlay (IBO) with ARCHER (KLA). In this paper we will compare these two methods through 3 critical production layers: Poly Gate, Contact and first metal layer. We will show the overlay results of the 2 techniques, explore the accuracy and compare the total measurement uncertainty (TMU) for the standard overlay targets of both techniques. We will see also the response and impact for the Image Based Overlay and Diffraction Based Overlay techniques through a process change like an additional Hardmask TEOS layer on the front-end stack. The importance of the target design is approached; we will propose more adapted design for image based targets. Finally we will present embedded targets in the 14 FDSOI with first results.

VT Data - Overlay District 20170407, Burlington

Data.gov (United States)

Vermont Center for Geographic Information — The following Overlay District Data is included:Design Review OverlayInstitutional Core Campus OverlayRH Density Bonus OverlayNatural Resource Protection OverlayRL...

Photoelectron emission from thin overlayers

International Nuclear Information System (INIS)

Jablonski, A.

2012-01-01

Highlights: ► Weak influence of the support on photoemission from an overlayer. ► Accurate description of photoelectron intensity from overlayer by analytical theory. ► Method for overlayer thickness measurements based on analytical formalism. ► Influence of photoelectron elastic scattering on calculated thickness. -- Abstract: Photoelectron signal intensities calculated for a thin overlayer from theoretical models taking elastic photoelectron collisions into account are shown to be very weakly dependent on the substrate material. This result has been obtained for photoelectrons analyzed in XPS spectrometers equipped with typical X-ray sources, i.e. sources of Mg Kα and Al Kα radiation. Low sensitivity to the substrate material is due to the fact that trajectories of photoelectrons emitted in the overlayer and entering the substrate have a low probability to reach the analyzer without energy loss. On the other hand, the signal intensity of photoelectrons emitted in the overlayer is found to be distinctly affected by elastic photoelectron scattering. Consequently, a theoretical model that can accurately describe the photoelectron intensity from an overlayer deposited on any material (e.g. on a substrate of the same material as the overlayer) can be a useful basis for a universal and convenient method for determination of the overlayer thickness. It is shown that the formalism derived from the kinetic Boltzmann equation within the so-called transport approximation satisfies these requirements. This formalism is postulated for use in overlayer-thickness measurements to avoid time-consuming Monte Carlo simulations of photoelectron transport, and also to circumvent problems with determining the effective attenuation lengths for overlayer/substrate systems.

VT Data - Overlay District 20170802, Shelburne

Data.gov (United States)

Vermont Center for Geographic Information — The following Overlay Districts are included in the data:Lakeshore Conservation OverlyNeighborhood OverlayVillage Design Review OverlayVillage Core OverlayWater...

VT Data - Overlay District 20170228, Richmond

Data.gov (United States)

Vermont Center for Geographic Information — The following overlay districts are included in the data:Shoreline Protection OverlayFlood Hazard OverlayDetails about these overlay districts, as well as zoning...

Evaluation of an egg yolk enzyme-linked immunosorbent assay antibody test and its use to assess the prevalence of Mycoplasma gallisepticum infection in laying hens in Italy

Directory of Open Access Journals (Sweden)

Marco Tamba

2010-01-01

Full Text Available The prevalence of Mycoplasma gallisepticum infection in commercial layers was established by the presence of antibodies in eggs. Saline-extracted yolks were used with a commercial enzyme-linked immunosorbent assay kit. For the prevalence study, yolks from 30 eggs were obtained from each of 66 flocks coming from 36 layer farms. The prevalence of egg antibodies to Mycoplasma gallisepticum was 33.3% in single-age farms and 77.8% in multi-age farms. In 27 flocks, antibody titers were compared with results obtained from blood samples taken in the same flock and in the same period and analyzed with the same kit. This study has confirmed that egg yolk enzyme-linked immunosorbent assay antibody test is a suitable and practical approach for assessing the flock prevalence of Mycoplasma gallisepticum infection in layer hens.

Critical issues in overlay metrology

International Nuclear Information System (INIS)

Sullivan, Neal T.

2001-01-01

In this paper, following an overview of overlay metrology, the difficult relationship of overlay with device performance and yield is discussed and supported with several examples. This is followed by a discussion of the impending collision of metrology equipment performance and 'real' process tolerances for sub 0.18 um technologies. This convergence of tolerance and performance is demonstrated to lead to the current emergence of real-time overlay modeling in a feed-forward/feedback process environment and the associated metrology/sampling implications. This modeling takes advantage of the wealth of understanding concerning the systematic behavior of overlay registration errors. Finally, the impact of new process technologies (RET, OAI, CPSM, CMP, and etc.) on the measurement target is discussed and shown to de-stabilize overlay performance on standard overlay measurement target designs

Overlay metrology for double patterning processes

Science.gov (United States)

Leray, Philippe; Cheng, Shaunee; Laidler, David; Kandel, Daniel; Adel, Mike; Dinu, Berta; Polli, Marco; Vasconi, Mauro; Salski, Bartlomiej

2009-03-01

The double patterning (DPT) process is foreseen by the industry to be the main solution for the 32 nm technology node and even beyond. Meanwhile process compatibility has to be maintained and the performance of overlay metrology has to improve. To achieve this for Image Based Overlay (IBO), usually the optics of overlay tools are improved. It was also demonstrated that these requirements are achievable with a Diffraction Based Overlay (DBO) technique named SCOLTM [1]. In addition, we believe that overlay measurements with respect to a reference grid are required to achieve the required overlay control [2]. This induces at least a three-fold increase in the number of measurements (2 for double patterned layers to the reference grid and 1 between the double patterned layers). The requirements of process compatibility, enhanced performance and large number of measurements make the choice of overlay metrology for DPT very challenging. In this work we use different flavors of the standard overlay metrology technique (IBO) as well as the new technique (SCOL) to address these three requirements. The compatibility of the corresponding overlay targets with double patterning processes (Litho-Etch-Litho-Etch (LELE); Litho-Freeze-Litho-Etch (LFLE), Spacer defined) is tested. The process impact on different target types is discussed (CD bias LELE, Contrast for LFLE). We compare the standard imaging overlay metrology with non-standard imaging techniques dedicated to double patterning processes (multilayer imaging targets allowing one overlay target instead of three, very small imaging targets). In addition to standard designs already discussed [1], we investigate SCOL target designs specific to double patterning processes. The feedback to the scanner is determined using the different techniques. The final overlay results obtained are compared accordingly. We conclude with the pros and cons of each technique and suggest the optimal metrology strategy for overlay control in double

Diffraction based overlay re-assessed

Science.gov (United States)

Leray, Philippe; Laidler, David; D'havé, Koen; Cheng, Shaunee

2011-03-01

In recent years, numerous authors have reported the advantages of Diffraction Based Overlay (DBO) over Image Based Overlay (IBO), mainly by comparison of metrology figures of merit such as TIS and TMU. Some have even gone as far as to say that DBO is the only viable overlay metrology technique for advanced technology nodes; 22nm and beyond. Typically the only reported drawback of DBO is the size of the required targets. This severely limits its effective use, when all critical layers of a product, including double patterned layers need to be measured, and in-die overlay measurements are required. In this paper we ask whether target size is the only limitation to the adoption of DBO for overlay characterization and control, or are there other metrics, which need to be considered. For example, overlay accuracy with respect to scanner baseline or on-product process overlay control? In this work, we critically re-assess the strengths and weaknesses of DBO for the applications of scanner baseline and on-product process layer overlay control. A comprehensive comparison is made to IBO. For on product process layer control we compare the performance on critical process layers; Gate, Contact and Metal. In particularly we focus on the response of the scanner to the corrections determined by each metrology technique for each process layer, as a measure of the accuracy. Our results show that to characterize an overlay metrology technique that is suitable for use in advanced technology nodes requires much more than just evaluating the conventional metrology metrics of TIS and TMU.

Overlay networks toward information networking

CERN Document Server

Tarkoma, Sasu

2010-01-01

With their ability to solve problems in massive information distribution and processing, while keeping scaling costs low, overlay systems represent a rapidly growing area of R&D with important implications for the evolution of Internet architecture. Inspired by the author's articles on content based routing, Overlay Networks: Toward Information Networking provides a complete introduction to overlay networks. Examining what they are and what kind of structures they require, the text covers the key structures, protocols, and algorithms used in overlay networks. It reviews the current state of th

VT Data - Overlay District 20170710, South Burlington

Data.gov (United States)

Vermont Center for Geographic Information — Overlay data for the City of South Burlington included in this data:Flood Plain Overlay DistrictTraffic Overlay DistrictInterstate Highway Overlay DistrictScenic...

Advanced overlay analysis through design based metrology

Science.gov (United States)

Ji, Sunkeun; Yoo, Gyun; Jo, Gyoyeon; Kang, Hyunwoo; Park, Minwoo; Kim, Jungchan; Park, Chanha; Yang, Hyunjo; Yim, Donggyu; Maruyama, Kotaro; Park, Byungjun; Yamamoto, Masahiro

2015-03-01

As design rule shrink, overlay has been critical factor for semiconductor manufacturing. However, the overlay error which is determined by a conventional measurement with an overlay mark based on IBO and DBO often does not represent the physical placement error in the cell area. The mismatch may arise from the size or pitch difference between the overlay mark and the cell pattern. Pattern distortion caused by etching or CMP also can be a source of the mismatch. In 2014, we have demonstrated that method of overlay measurement in the cell area by using DBM (Design Based Metrology) tool has more accurate overlay value than conventional method by using an overlay mark. We have verified the reproducibility by measuring repeatable patterns in the cell area, and also demonstrated the reliability by comparing with CD-SEM data. We have focused overlay mismatching between overlay mark and cell area until now, further more we have concerned with the cell area having different pattern density and etch loading. There appears a phenomenon which has different overlay values on the cells with diverse patterning environment. In this paper, the overlay error was investigated from cell edge to center. For this experiment, we have verified several critical layers in DRAM by using improved(Better resolution and speed) DBM tool, NGR3520.

Differing House Finch Cytokine Expression Responses to Original and Evolved Isolates of Mycoplasma gallisepticum.

Science.gov (United States)

Vinkler, Michal; Leon, Ariel E; Kirkpatrick, Laila; Dalloul, Rami A; Hawley, Dana M

2018-01-01

The recent emergence of the poultry bacterial pathogen Mycoplasma gallisepticum (MG) in free-living house finches ( Haemorhous mexicanus ), which causes mycoplasmal conjunctivitis in this passerine bird species, resulted in a rapid coevolutionary arms-race between MG and its novel avian host. Despite extensive research on the ecological and evolutionary dynamics of this host-pathogen system over the past two decades, the immunological responses of house finches to MG infection remain poorly understood. We developed seven new probe-based one-step quantitative reverse transcription polymerase chain reaction assays to investigate mRNA expression of house finch cytokine genes ( IL1B, IL6, IL10, IL18, TGFB2, TNFSF15 , and CXCLi2 , syn. IL8L ). These assays were then used to describe cytokine transcription profiles in a panel of 15 house finch tissues collected at three distinct time points during MG infection. Based on initial screening that indicated strong pro-inflammatory cytokine expression during MG infection at the periorbital sites in particular, we selected two key house finch tissues for further characterization: the nictitating membrane, i.e., the internal eyelid in direct contact with MG, and the Harderian gland, the secondary lymphoid tissue responsible for regulation of periorbital immunity. We characterized cytokine responses in these two tissues for 60 house finches experimentally inoculated either with media alone (sham) or one of two MG isolates: the earliest known pathogen isolate from house finches (VA1994) or an evolutionarily more derived isolate collected in 2006 (NC2006), which is known to be more virulent. We show that the more derived and virulent isolate NC2006, relative to VA1994, triggers stronger local inflammatory cytokine signaling, with peak cytokine expression generally occurring 3-6 days following MG inoculation. We also found that the extent of pro-inflammatory interleukin 1 beta signaling was correlated with conjunctival MG loads

Differing House Finch Cytokine Expression Responses to Original and Evolved Isolates of Mycoplasma gallisepticum

Directory of Open Access Journals (Sweden)

Michal Vinkler

2018-01-01

Full Text Available The recent emergence of the poultry bacterial pathogen Mycoplasma gallisepticum (MG in free-living house finches (Haemorhous mexicanus, which causes mycoplasmal conjunctivitis in this passerine bird species, resulted in a rapid coevolutionary arms-race between MG and its novel avian host. Despite extensive research on the ecological and evolutionary dynamics of this host–pathogen system over the past two decades, the immunological responses of house finches to MG infection remain poorly understood. We developed seven new probe-based one-step quantitative reverse transcription polymerase chain reaction assays to investigate mRNA expression of house finch cytokine genes (IL1B, IL6, IL10, IL18, TGFB2, TNFSF15, and CXCLi2, syn. IL8L. These assays were then used to describe cytokine transcription profiles in a panel of 15 house finch tissues collected at three distinct time points during MG infection. Based on initial screening that indicated strong pro-inflammatory cytokine expression during MG infection at the periorbital sites in particular, we selected two key house finch tissues for further characterization: the nictitating membrane, i.e., the internal eyelid in direct contact with MG, and the Harderian gland, the secondary lymphoid tissue responsible for regulation of periorbital immunity. We characterized cytokine responses in these two tissues for 60 house finches experimentally inoculated either with media alone (sham or one of two MG isolates: the earliest known pathogen isolate from house finches (VA1994 or an evolutionarily more derived isolate collected in 2006 (NC2006, which is known to be more virulent. We show that the more derived and virulent isolate NC2006, relative to VA1994, triggers stronger local inflammatory cytokine signaling, with peak cytokine expression generally occurring 3–6 days following MG inoculation. We also found that the extent of pro-inflammatory interleukin 1 beta signaling was correlated with conjunctival

Evaluation of a PCR multiplex for detection and differentiation of Mycoplasma synoviae, M. gallisepticum, and M. gallisepticum strain F-vaccine

Directory of Open Access Journals (Sweden)

Elena Mettifogo

2015-01-01

Full Text Available Mycoplasma gallisepticum (MG and Mycoplasma synoviae (MS are the mycoplasma infections of most concern for commercial poultry industry. MG infection is commonly designated as chronic respiratory disease (CRD of chickens and infections sinusitis of turkeys. MS causes sub clinical upper respiratory infection and tenosynovitis or bursitis in chickens and turkeys. The multiplex PCR was standardized to detect simultaneously the MS, MG field strains and MG F-vaccine strain specific. The generic PCR for detection of any species of Mollicutes Class was performed and compared to the multiplex PCR and to PCR using species-specific primers. A total of 129 avian tracheal swabs were collected from broiler-breeders, layer hens and broilers in seven different farms and were examined by multiplex PCR methods. The system (multiplex PCR demonstrated to be very rapid, sensitive, and specific. Therefore, the results showed a high prevalence of MS in the flocks examined (27.9%, and indicate that the MS is a recurrent pathogen in Brazilian commercial poultry flocks.

[Antimycoplasmal activities of ofloxacin and commonly used antimicrobial agents on Mycoplasma gallisepticum].

Science.gov (United States)

Takahashi, I; Yoshida, T

1989-05-01

In vitro activities of ofloxacin (OFLX), a new quinolone derivative, against 29 strains of Mycoplasma gallisepticum was compared with those of 4 commonly used antimicrobial agents, doxycycline (DOXY), tylosin (TS), spectinomycin (SPCM) and thiamphenicol (TP). Antimycoplasmal activities of the drugs were evaluated on the MIC (final MIC) and MPC (minimum mycoplasmacidal concentration) values which were determined by a broth dilution procedure. The following results were obtained. 1. The MIC90s of OFLX and DOXY were both 0.20 micrograms/ml. The MICs of TS were distributed through a wide range (less than or equal to 0.006 - 0.78 micrograms/ml), and its MIC90 was 0.78 micrograms/ml. Of 29 M. gallisepticum strains, 27.6% were recognized as TS-resistant. The MIC90 values of SPCM and TP were 1.56 micrograms/ml and 3.13 micrograms/ml, respectively. The MIC90 of OFLX was equal to that of DOXY and 4- to 16-fold smaller than the values of the other 3 antibiotics. 2. The MPC of OFLX was the lowest among the antibiotics tested, its MPC90 value was 0.39 micrograms/ml and was followed by DOXY (1.56 micrograms/ml). The MPCs of TS were distributed in a wide range (0.012 - 3.13 micrograms/ml), and its MPC90 was 3.13 micrograms/ml. The MPC90 values of SPCM and TP were both 6.25 micrograms/ml. Therefore, the mycoplasmacidal activity of OFLX evaluated with MPC90 values was 4- to 16-fold greater than those of the other 4 antibiotics.

Attenuated Phenotype of a Recent House Finch-Associated Mycoplasma gallisepticum Isolate in Domestic Poultry.

Science.gov (United States)

Pflaum, K; Tulman, E R; Beaudet, J; Liao, X; Dhondt, K V; Dhondt, A A; Hawley, D M; Ley, D H; Kerr, K M; Geary, S J

2017-06-01

Mycoplasma gallisepticum , known primarily as a respiratory pathogen of domestic poultry, has emerged since 1994 as a significant pathogen of the house finch ( Haemorhous mexicanus ) causing severe conjunctivitis and mortality. House finch-associated M. gallisepticum (HFMG) spread rapidly and increased in virulence for the finch host in the eastern United States. In the current study, we assessed virulence in domestic poultry with two temporally distant, and yet geographically consistent, HFMG isolates which differ in virulence for house finches-Virginia 1994 (VA1994), the index isolate of the epidemic, and Virginia 2013 (VA2013), a recent isolate of increased house finch virulence. Here we report a significant difference between VA1994 and VA2013 in their levels of virulence for chickens; notably, this difference correlated inversely to the difference in their levels of virulence for house finches. VA1994, while moderately virulent in house finches, displayed significant virulence in the chicken respiratory tract. VA2013, while highly virulent in the house finch, was significantly attenuated in chickens relative to VA1994, displaying less-severe pathological lesions in, and reduced bacterial recovery from, the respiratory tract. Overall, these data indicate that a recent isolate of HFMG is greatly attenuated in the chicken host relative to the index isolate, notably demonstrating a virulence phenotype in chickens inversely related to that in the finch host. Copyright © 2017 American Society for Microbiology.

Overlay accuracy with respect to device scaling

Science.gov (United States)

Leray, Philippe; Laidler, David; Cheng, Shaunee

2012-03-01

Overlay metrology performance is usually reported as repeatability, matching between tools or optics aberrations distorting the measurement (Tool induced shift or TIS). Over the last few years, improvement of these metrics by the tool suppliers has been impressive. But, what about accuracy? Using different target types, we have already reported small differences in the mean value as well as fingerprint [1]. These differences make the correctables questionable. Which target is correct and therefore which translation, scaling etc. values should be fed back to the scanner? In this paper we investigate the sources of these differences, using several approaches. First, we measure the response of different targets to offsets programmed in a test vehicle. Second, we check the response of the same overlay targets to overlay errors programmed into the scanner. We compare overlay target designs; what is the contribution of the size of the features that make up the target? We use different overlay measurement techniques; is DBO (Diffraction Based Overlay) more accurate than IBO (Image Based Overlay)? We measure overlay on several stacks; what is the stack contribution to inaccuracy? In conclusion, we offer an explanation for the observed differences and propose a solution to reduce them.

Seroprevalence of Mycoplasma synoviae and Mycoplasma gallisepticum at Batna Commercial poultry farms in Algeria

Directory of Open Access Journals (Sweden)

Nouzha Heleili

Full Text Available Aim: The present study was undertaken to know the seroprevalence of Mycoplasma synoviae (MS and Mycoplasma gallisepticum (MG in broiler and layer chickens in the area of Batna, eastern Algeria. This investigation was conducted during the period from 2008 to 2011. Materials and Methods: A total of 505 sera samples were collected and tested by serum plate agglutination (SPA test using Mycoplasma gallisepticum and Mycoplasma synoviae antigens (Soleil Diagnostic to detect the presence of antibodies against MS and MG. Results: The overall prevalence of MS and MG infection in the 27 flocks visited in this investigation were recorded as 66.33% and 69.90% respectively. Seroprevalence of MG infection was found significantly (p<0.05 higher during winter season (61.48% than in summer (47.74% while MS infection is more dominant in summer (91.25% against 46.69%. Again this was recorded in different age groups, with significantly higher occurrence in young compared to adult with 85.14% in layer hens and 90.73% in broiler chickens. On the other hand, the seroprevalence of MG and MS infection was found little (p>0.05 higher in large flocks (76.97% in comparison to small flocks (63.63%. The highest prevalence (76.59% of mycoplasmal infection in layer hens was found in Lohman strain. Conclusion: It has been found that MG and MS infections are still important disease problems in poultry farms in Algeria. [Vet World 2012; 5(12.000: 709-712

Reaching for the true overlay in advanced nodes

Science.gov (United States)

Koay, Chiew-seng; Hamieh, Bassem; Felix, Nelson; Gaudiello, John

2017-03-01

Traditionally, the total measurement uncertainty (TMU) of overlay metrology focuses on dynamic precision, toolinduced-shift, and matching, while rarely examining inaccuracy. However, some researchers have recently shown that measurement inaccuracy can still be large despite optimized small TMU. Moreover, this inaccuracy can consume a significant portion of the overlay budget in the advanced nodes. In addition to qualifying the overlay error of inline wafers, overlay metrology is also used for improving on-product overlay as it provides corrective feedback to the lithography scanner. The accuracy of the correction terms as a result depends directly upon the measurement accuracy. As such, enhanced overlay accuracy will improve the overlay performance of reworked wafers, or subsequently exposed wafers. We have previously shown that a segmented Blossom target is more prone to asymmetry-induced inaccuracy than a nonsegmented target is [1]. Since target segmentation is inevitable for SADP and SAQP patterning processes, their resulting overlay performance leaves a lot to be desired. In our quest to reach for the true overlay, this paper reports our investigations on accuracy enhancement techniques for image-based targets, such as redundancy and self-calibration, and on the use of simulation-optimized scatterometry-based targets.

Life extension of boilers using weld overlay protection

Energy Technology Data Exchange (ETDEWEB)

Lai, G; Hulsizer, P [Welding Services Inc., Norcross, GA (United States); Brooks, R [Welding Services Inc., Welding Services Europe, Spijkenisse (Netherlands)

1999-12-31

The presentation describes the status of modern weld overlay technology for refurbishment, upgrading and life extension of boilers. The approaches to life extension of boilers include field overlay application, shop-fabricated panels for replacement of the worn, corroded waterwall and shop-fabricated overlay tubing for replacement of individual tubes in superheaters, generating banks and other areas. The characteristics of weld overlay products are briefly described. Also discussed are successful applications of various corrosion-resistant overlays for life extension of boiler tubes in waste-to-energy boilers, coal-fired boilers and chemical recovery boilers. Types of corrosion and selection of weld overlay alloys in these systems are also discussed. (orig.) 14 refs.

Life extension of boilers using weld overlay protection

Energy Technology Data Exchange (ETDEWEB)

Lai, G.; Hulsizer, P. [Welding Services Inc., Norcross, GA (United States); Brooks, R. [Welding Services Inc., Welding Services Europe, Spijkenisse (Netherlands)

1998-12-31

The presentation describes the status of modern weld overlay technology for refurbishment, upgrading and life extension of boilers. The approaches to life extension of boilers include field overlay application, shop-fabricated panels for replacement of the worn, corroded waterwall and shop-fabricated overlay tubing for replacement of individual tubes in superheaters, generating banks and other areas. The characteristics of weld overlay products are briefly described. Also discussed are successful applications of various corrosion-resistant overlays for life extension of boiler tubes in waste-to-energy boilers, coal-fired boilers and chemical recovery boilers. Types of corrosion and selection of weld overlay alloys in these systems are also discussed. (orig.) 14 refs.

Performance of ASML YieldStar μDBO overlay targets for advanced lithography nodes C028 and C014 overlay process control

Science.gov (United States)

Blancquaert, Yoann; Dezauzier, Christophe; Depre, Jerome; Miqyass, Mohamed; Beltman, Jan

2013-04-01

Continued tightening of overlay control budget in semiconductor lithography drives the need for improved metrology capabilities. Aggressive improvements are needed for overlay metrology speed, accuracy and precision. This paper is dealing with the on product metrology results of a scatterometry based platform showing excellent production results on resolution, precision, and tool matching for overlay. We will demonstrate point to point matching between tool generations as well as between target sizes and types. Nowadays, for the advanced process nodes a lot of information is needed (Higher order process correction, Reticle fingerprint, wafer edge effects) to quantify process overlay. For that purpose various overlay sampling schemes are evaluated: ultra- dense, dense and production type. We will show DBO results from multiple target type and shape for on product overlay control for current and future node down to at least 14 nm node. As overlay requirements drive metrology needs, we will evaluate if the new metrology platform meets the overlay requirements.

Enhacement of intrafield overlay using a design based metrology system

Science.gov (United States)

Jo, Gyoyeon; Ji, Sunkeun; Kim, Shinyoung; Kang, Hyunwoo; Park, Minwoo; Kim, Sangwoo; Kim, Jungchan; Park, Chanha; Yang, Hyunjo; Maruyama, Kotaro; Park, Byungjun

2016-03-01

As the scales of the semiconductor devices continue to shrink, accurate measurement and control of the overlay have been emphasized for securing more overlay margin. Conventional overlay analysis methods are based on the optical measurement of the overlay mark. However, the overlay data obtained from these optical methods cannot represent the exact misregistration between two layers at the circuit level. The overlay mismatch may arise from the size or pitch difference between the overlay mark and the real pattern. Pattern distortion, caused by CMP or etching, could be a source of the overlay mismatch as well. Another issue is the overlay variation in the real circuit pattern which varies depending on its location. The optical overlay measurement methods, such as IBO and DBO that use overlay mark on the scribeline, are not capable of defining the exact overlay values of the real circuit. Therefore, the overlay values of the real circuit need to be extracted to integrate the semiconductor device properly. The circuit level overlay measurement using CDSEM is time-consuming in extracting enough data to indicate overall trend of the chip. However DBM tool is able to derive sufficient data to display overlay tendency of the real circuit region with high repeatability. An E-beam based DBM(Design Based Metrology) tool can be an alternative overlay measurement method. In this paper, we are going to certify that the overlay values extracted from optical measurement cannot represent the circuit level overlay values. We will also demonstrate the possibility to correct misregistration between two layers using the overlay data obtained from the DBM system.

Overlay leaves litho: impact of non-litho processes on overlay and compensation

Science.gov (United States)

Ruhm, Matthias; Schulz, Bernd; Cotte, Eric; Seltmann, Rolf; Hertzsch, Tino

2014-10-01

According to the ITRS roadmap [1], the overlay requirement for the 28nm node is 8nm. If we compare this number with the performance given by tool vendors for their most advanced immersion systems (which is emerging. Mask contributions and so-called non-linear wafer distortions are known effects that can impact overlay quite significantly. Furthermore, it is often forgotten that downstream (post-litho) processes can impact the overlay as well. Thus, it can be required to compensate for the effects of subsequent processes already at the lithography operation. Within our paper, we will briefly touch on the wafer distortion topic and discuss the limitations of lithography compensation techniques such as higher order corrections versus solving the root cause of the distortions. The primary focus will be on the impact of the etch processes on the pattern placement error. We will show how individual layers can get affected differently by showing typical wafer signatures. However, in contrast to the above-mentioned wafer distortion topic, lithographic compensation techniques can be highly effective to reduce the placement error significantly towards acceptable levels (see Figure 1). Finally we will discuss the overall overlay budget for a 28nm contact to gate case by taking the impact of the individual process contributors into account.

Advanced diffraction-based overlay for double patterning

Science.gov (United States)

Li, Jie; Liu, Yongdong; Dasari, Prasad; Hu, Jiangtao; Smith, Nigel; Kritsun, Oleg; Volkman, Catherine

2010-03-01

Diffraction based overlay (DBO) technologies have been developed to address the tighter overlay control challenges as the dimensions of integrated circuit continue to shrink. Several studies published recently have demonstrated that the performance of DBO technologies has the potential to meet the overlay metrology budget for 22nm technology node. However, several hurdles must be cleared before DBO can be used in production. One of the major hurdles is that most DBO technologies require specially designed targets that consist of multiple measurement pads, which consume too much space and increase measurement time. A more advanced spectroscopic ellipsometry (SE) technology-Mueller Matrix SE (MM-SE) is developed to address the challenge. We use a double patterning sample to demonstrate the potential of MM-SE as a DBO candidate. Sample matrix (the matrix that describes the effects of the sample on the incident optical beam) obtained from MM-SE contains up to 16 elements. We show that the Mueller elements from the off-diagonal 2x2 blocks respond to overlay linearly and are zero when overlay errors are absent. This superior property enables empirical DBO (eDBO) using two pads per direction. Furthermore, the rich information in Mueller matrix and its direct response to overlay make it feasible to extract overlay errors from only one pad per direction using modeling approach (mDBO). We here present the Mueller overlay results using both eDBO and mDBO and compare the results with image-based overlay (IBO) and CD-SEM results. We also report the tool induced shifts (TIS) and dynamic repeatability.

Serologic response of roosters to gradient dosage levels of a commercially available live F strain-derived Mycoplasma gallisepticum vaccine over time

Science.gov (United States)

Spray application is a commonly used time- and labor-efficient means to deliver live Mycoplasma gallisepticum (MG) vaccine to laying hens in commercial production facilities. The dosage of vaccine received by spray vaccinated birds can vary due to variation in the spray plume and vaccine suspension...

Diffraction-based overlay metrology for double patterning technologies

Science.gov (United States)

Dasari, Prasad; Korlahalli, Rahul; Li, Jie; Smith, Nigel; Kritsun, Oleg; Volkman, Cathy

2009-03-01

The extension of optical lithography to 32nm and beyond is made possible by Double Patterning Techniques (DPT) at critical levels of the process flow. The ease of DPT implementation is hindered by increased significance of critical dimension uniformity and overlay errors. Diffraction-based overlay (DBO) has shown to be an effective metrology solution for accurate determination of the overlay errors associated with double patterning [1, 2] processes. In this paper we will report its use in litho-freeze-litho-etch (LFLE) and spacer double patterning technology (SDPT), which are pitch splitting solutions that reduce the significance of overlay errors. Since the control of overlay between various mask/level combinations is critical for fabrication, precise and accurate assessment of errors by advanced metrology techniques such as spectroscopic diffraction based overlay (DBO) and traditional image-based overlay (IBO) using advanced target designs will be reported. A comparison between DBO, IBO and CD-SEM measurements will be reported. . A discussion of TMU requirements for 32nm technology and TMU performance data of LFLE and SDPT targets by different overlay approaches will be presented.

Real cell overlay measurement through design based metrology

Science.gov (United States)

Yoo, Gyun; Kim, Jungchan; Park, Chanha; Lee, Taehyeong; Ji, Sunkeun; Jo, Gyoyeon; Yang, Hyunjo; Yim, Donggyu; Yamamoto, Masahiro; Maruyama, Kotaro; Park, Byungjun

2014-04-01

Until recent device nodes, lithography has been struggling to improve its resolution limit. Even though next generation lithography technology is now facing various difficulties, several innovative resolution enhancement technologies, based on 193nm wavelength, were introduced and implemented to keep the trend of device scaling. Scanner makers keep developing state-of-the-art exposure system which guarantees higher productivity and meets a more aggressive overlay specification. "The scaling reduction of the overlay error has been a simple matter of the capability of exposure tools. However, it is clear that the scanner contributions may no longer be the majority component in total overlay performance. The ability to control correctable overlay components is paramount to achieve the desired performance.(2)" In a manufacturing fab, the overlay error, determined by a conventional overlay measurement: by using an overlay mark based on IBO and DBO, often does not represent the physical placement error in the cell area of a memory device. The mismatch may arise from the size or pitch difference between the overlay mark and the cell pattern. Pattern distortion, caused by etching or CMP, also can be a source of the mismatch. Therefore, the requirement of a direct overlay measurement in the cell pattern gradually increases in the manufacturing field, and also in the development level. In order to overcome the mismatch between conventional overlay measurement and the real placement error of layer to layer in the cell area of a memory device, we suggest an alternative overlay measurement method utilizing by design, based metrology tool. A basic concept of this method is shown in figure1. A CD-SEM measurement of the overlay error between layer 1 and 2 could be the ideal method but it takes too long time to extract a lot of data from wafer level. An E-beam based DBM tool provides high speed to cover the whole wafer with high repeatability. It is enabled by using the design as a

A comparison of advanced overlay technologies

Science.gov (United States)

Dasari, Prasad; Smith, Nigel; Goelzer, Gary; Liu, Zhuan; Li, Jie; Tan, Asher; Koh, Chin Hwee

2010-03-01

The extension of optical lithography to 22nm and beyond by Double Patterning Technology is often challenged by CDU and overlay control. With reduced overlay measurement error budgets in the sub-nm range, relying on traditional Total Measurement Uncertainty (TMU) estimates alone is no longer sufficient. In this paper we will report scatterometry overlay measurements data from a set of twelve test wafers, using four different target designs. The TMU of these measurements is under 0.4nm, within the process control requirements for the 22nm node. Comparing the measurement differences between DBO targets (using empirical and model based analysis) and with image-based overlay data indicates the presence of systematic and random measurement errors that exceeds the TMU estimate.

Hybrid overlay metrology for high order correction by using CDSEM

Science.gov (United States)

Leray, Philippe; Halder, Sandip; Lorusso, Gian; Baudemprez, Bart; Inoue, Osamu; Okagawa, Yutaka

2016-03-01

Overlay control has become one of the most critical issues for semiconductor manufacturing. Advanced lithographic scanners use high-order corrections or correction per exposure to reduce the residual overlay. It is not enough in traditional feedback of overlay measurement by using ADI wafer because overlay error depends on other process (etching process and film stress, etc.). It needs high accuracy overlay measurement by using AEI wafer. WIS (Wafer Induced Shift) is the main issue for optical overlay, IBO (Image Based Overlay) and DBO (Diffraction Based Overlay). We design dedicated SEM overlay targets for dual damascene process of N10 by i-ArF multi-patterning. The pattern is same as device-pattern locally. Optical overlay tools select segmented pattern to reduce the WIS. However segmentation has limit, especially the via-pattern, for keeping the sensitivity and accuracy. We evaluate difference between the viapattern and relaxed pitch gratings which are similar to optical overlay target at AEI. CDSEM can estimate asymmetry property of target from image of pattern edge. CDSEM can estimate asymmetry property of target from image of pattern edge. We will compare full map of SEM overlay to full map of optical overlay for high order correction ( correctables and residual fingerprints).

Diffraction-based overlay for spacer patterning and double patterning technology

Science.gov (United States)

Lee, Byoung Hoon; Park, JeongSu; Lee, Jongsu; Park, Sarohan; Lim, ChangMoon; Yim, Dong-Gyu; Park, Sungki; Ryu, Chan-Ho; Morgan, Stephen; van de Schaar, Maurits; Fuchs, Andreas; Bhattacharyya, Kaustuve

2011-03-01

Overlay performance will be increasingly important for Spacer Patterning Technology (SPT) and Double Patterning Technology (DPT) as various Resolution Enhancement Techniques are employed to extend the resolution limits of lithography. Continuous shrinkage of devices makes overlay accuracy one of the most critical issues while overlay performance is completely dependent on exposure tool. Image Based Overlay (IBO) has been used as the mainstream metrology for overlay by the main memory IC companies, but IBO is not suitable for some critical layers due to the poor Tool Induced Shift (TIS) values. Hence new overlay metrology is required to improve the overlay measurement accuracy. Diffraction Based Overlay (DBO) is regarded to be an alternative metrology to IBO for more accurate measurements and reduction of reading errors. Good overlay performances of DBO have been reported in many articles. However applying DBO for SPT and DPT layers poses extra challenges for target design. New vernier designs are considered for different DPT and SPT schemes to meet overlay target in DBO system. In this paper, we optimize the design of the DBO target and the performance of DBO to meet the overlay specification of sub-3x nm devices which are using SPT and DPT processes. We show that the appropriate vernier design yields excellent overlay performance in residual and TIS. The paper also demonstrated the effects of vernier structure on overlay accuracy from SEM analysis.

In vitro susceptibilities to fluoroquinolones in current and archived Mycoplasma gallisepticum and Mycoplasma synoviae isolates from meat-type turkeys.

Science.gov (United States)

Gerchman, Irina; Lysnyansky, Inna; Perk, Shimon; Levisohn, Sharon

2008-10-15

Monitoring of susceptibility to antibiotics in field isolates of pathogenic avian mycoplasmas is important for appropriate choice of treatment. Our study compared in vitro susceptibility to enrofloxacin and difloxacin in recent (2005-2006) isolates of Mycoplasma gallisepticum and Mycoplasma synoviae from meat-type turkey flocks with archived (1997-2003) isolates and reference strains. Comparison of minimal inhibitory concentration (MIC) values determined by microtest, agar dilution and commercial Etest showed good agreement, but underscored the need for standardized methods for testing. Notably, while the commercial Etest was convenient and accurate for determining MICs for enrofloxacin in the range 0.002-0.094microg/ml, the endpoint of inhibition for M. gallisepticum and M. synoviae strains with MIC values > or =1.0microg/ml could not be determined. A decrease in susceptibility to both fluoroquinolones was detected in archived strains but to a greater degree in recent isolates, most of which had MICs above the NCCLS susceptibility breakpoint for these antibiotics (meat-type turkeys suggests that these strains have become established in Israel, necessitating a reevaluation of antibiotic therapy. Periodic survey of MICs in field isolates of avian mycoplasmas to monitor for the possible appearance of resistant strains is recommended.

High-throughput electrical characterization for robust overlay lithography control

Science.gov (United States)

Devender, Devender; Shen, Xumin; Duggan, Mark; Singh, Sunil; Rullan, Jonathan; Choo, Jae; Mehta, Sohan; Tang, Teck Jung; Reidy, Sean; Holt, Jonathan; Kim, Hyung Woo; Fox, Robert; Sohn, D. K.

2017-03-01

Realizing sensitive, high throughput and robust overlay measurement is a challenge in current 14nm and advanced upcoming nodes with transition to 300mm and upcoming 450mm semiconductor manufacturing, where slight deviation in overlay has significant impact on reliability and yield1). Exponentially increasing number of critical masks in multi-patterning lithoetch, litho-etch (LELE) and subsequent LELELE semiconductor processes require even tighter overlay specification2). Here, we discuss limitations of current image- and diffraction- based overlay measurement techniques to meet these stringent processing requirements due to sensitivity, throughput and low contrast3). We demonstrate a new electrical measurement based technique where resistance is measured for a macro with intentional misalignment between two layers. Overlay is quantified by a parabolic fitting model to resistance where minima and inflection points are extracted to characterize overlay control and process window, respectively. Analyses using transmission electron microscopy show good correlation between actual overlay performance and overlay obtained from fitting. Additionally, excellent correlation of overlay from electrical measurements to existing image- and diffraction- based techniques is found. We also discuss challenges of integrating electrical measurement based approach in semiconductor manufacturing from Back End of Line (BEOL) perspective. Our findings open up a new pathway for accessing simultaneous overlay as well as process window and margins from a robust, high throughput and electrical measurement approach.

New low-viscosity overlay medium for viral plaque assays

Directory of Open Access Journals (Sweden)

Garten Wolfgang

2006-08-01

Full Text Available Abstract Background Plaque assays in cell culture monolayers under solid or semisolid overlay media are commonly used for quantification of viruses and antiviral substances. To overcome the pitfalls of known overlays, we tested suspensions of microcrystalline cellulose Avicel RC/CL™ as overlay media in the plaque and plaque-inhibition assay of influenza viruses. Results Significantly larger plaques were formed under Avicel-containing media, as compared to agar and methylcellulose (MC overlay media. The plaque size increased with decreasing Avicel concentration, but even very diluted Avicel overlays (0.3% ensured formation of localized plaques. Due to their low viscosity, Avicel overlays were easier to use than methylcellulose overlays, especially in the 96-well culture plates. Furthermore, Avicel overlay could be applied without prior removal of the virus inoculum thus facilitating the assay and reducing chances of cross-contamination. Using neuraminidase inhibitor oseltamivir carboxylate, we demonstrated applicability of the Avicel-based plaque reduction assay for testing of antiviral substances. Conclusion Plaque assay under Avicel-containing overlay media is easier, faster and more sensitive than assays under agar- and methylcellulose overlays. The assay can be readily performed in a 96-well plate format and seems particularly suitable for high-throughput virus titrations, serological studies and experiments on viral drug sensitivity. It may also facilitate work with highly pathogenic agents performed under hampered conditions of bio-safety labs.

SEM based overlay measurement between resist and buried patterns

Science.gov (United States)

Inoue, Osamu; Okagawa, Yutaka; Hasumi, Kazuhisa; Shao, Chuanyu; Leray, Philippe; Lorusso, Gian; Baudemprez, Bart

2016-03-01

With the continuous shrink in pattern size and increased density, overlay control has become one of the most critical issues in semiconductor manufacturing. Recently, SEM based overlay of AEI (After Etch Inspection) wafer has been used for reference and optimization of optical overlay (both Image Based Overlay (IBO) and Diffraction Based Overlay (DBO)). Overlay measurement at AEI stage contributes monitor and forecast the yield after formation by etch and calibrate optical measurement tools. however those overlay value seems difficult directly for feedback to a scanner. Therefore, there is a clear need to have SEM based overlay measurements of ADI (After Develop Inspection) wafers in order to serve as reference for optical overlay and make necessary corrections before wafers go to etch. Furthermore, to make the corrections as accurate as possible, actual device like feature dimensions need to be measured post ADI. This device size measurement is very unique feature of CDSEM , which can be measured with smaller area. This is currently possible only with the CD-SEM. This device size measurement is very unique feature of CD-SEM , which can be measured with smaller area. In this study, we assess SEM based overlay measurement of ADI and AEI wafer by using a sample from an N10 process flow. First, we demonstrate SEM based overlay performance at AEI by using dual damascene process for Via 0 (V0) and metal 1 (M1) layer. We also discuss the overlay measurements between litho-etch-litho stages of a triple patterned M1 layer and double pattern V0. Second, to illustrate the complexities in image acquisition and measurement we will measure overlay between M1B resist and buried M1A-Hard mask trench. Finally, we will show how high accelerating voltage can detect buried pattern information by BSE (Back Scattering Electron). In this paper we discuss the merits of this method versus standard optical metrology based corrections.

Image-based overlay measurement using subsurface ultrasonic resonance force microscopy

Science.gov (United States)

Tamer, M. S.; van der Lans, M. J.; Sadeghian, H.

2018-03-01

Image Based Overlay (IBO) measurement is one of the most common techniques used in Integrated Circuit (IC) manufacturing to extract the overlay error values. The overlay error is measured using dedicated overlay targets which are optimized to increase the accuracy and the resolution, but these features are much larger than the IC feature size. IBO measurements are realized on the dedicated targets instead of product features, because the current overlay metrology solutions, mainly based on optics, cannot provide sufficient resolution on product features. However, considering the fact that the overlay error tolerance is approaching 2 nm, the overlay error measurement on product features becomes a need for the industry. For sub-nanometer resolution metrology, Scanning Probe Microscopy (SPM) is widely used, though at the cost of very low throughput. The semiconductor industry is interested in non-destructive imaging of buried structures under one or more layers for the application of overlay and wafer alignment, specifically through optically opaque media. Recently an SPM technique has been developed for imaging subsurface features which can be potentially considered as a solution for overlay metrology. In this paper we present the use of Subsurface Ultrasonic Resonance Force Microscopy (SSURFM) used for IBO measurement. We used SSURFM for imaging the most commonly used overlay targets on a silicon substrate and photoresist. As a proof of concept we have imaged surface and subsurface structures simultaneously. The surface and subsurface features of the overlay targets are fabricated with programmed overlay errors of +/-40 nm, +/-20 nm, and 0 nm. The top layer thickness changes between 30 nm and 80 nm. Using SSURFM the surface and subsurface features were successfully imaged and the overlay errors were extracted, via a rudimentary image processing algorithm. The measurement results are in agreement with the nominal values of the programmed overlay errors.

Scatterometry or imaging overlay: a comparative study

Science.gov (United States)

Hsu, Simon C. C.; Pai, Yuan Chi; Chen, Charlie; Yu, Chun Chi; Hsing, Henry; Wu, Hsing-Chien; Kuo, Kelly T. L.; Amir, Nuriel

2015-03-01

Most fabrication facilities today use imaging overlay measurement methods, as it has been the industry's reliable workhorse for decades. In the last few years, third-generation Scatterometry Overlay (SCOL™) or Diffraction Based Overlay (DBO-1) technology was developed, along another DBO technology (DBO-2). This development led to the question of where the DBO technology should be implemented for overlay measurements. Scatterometry has been adopted for high volume production in only few cases, always with imaging as a backup, but scatterometry overlay is considered by many as the technology of the future. In this paper we compare imaging overlay and DBO technologies by means of measurements and simulations. We outline issues and sensitivities for both technologies, providing guidelines for the best implementation of each. For several of the presented cases, data from two different DBO technologies are compared as well, the first with Pupil data access (DBO-1) and the other without pupil data access (DBO-2). Key indicators of overlay measurement quality include: layer coverage, accuracy, TMU, process robustness and robustness to process changes. Measurement data from real cases across the industry are compared and the conclusions are also backed by simulations. Accuracy is benchmarked with reference OVL, and self-consistency, showing good results for Imaging and DBO-1 technology. Process sensitivity and metrology robustness are mostly simulated with MTD (Metrology Target Designer) comparing the same process variations for both technologies. The experimental data presented in this study was done on ten advanced node layers and three production node layers, for all phases of the IC fabrication process (FEOL, MEOL and BEOL). The metrology tool used for most of the study is KLA-Tencor's Archer 500LCM system (scatterometry-based and imaging-based measurement technologies on the same tool) another type of tool is used for DBO-2 measurements. Finally, we conclude that

Development of an Overlay Design Procedure for Composite Pavements

Science.gov (United States)

2017-09-01

The composite overlay design procedure currently used by ODOT sometimes produces very large overlay thicknesses that are deemed structurally unnecessary, especially for composite pavements already with thick asphalt overlays. This study was initiated...

BASIC overlay for CAMAC data and command handling

Energy Technology Data Exchange (ETDEWEB)

Ciftcioglu, O [Istanbul Technical Univ. (Turkey). Inst. for Nuclear Energy

1979-11-15

A BASIC overlay has been developed for the BASIC language run in the PDP-11 series of computers. The overlay has particularly been wirtten for a dedicated Camac Crate Controller DC-011 from Ortec. By means of the overlay, any command comprising C, N, A, F information can easily be issued by the host system to communicate with the peripherals connected to the CAMAC system, through the CAMAC interface. The overlay is particularly useful for rather slow control systems and data handling between two different operating systems with incompatible formats for the data files having the CAMAC system as a mutual system component controllable by each of the operating systems individually. The overlay can easily be modified to be used for a Standard controller (type A-1) or any other type of dedicated controller.

In vitro development of resistance to enrofloxacin, erythromycin, tylosin, tiamulin and oxytetracycline in Mycoplasma gallisepticum, Mycoplasma iowae and Mycoplasma synoviae.

Science.gov (United States)

Gautier-Bouchardon, A V; Reinhardt, A K; Kobisch, M; Kempf, I

2002-08-02

The in vitro emergence of resistance to enrofloxacin, erythromycin, tylosin, tiamulin, and oxytetracycline in three avian Mycoplasma species, Mycoplasma gallisepticum, Mycoplasma synoviae and Mycoplasma iowae was studied. Mutants were selected stepwise and their MICs were determined after 10 passages in subinhibitory concentrations of antibiotic. High-level resistance to erythromycin and tylosin developed within 2-6 passages in the three Mycoplasma species. Resistance to enrofloxacin developed more gradually. No resistance to tiamulin or oxytetracycline could be evidenced in M. gallisepticum or M. synoviae after 10 passages whereas, resistant mutants were obtained with M. iowae. Cross-sensitivity tests performed on mutants demonstrated that mycoplasmas made resistant to tylosin were also resistant to erythromycin, whereas mutants made resistant to erythromycin were not always resistant to tylosin. Some M. iowae tiamulin-resistant mutants were also resistant to both macrolide antibiotics. Enrofloxacin and oxytetracycline did not induce any cross-resistance to the other antibiotics tested. These results show that Mycoplasma resistance to macrolides can be quickly selected in vitro, and thus, providing that similar results could be obtained under field conditions, that development of resistance to these antibiotics in vivo might also be a relatively frequent event.

Overlay welding of FeCrAl alloys

OpenAIRE

Rashid, Lezan

2016-01-01

In this master thesis different overlay welding methods suitable for boiler application has been investigated. The purpose of this project is to define advantages and disadvantages for each overlay welding methods and suggest some evaluation criteria on some commercial and experimental alloys aimed for overlay welding material. Many components in a boiler are made of low alloy steel and the atmosphere in the furnace region can be very complex; therefore many different types of corrosion can o...

Experimental Mycoplasma gallisepticum infections in captive-reared wild turkeys

Science.gov (United States)

Rocke, Tonie E.; Yuill, Thomas M.; Amundson, Terry E.

1988-01-01

The effects of Mycoplasma gallisepticum (MG) infections on egg production, fertility, and hatchability were studied in captive-reared wild turkeys (Meleagris gallopavo). Three groups of adult birds, each consisting of four hens and two toms, were exposed to MG by the respiratory route at the beginning of their breeding season. Fourteen control birds received sterile growth medium. Although no mortality of infected or control birds occurred, egg production during the first breeding season after infection was reduced. The mean number of eggs/hen/day produced by infected groups the first breeding season postexposure (PE) was significantly lower than the control value. The mean number of eggs produced daily by the same hens 1 yr later was unaffected by MG infection. The pecentage of fertile eggs produced by infected groups was slightly reduced in both the first and second breeding seasons PE. Hatchability of fertile eggs from infected hens was significantly lower than eggs from control hens. Productivity may be impaired if MG infections occur in free-ranging wild turkey populations.

Colors, colored overlays, and reading skills

Directory of Open Access Journals (Sweden)

Arcangelo eUccula

2014-07-01

Full Text Available In this article, we are concerned with the role of colors in reading written texts. It has been argued that colored overlays applied above written texts positively influence both reading fluency and reading speed. These effects would be particularly evident for those individuals affected by the so called Meares-Irlen syndrome, i.e. who experience eyestrain and/or visual distortions – e.g. color, shape or movement illusions – while reading. This condition would interest the 12-14% of the general population and up to the 46% of the dyslexic population. Thus, colored overlays have been largely employed as a remedy for some aspects of the difficulties in reading experienced by dyslexic individuals, as fluency and speed. Despite the wide use of colored overlays, how they exert their effects has not been made clear yet. Also, according to some researchers, the results supporting the efficacy of colored overlays as a tool for helping readers are at least controversial. Furthermore, the very nature of the Meares-Irlen syndrome has been questioned. Here we provide a concise, critical review of the literature.

In-cell overlay metrology by using optical metrology tool

Science.gov (United States)

Lee, Honggoo; Han, Sangjun; Hong, Minhyung; Kim, Seungyoung; Lee, Jieun; Lee, DongYoung; Oh, Eungryong; Choi, Ahlin; Park, Hyowon; Liang, Waley; Choi, DongSub; Kim, Nakyoon; Lee, Jeongpyo; Pandev, Stilian; Jeon, Sanghuck; Robinson, John C.

2018-03-01

Overlay is one of the most critical process control steps of semiconductor manufacturing technology. A typical advanced scheme includes an overlay feedback loop based on after litho optical imaging overlay metrology on scribeline targets. The after litho control loop typically involves high frequency sampling: every lot or nearly every lot. An after etch overlay metrology step is often included, at a lower sampling frequency, in order to characterize and compensate for bias. The after etch metrology step often involves CD-SEM metrology, in this case in-cell and ondevice. This work explores an alternative approach using spectroscopic ellipsometry (SE) metrology and a machine learning analysis technique. Advanced 1x nm DRAM wafers were prepared, including both nominal (POR) wafers with mean overlay offsets, as well as DOE wafers with intentional across wafer overlay modulation. After litho metrology was measured using optical imaging metrology, as well as after etch metrology using both SE and CD-SEM for comparison. We investigate 2 types of machine learning techniques with SE data: model-less and model-based, showing excellent performance for after etch in-cell on-device overlay metrology.

Hybrid overlay metrology with CDSEM in a BEOL patterning scheme

Science.gov (United States)

Leray, Philippe; Jehoul, Christiane; Inoue, Osamu; Okagawa, Yutaka

2015-03-01

Overlay metrology accuracy is a major concern for our industry. Advanced logic process require more tighter overlay control for multipatterning schemes. TIS (Tool Induced Shift) and WIS (Wafer Induced Shift) are the main issues for IBO (Image Based Overlay) and DBO (Diffraction Based Overlay). Methods of compensation have been introduced, some are even very efficient to reduce these measured offsets. Another related question is about the overlay target designs. These targets are never fully representative of the design rules, strong efforts have been achieved, but the device cannot be completely duplicated. Ideally, we would like to measure in the device itself to verify the real overlay value. Top down CDSEM can measure critical dimensions of any structure, it is not dependent of specific target design. It can also measure the overlay errors but only in specific cases like LELE (Litho Etch Litho Etch) after final patterning. In this paper, we will revisit the capability of the CDSEM at final patterning by measuring overlay in dedicated targets as well as inside a logic and an SRAM design. In the dedicated overlay targets, we study the measurement differences between design rules gratings and relaxed pitch gratings. These relaxed pitch which are usually used in IBO or DBO targets. Beyond this "simple" LELE case, we will explore the capability of the CDSEM to measure overlay even if not at final patterning, at litho level. We will assess the hybridization of DBO and CDSEM for reference to optical tools after final patterning. We will show that these reference data can be used to validate the DBO overlay results (correctables and residual fingerprints).

Evaluating diffraction-based overlay

Science.gov (United States)

Li, Jie; Tan, Asher; Jung, JinWoo; Goelzer, Gary; Smith, Nigel; Hu, Jiangtao; Ham, Boo-Hyun; Kwak, Min-Cheol; Kim, Cheol-Hong; Nam, Suk-Woo

2012-03-01

We evaluate diffraction-based overlay (DBO) metrology using two test wafers. The test wafers have different film stacks designed to test the quality of DBO data under a range of film conditions. We present DBO results using traditional empirical approach (eDBO). eDBO relies on linear response of the reflectance with respect to the overlay displacement within a small range. It requires specially designed targets that consist of multiple pads with programmed shifts. It offers convenience of quick recipe setup since there is no need to establish a model. We measure five DBO targets designed with different pitches and programmed shifts. The correlations of five eDBO targets and the correlation of eDBO to image-based overlay are excellent. The targets of 800nm and 600nm pitches have better dynamic precision than targets of 400nm pitch, which agrees with simulated results on signal/noise ratio. 3σ of less than 0.1nm is achieved for both wafers using the best configured targets. We further investigate the linearity assumption of eDBO algorithm. Simulation results indicate that as the pitch of DBO targets gets smaller, the nonlinearity error, i.e., the error in the overlay measurement results caused by deviation from ideal linear response, becomes bigger. We propose a nonlinearity correction (NLC) by including higher order terms in the optical response. The new algorithm with NLC improves measurement consistency for DBO targets of same pitch but different programmed shift, due to improved accuracy. The results from targets with different pitches, however, are improved marginally, indicating the presence of other error sources.

Chitosan-adjuvanted Mycoplasma gallisepticum bacterin via intraocular administration enhances Mycoplasma gallisepticum protection in commercial layers.

Science.gov (United States)

Limsatanun, A; Sasipreeyajan, J; Pakpinyo, S

2018-06-01

Mycoplasma gallisepticum (MG) causes respiratory signs and economic losses in the poultry industry. MG vaccination is one of the effective prevention and control measures that have been used around the world. Our previous study demonstrated that chitosan-adjuvanted MG bacterin could effectively reduce pathological lesions induced by MG and that chitosan could be used as an adjuvant in MG bacterin. The present study determining the efficacy of MG bacterins against the Thai MG strain was based on vaccine programs. Seven groups (25 layers/group) were received MG bacterins containing 0.5% chitosan or a commercial bacterin via intramuscular (IM) or intraocular (IO) route at 6 and 10 wk of age. Sham-negative and sham-positive controls were groups 1 and 2, respectively. Group 3: IM route of chitosan bacterin followed by IM route of chitosan bacterin; group 4: commercial bacterin via IM route followed by chitosan bacterin via IO route; group 5: commercial bacterin via IM route followed by commercial bacterin via IM route; group 6: chitosan bacterin via IM followed by chitosan bacterin via IO route; and group 7: chitosan bacterin via IO route followed by chitosan bacterin via IO route were determined. At 16 wk of age, all groups, excluding group 1, were challenged intratracheally with 0.1 mL containing Thai MG strain 107 colony-forming unit. At 17, 18, and 20 wk of age, 5 birds in each group were bled for serological testing and swabbed at the choanal cleft for the quantitative real-time PCR assay, the euthanized and necropsied. The results showed that birds vaccinated with a commercial intramuscular bacterin followed by an intraocularly chitosan adjuvant bacterin showed the best protection against the MG challenge. The study indicated that chitosan could be the effective mucosal adjuvant and increased the effectiveness of MG bacterin.

Perceived effects of coloured overlays on reading material in persons with albinism

Directory of Open Access Journals (Sweden)

N. T. Makgaba

2008-12-01

Full Text Available Persons with albinism often complain of glare when reading. They may therefore benefit from coloured filter overlays just as they benefit from tinted lenses. The purpose of this study was to assess the effectof coloured overlays on print perception in persons with oculocutaneous albinism (OCA.   Fifty subjects were included in this study, their ages ranged from 12 to 31 years with a mean of 16.12 years (SD = ± 4.56 years.  Following refraction and subsequent compensation for refractive errors, subjective perception of print was examined with the subject looking at the Wilkins® reading rate test chart with and without colored filter overlay/s.  The subjects were asked to respond to questions previously used in a questionnaire by Wilkins (2001. The percentage frequencies of positive (beneficial responses were used to decide whether or not a particular overlay would enhance reading performance.  McNemar’s test was used to establish significant differences between responses to questions without and with overlays. All single overlays gave greater percentages of positive responses (92.0-97.2% than without overlay (85.2%.  The single overlay that provided the highest positive responses was blue (97.2% and the least was purple (92.0%. All double overlays, except grey/grey (82.0% gave greater positive responses than without overlay (85.2%. Aqua/blue gave the greatest positive responses (possible benefits (97.2%, followed by rose/rose (96.8%.  Comparing the responses without overlay with single and double overlays, the difference in responses to the five questions was only significant (p < 0.05 with regard to brightness of the surface. The results suggest that overlays provided a more glare-free reading surface than without an overlay. It was, therefore concluded that the best advantage of the coloured overlays was in glare reduction.  Although this study showed that there were more subjects who preferred single blue and aqua/blue double

Robotic weld overlay coatings for erosion control

Science.gov (United States)

The erosion of materials by the impact of solid particles has received increasing attention during the past twenty years. Recently, research has been initiated with the event of advanced coal conversion processes in which erosion plays an important role. The resulting damage, termed Solid Particle Erosion (SPE), is of concern primarily because of the significantly increased operating costs which result in material failures. Reduced power plant efficiency due to solid particle erosion of boiler tubes and waterfalls has led to various methods to combat SPE. One method is to apply coatings to the components subjected to erosive environments. Protective weld overlay coatings are particularly advantageous in terms of coating quality. The weld overlay coatings are essentially immune to spallation due to a strong metallurgical bond with the substrate material. By using powder mixtures, multiple alloys can be mixed in order to achieve the best performance in an erosive environment. However, a review of the literature revealed a lack of information on weld overlay coating performance in erosive environments which makes the selection of weld overlay alloys a difficult task. The objective of this project is to determine the effects of weld overlay coating composition and microstructure on erosion resistance. These results will lead to a better understanding of erosion mitigation in CFB's.

Ablative overlays for Space Shuttle leading edge ascent heat protection

Science.gov (United States)

Strauss, E. L.

1975-01-01

Ablative overlays were evaluated via a plasma-arc simulation of the ascent pulse on the leading edge of the Space Shuttle Orbiter. Overlay concepts included corkboard, polyisocyanurate foam, low-density Teflon, epoxy, and subliming salts. Their densities ranged from 4.9 to 81 lb per cu ft, and the thicknesses varied from 0.107 to 0.330 in. Swept-leading-edge models were fabricated from 30-lb per cu ft silicone-based ablators. The overlays were bonded to maintain the surface temperature of the base ablator below 500 F during ascent. Foams provided minimum-weight overlays, and subliming salts provided minimum-thickness overlays. Teflon left the most uniform surface after ascent heating.

Tack coat optimization for HMA overlays laboratory testing.

Science.gov (United States)

2008-09-01

Interface bonding between hot-mix asphalt (HMA) overlays and Portland cement concrete (PCC) pavements can be one of the most : significant factors affecting overlay service life. Various factors may affect the bonding condition at the interface, incl...

Accuracy optimization with wavelength tunability in overlay imaging technology

Science.gov (United States)

Lee, Honggoo; Kang, Yoonshik; Han, Sangjoon; Shim, Kyuchan; Hong, Minhyung; Kim, Seungyoung; Lee, Jieun; Lee, Dongyoung; Oh, Eungryong; Choi, Ahlin; Kim, Youngsik; Marciano, Tal; Klein, Dana; Hajaj, Eitan M.; Aharon, Sharon; Ben-Dov, Guy; Lilach, Saltoun; Serero, Dan; Golotsvan, Anna

2018-03-01

As semiconductor manufacturing technology progresses and the dimensions of integrated circuit elements shrink, overlay budget is accordingly being reduced. Overlay budget closely approaches the scale of measurement inaccuracies due to both optical imperfections of the measurement system and the interaction of light with geometrical asymmetries of the measured targets. Measurement inaccuracies can no longer be ignored due to their significant effect on the resulting device yield. In this paper we investigate a new approach for imaging based overlay (IBO) measurements by optimizing accuracy rather than contrast precision, including its effect over the total target performance, using wavelength tunable overlay imaging metrology. We present new accuracy metrics based on theoretical development and present their quality in identifying the measurement accuracy when compared to CD-SEM overlay measurements. The paper presents the theoretical considerations and simulation work, as well as measurement data, for which tunability combined with the new accuracy metrics is shown to improve accuracy performance.

Multi-level Reconfigurable Self-organization in Overlay Services

NARCIS (Netherlands)

Pournaras, E.

2013-01-01

Large-scale decentralized systems organized in overlay networks are complex to manage. Such systems integrate organizational complexity in the application-level resulting in low abstraction and modularity in their services. This thesis introduces a multi-level conceptual architecture for overlay

Strategic intelligence on emerging technologies: Scientometric overlay mapping

NARCIS (Netherlands)

Rotolo, D.; Rafols, I.; Hopkins, M.M.; Leydesdorff, L.

This paper examines the use of scientometric overlay mapping as a tool of “strategic intelligence” to aid the governing of emerging technologies. We develop an integrative synthesis of different overlay mapping techniques and associated perspectives on technological emergence across geographical,

RADAR PPI Scope Overlay

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — RADAR PPI Scope Overlays are used to position a RADAR image over a station at the correct resolution. The archive maintains several different RADAR resolution types,...

Exploring overlay journals: the RIOJA project

CERN Multimedia

CERN. Geneva

2007-01-01

Researchers in cosmology and astrophysics depend on the arXiv repository for the registration and dissemination of their work, as well as for current awareness, yet they continue to submit papers to journals for review. Could rapid quality certification be overlaid directly onto the arXiv repository? This presentation introduces the RIOJA (Repository Interface to Overlaid Journal Archives) project, on which a group of cosmology researchers from the UK is working with UCL Library Services and Cornell University. The project is creating a tool to support the overlay of journals onto repositories, and will demonstrate a cosmology journal overlaid on top of arXiv. RIOJA will also work with the cosmology community to explore the social and economic aspects of journal overlay in this discipline: what other value, besides the quality stamp, does journal publication typically add? What are the costs of the ideal overlay journal for this community, and how could those costs be recovered? Would researchers real...

Overlay improvements using a real time machine learning algorithm

Science.gov (United States)

Schmitt-Weaver, Emil; Kubis, Michael; Henke, Wolfgang; Slotboom, Daan; Hoogenboom, Tom; Mulkens, Jan; Coogans, Martyn; ten Berge, Peter; Verkleij, Dick; van de Mast, Frank

2014-04-01

While semiconductor manufacturing is moving towards the 14nm node using immersion lithography, the overlay requirements are tightened to below 5nm. Next to improvements in the immersion scanner platform, enhancements in the overlay optimization and process control are needed to enable these low overlay numbers. Whereas conventional overlay control methods address wafer and lot variation autonomously with wafer pre exposure alignment metrology and post exposure overlay metrology, we see a need to reduce these variations by correlating more of the TWINSCAN system's sensor data directly to the post exposure YieldStar metrology in time. In this paper we will present the results of a study on applying a real time control algorithm based on machine learning technology. Machine learning methods use context and TWINSCAN system sensor data paired with post exposure YieldStar metrology to recognize generic behavior and train the control system to anticipate on this generic behavior. Specific for this study, the data concerns immersion scanner context, sensor data and on-wafer measured overlay data. By making the link between the scanner data and the wafer data we are able to establish a real time relationship. The result is an inline controller that accounts for small changes in scanner hardware performance in time while picking up subtle lot to lot and wafer to wafer deviations introduced by wafer processing.

Residual stress reduction in the penetration nozzle weld joint by overlay welding

International Nuclear Information System (INIS)

Jiang, Wenchun; Luo, Yun; Wang, B.Y.; Tu, S.T.; Gong, J.M.

2014-01-01

Highlights: • Residual stress reduction in penetration weld nozzle by overlay welding was studied. • The overlay weld can decrease the residual stress in the weld root. • Long overlay welding is proposed in the actual welding. • Overlay weld to decrease residual stress is more suitable for thin nozzle. - Abstract: Stress corrosion cracking (SCC) in the penetration nozzle weld joint endangers the structural reliability of pressure vessels in nuclear and chemical industries. How to decrease the residual stress is very critical to ensure the structure integrity. In this paper, a new method, which uses overlay welding on the inner surface of nozzle, is proposed to decrease the residual stresses in the penetration joint. Finite element simulation is used to study the change of weld residual stresses before and after overlay welding. It reveals that this method can mainly decrease the residual stress in the weld root. Before overlay welding, large tensile residual stresses are generated in the weld root. After overlay weld, the tensile hoop stress in weld root has been decreased about 45%, and the radial stress has been decreased to compressive stress, which is helpful to decrease the susceptibility to SCC. With the increase of overlay welding length, the residual stress in weld root has been greatly decreased, and thus the long overlay welding is proposed in the actual welding. It also finds that this method is more suitable for thin nozzle rather than thick nozzle

Improving concrete overlay construction.

Science.gov (United States)

2010-03-01

Several road construction projects involving concrete overlays at the state and county levels in Iowa in 2009 were studied for : construction techniques and methods. The projects that were evaluated consisted of sites in four Iowa counties: Osceola, ...

Wafer edge overlay control solution for N7 and beyond

Science.gov (United States)

van Haren, Richard; Calado, Victor; van Dijk, Leon; Hermans, Jan; Kumar, Kaushik; Yamashita, Fumiko

2018-03-01

Historically, the on-product overlay performance close to the wafer edge is lagging with respect to the inner part of the wafer. The reason for this is that wafer processing is less controlled close to the wafer edge as opposed to the rest of the wafer. It is generally accepted that Chemical Vapor Deposition (CVD) of stressed layers that cause wafer warp, wafer table contamination, Chemical Mechanical Polishing (CMP), and Reactive Ion Etch (RIE) may deteriorate the overlay performance and/or registration close to the wafer edge. For the N7 technology node and beyond, it is anticipated that the tight on-product overlay specification is required across the full wafer which includes the edge region. In this work, we highlight one contributor that may negatively impact the on-product overlay performance, namely the etch step. The focus will be mainly on the wafer edge region but the remaining part of the wafer is considered as well. Three use-cases are examined: multiple Litho-Etch steps (LEn), contact hole layer etch, and the copper dual damascene etch. We characterize the etch contribution by considering the overlay measurement after resist development inspect (ADI) and after etch inspect (AEI). We show that the Yieldstar diffraction based overlay (μDBO) measurements can be utilized to characterize the etch contribution to the overlay budget. The effects of target asymmetry as well as overlay shifts are considered and compared with SEM measurements. Based on the results above, we propose a control solution aiming to reduce or even eliminate the delta between ADI and AEI. By doing so, target/mark to device offsets due to etch might be avoided.

Fundamentals of overlay measurement and inspection using scanning electron-microscope

Science.gov (United States)

Kato, T.; Okagawa, Y.; Inoue, O.; Arai, K.; Yamaguchi, S.

2013-04-01

Scanning electron-microscope (SEM) has been successfully applied to CD measurement as promising tools for qualifying and controlling quality of semiconductor devices in in-line manufacturing process since 1985. Furthermore SEM is proposed to be applied to in-die overlay monitor in the local area which is too small to be measured by optical overlay measurement tools any more, when the overlay control limit is going to be stringent and have un-ignorable dependence on device pattern layout, in-die location, and singular locations in wafer edge, etc. In this paper, we proposed new overlay measurement and inspection system to make an effective use of in-line SEM image, in consideration of trade-off between measurement uncertainty and measurement pattern density in each SEM conditions. In parallel, we make it clear that the best hybrid overlay metrology is in considering each tool's technology portfolio.

64nm pitch metal1 double patterning metrology: CD and OVL control by SEMCD, image based overlay and diffraction based overlay

Science.gov (United States)

Ducoté, Julien; Dettoni, Florent; Bouyssou, Régis; Le-Gratiet, Bertrand; Carau, Damien; Dezauzier, Christophe

2015-03-01

Patterning process control of advanced nodes has required major changes over the last few years. Process control needs of critical patterning levels since 28nm technology node is extremely aggressive showing that metrology accuracy/sensitivity must be finely tuned. The introduction of pitch splitting (Litho-Etch-Litho-Etch) at 14FDSOInm node requires the development of specific metrologies to adopt advanced process control (for CD, overlay and focus corrections). The pitch splitting process leads to final line CD uniformities that are a combination of the CD uniformities of the two exposures, while the space CD uniformities are depending on both CD and OVL variability. In this paper, investigations of CD and OVL process control of 64nm minimum pitch at Metal1 level of 14FDSOI technology, within the double patterning process flow (Litho, hard mask etch, line etch) are presented. Various measurements with SEMCD tools (Hitachi), and overlay tools (KT for Image Based Overlay - IBO, and ASML for Diffraction Based Overlay - DBO) are compared. Metrology targets are embedded within a block instanced several times within the field to perform intra-field process variations characterizations. Specific SEMCD targets were designed for independent measurement of both line CD (A and B) and space CD (A to B and B to A) for each exposure within a single measurement during the DP flow. Based on those measurements correlation between overlay determined with SEMCD and with standard overlay tools can be evaluated. Such correlation at different steps through the DP flow is investigated regarding the metrology type. Process correction models are evaluated with respect to the measurement type and the intra-field sampling.

Electronic structure of uranium overlayers on magnesium and aluminium

Science.gov (United States)

Gouder, T.

1997-06-01

We studied U overlayers on polycrystalline Mg and Al by X-ray and ultra-violet photoelectron spectroscopies (XPS and UPS, respectively), and compared the mode of growth and the evolution of the electronic structure as a function of coverage. The goal of this work was to detect localization, or at least correlation effects, in U overlayers and U substrate near surface alloys, which were expected to occur because of the reduced U 5f bandwidth in these systems. On Mg, U deposits as a pure overlayer without any interdiffusion, while on Al spontaneous interdiffusion takes place. The U 4f spectra of {U}/{Mg} show only weak correlation satellites. Nevertheless, the asymmetrical shape of the U 4f peak indicates 5f band narrowing. On Al, strong correlation satellites are observed in addition to plasmon loss features. It seems that U-substrate interactions promote correlation effects, while the reduced coordination in overlayers plays a less important role. UPS valence-band (VB) spectra of the two systems look remarkably similar. They do not show any correlation satellites. With decreasing overlayer thickness the 5f peak narrows, which is attributed to 5f band narrowing at the surface.

High-volume manufacturing device overlay process control

Science.gov (United States)

Lee, Honggoo; Han, Sangjun; Woo, Jaeson; Lee, DongYoung; Song, ChangRock; Heo, Hoyoung; Brinster, Irina; Choi, DongSub; Robinson, John C.

2017-03-01

Overlay control based on DI metrology of optical targets has been the primary basis for run-to-run process control for many years. In previous work we described a scenario where optical overlay metrology is performed on metrology targets on a high frequency basis including every lot (or most lots) at DI. SEM based FI metrology is performed ondevice in-die as-etched on an infrequent basis. Hybrid control schemes of this type have been in use for many process nodes. What is new is the relative size of the NZO as compared to the overlay spec, and the need to find more comprehensive solutions to characterize and control the size and variability of NZO at the 1x nm node: sampling, modeling, temporal frequency and control aspects, as well as trade-offs between SEM throughput and accuracy.

Inoculation effects on root-colonizing arbuscular mycorrhizal fungal communities spread beyond directly inoculated plants

Science.gov (United States)

Krak, Karol; Vosátka, Miroslav; Püschel, David; Štorchová, Helena

2017-01-01

Inoculation with arbuscular mycorrhizal fungi (AMF) may improve plant performance at disturbed sites, but inoculation may also suppress root colonization by native AMF and decrease the diversity of the root-colonizing AMF community. This has been shown for the roots of directly inoculated plants, but little is known about the stability of inoculation effects, and to which degree the inoculant and the inoculation-induced changes in AMF community composition spread into newly emerging seedlings that were not in direct contact with the introduced propagules. We addressed this topic in a greenhouse experiment based on the soil and native AMF community of a post-mining site. Plants were cultivated in compartmented pots with substrate containing the native AMF community, where AMF extraradical mycelium radiating from directly inoculated plants was allowed to inoculate neighboring plants. The abundances of the inoculated isolate and of native AMF taxa were monitored in the roots of the directly inoculated plants and the neighboring plants by quantitative real-time PCR. As expected, inoculation suppressed root colonization of the directly inoculated plants by other AMF taxa of the native AMF community and also by native genotypes of the same species as used for inoculation. In the neighboring plants, high abundance of the inoculant and the suppression of native AMF were maintained. Thus, we demonstrate that inoculation effects on native AMF propagate into plants that were not in direct contact with the introduced inoculum, and are therefore likely to persist at the site of inoculation. PMID:28738069

Inoculation effects on root-colonizing arbuscular mycorrhizal fungal communities spread beyond directly inoculated plants.

Directory of Open Access Journals (Sweden)

Martina Janoušková

Full Text Available Inoculation with arbuscular mycorrhizal fungi (AMF may improve plant performance at disturbed sites, but inoculation may also suppress root colonization by native AMF and decrease the diversity of the root-colonizing AMF community. This has been shown for the roots of directly inoculated plants, but little is known about the stability of inoculation effects, and to which degree the inoculant and the inoculation-induced changes in AMF community composition spread into newly emerging seedlings that were not in direct contact with the introduced propagules. We addressed this topic in a greenhouse experiment based on the soil and native AMF community of a post-mining site. Plants were cultivated in compartmented pots with substrate containing the native AMF community, where AMF extraradical mycelium radiating from directly inoculated plants was allowed to inoculate neighboring plants. The abundances of the inoculated isolate and of native AMF taxa were monitored in the roots of the directly inoculated plants and the neighboring plants by quantitative real-time PCR. As expected, inoculation suppressed root colonization of the directly inoculated plants by other AMF taxa of the native AMF community and also by native genotypes of the same species as used for inoculation. In the neighboring plants, high abundance of the inoculant and the suppression of native AMF were maintained. Thus, we demonstrate that inoculation effects on native AMF propagate into plants that were not in direct contact with the introduced inoculum, and are therefore likely to persist at the site of inoculation.

Location-Aware Cross-Layer Design Using Overlay Watermarks

Directory of Open Access Journals (Sweden)

Paul Ho

2007-04-01

Full Text Available A new orthogonal frequency division multiplexing (OFDM system embedded with overlay watermarks for location-aware cross-layer design is proposed in this paper. One major advantage of the proposed system is the multiple functionalities the overlay watermark provides, which includes a cross-layer signaling interface, a transceiver identification for position-aware routing, as well as its basic role as a training sequence for channel estimation. Wireless terminals are typically battery powered and have limited wireless communication bandwidth. Therefore, efficient collaborative signal processing algorithms that consume less energy for computation and less bandwidth for communication are needed. Transceiver aware of its location can also improve the routing efficiency by selective flooding or selective forwarding data only in the desired direction, since in most cases the location of a wireless host is unknown. In the proposed OFDM system, location information of a mobile for efficient routing can be easily derived when a unique watermark is associated with each individual transceiver. In addition, cross-layer signaling and other interlayer interactive information can be exchanged with a new data pipe created by modulating the overlay watermarks. We also study the channel estimation and watermark removal techniques at the physical layer for the proposed overlay OFDM. Our channel estimator iteratively estimates the channel impulse response and the combined signal vector from the overlay OFDM signal. Cross-layer design that leads to low-power consumption and more efficient routing is investigated.

Analysis of an Orthotropic Deck Stiffened with a Cement-Based Overlay

DEFF Research Database (Denmark)

Walter, Rasmus; Olesen, John Forbes; Stang, Henrik

2007-01-01

decks. A solution might be to enhance the stiffness of the traditional orthotropic bridge deck by using a cement-based overlay. In this paper, an orthotropic steel bridge deck stiffened with a cement-based overlay is analyzed. The analysis is based on nonlinear fracture mechanics, and utilizes......Over the past years, with increasing traffic volumes and higher wheel loads, fatigue damage in steel parts of typical orthotropic steel bridge decks has been experienced on heavily trafficked routes. A demand exists to find a durable system to increase the fatigue safety of orthotropic steel bridge...... the finite-element method. The stiffness of the steel deck reinforced with an overlay depends highly on the composite action. The composite action is closely related to cracking of the overlay and interfacial cracking between the overlay and underlying steel plate (debonding). As an example, a real size...

Virtual overlay metrology for fault detection supported with integrated metrology and machine learning

Science.gov (United States)

Lee, Hong-Goo; Schmitt-Weaver, Emil; Kim, Min-Suk; Han, Sang-Jun; Kim, Myoung-Soo; Kwon, Won-Taik; Park, Sung-Ki; Ryan, Kevin; Theeuwes, Thomas; Sun, Kyu-Tae; Lim, Young-Wan; Slotboom, Daan; Kubis, Michael; Staecker, Jens

2015-03-01

While semiconductor manufacturing moves toward the 7nm node for logic and 15nm node for memory, an increased emphasis has been placed on reducing the influence known contributors have toward the on product overlay budget. With a machine learning technique known as function approximation, we use a neural network to gain insight to how known contributors, such as those collected with scanner metrology, influence the on product overlay budget. The result is a sufficiently trained function that can approximate overlay for all wafers exposed with the lithography system. As a real world application, inline metrology can be used to measure overlay for a few wafers while using the trained function to approximate overlay vector maps for the entire lot of wafers. With the approximated overlay vector maps for all wafers coming off the track, a process engineer can redirect wafers or lots with overlay signatures outside the standard population to offline metrology for excursion validation. With this added flexibility, engineers will be given more opportunities to catch wafers that need to be reworked, resulting in improved yield. The quality of the derived corrections from measured overlay metrology feedback can be improved using the approximated overlay to trigger, which wafers should or shouldn't be, measured inline. As a development or integration engineer the approximated overlay can be used to gain insight into lots and wafers used for design of experiments (DOE) troubleshooting. In this paper we will present the results of a case study that follows the machine learning function approximation approach to data analysis, with production overlay measured on an inline metrology system at SK hynix.

Plastic collapse moment for pipe repaired with weld overlay

International Nuclear Information System (INIS)

Li, Yinsheng; Hasegawa, Kunio; Shibuya, Akira; Deardorff, Arthur

2009-01-01

The Weld Overlay has been used in several countries as an effective method to repair the stress corrosion cracks in nuclear power plant piping. However, the method to evaluate the plastic collapse stress for the pipe repaired with Weld Overlay has not been proposed and the limit load criterion for single uniform material has been used to design its structure by now. In this paper, the equations to evaluate the plastic collapse moment for the pipe repaired with Weld Overlay have been derived considering two layer materials. Moreover, several numerical examples are given to show the validity of Weld Overlay. The equations given in this paper are simple to use like the limit load criterion showed in present standards such as JSME Rules on Fitness-for-Service for Nuclear Power Plants or ASME Boiler and Pressure Vessel Code Section XI, and they can not only be used to evaluate the fracture of the pipe, but also be applied to design the weld structure. (author)

Application of Interfacial Propagation and Kinking Crack Concept to ECC/Concrete Overlay Repair System

Directory of Open Access Journals (Sweden)

Yaw ChiaHwan

2014-01-01

Full Text Available Research on the application of ultraductile engineered cementitious composite (ECC as overlay in the repair of deteriorated concrete structures is performed in this paper. Also, interfacial crack kinking and trapping mechanism experimentally observed in ECC/concrete overlay repair system are described by comparison of toughness and energy release rate. The mechanism involves cycles of extension, kinking, and arrest of interfacial crack into the overlay. Experimental testing of overlay repair system reveals significant improvements in load carrying capacity and ductility over conventional concrete overlay. The commonly observed overlay system failure mode of delamination or spalling is eliminated when ECC is applied. These failure modes are suppressed when ECC is used as an ideal and durable candidate overlay repair material.

Assessment and prediction of drying shrinkage cracking in bonded mortar overlays

Energy Technology Data Exchange (ETDEWEB)

Beushausen, Hans, E-mail: hans.beushausen@uct.ac.za; Chilwesa, Masuzyo

2013-11-15

Restrained drying shrinkage cracking was investigated on composite beams consisting of substrate concrete and bonded mortar overlays, and compared to the performance of the same mortars when subjected to the ring test. Stress development and cracking in the composite specimens were analytically modeled and predicted based on the measurement of relevant time-dependent material properties such as drying shrinkage, elastic modulus, tensile relaxation and tensile strength. Overlay cracking in the composite beams could be very well predicted with the analytical model. The ring test provided a useful qualitative comparison of the cracking performance of the mortars. The duration of curing was found to only have a minor influence on crack development. This was ascribed to the fact that prolonged curing has a beneficial effect on tensile strength at the onset of stress development, but is in the same time not beneficial to the values of tensile relaxation and elastic modulus. -- Highlights: •Parameter study on material characteristics influencing overlay cracking. •Analytical model gives good quantitative indication of overlay cracking. •Ring test presents good qualitative indication of overlay cracking. •Curing duration has little effect on overlay cracking.

Assessment and prediction of drying shrinkage cracking in bonded mortar overlays

International Nuclear Information System (INIS)

Beushausen, Hans; Chilwesa, Masuzyo

2013-01-01

Restrained drying shrinkage cracking was investigated on composite beams consisting of substrate concrete and bonded mortar overlays, and compared to the performance of the same mortars when subjected to the ring test. Stress development and cracking in the composite specimens were analytically modeled and predicted based on the measurement of relevant time-dependent material properties such as drying shrinkage, elastic modulus, tensile relaxation and tensile strength. Overlay cracking in the composite beams could be very well predicted with the analytical model. The ring test provided a useful qualitative comparison of the cracking performance of the mortars. The duration of curing was found to only have a minor influence on crack development. This was ascribed to the fact that prolonged curing has a beneficial effect on tensile strength at the onset of stress development, but is in the same time not beneficial to the values of tensile relaxation and elastic modulus. -- Highlights: •Parameter study on material characteristics influencing overlay cracking. •Analytical model gives good quantitative indication of overlay cracking. •Ring test presents good qualitative indication of overlay cracking. •Curing duration has little effect on overlay cracking

On Adding Structure to Unstructured Overlay Networks

Science.gov (United States)

Leitão, João; Carvalho, Nuno A.; Pereira, José; Oliveira, Rui; Rodrigues, Luís

Unstructured peer-to-peer overlay networks are very resilient to churn and topology changes, while requiring little maintenance cost. Therefore, they are an infrastructure to build highly scalable large-scale services in dynamic networks. Typically, the overlay topology is defined by a peer sampling service that aims at maintaining, in each process, a random partial view of peers in the system. The resulting random unstructured topology is suboptimal when a specific performance metric is considered. On the other hand, structured approaches (for instance, a spanning tree) may optimize a given target performance metric but are highly fragile. In fact, the cost for maintaining structures with strong constraints may easily become prohibitive in highly dynamic networks. This chapter discusses different techniques that aim at combining the advantages of unstructured and structured networks. Namely we focus on two distinct approaches, one based on optimizing the overlay and another based on optimizing the gossip mechanism itself.

Development of new engine bearings with overlay consisting of solid lubricants; Kotai junkatsu overlay tsuki engine yo suberi jikuuke zairyo no kaihatsu

Energy Technology Data Exchange (ETDEWEB)

Kanayama, H; Kawakami, S; Gohara, C [Taiho Kogyo Co. Ltd., Aichi (Japan); Fuwa, Y; Michioka, H [Toyota Motor Corp., Aichi (Japan)

1997-10-01

Recently, modern engines have a tendency for higher output and longer periods. As a result , higher bearing performance is required. For this reason, we have developed the new conceptual overlay consisting of solid lubricants and thermosetting plastics. This paper describes the performance of engine bearings with the new overlay. 5 refs., 13 figs., 5 tabs.

Computer vision and soft computing for automatic skull-face overlay in craniofacial superimposition.

Science.gov (United States)

Campomanes-Álvarez, B Rosario; Ibáñez, O; Navarro, F; Alemán, I; Botella, M; Damas, S; Cordón, O

2014-12-01

Craniofacial superimposition can provide evidence to support that some human skeletal remains belong or not to a missing person. It involves the process of overlaying a skull with a number of ante mortem images of an individual and the analysis of their morphological correspondence. Within the craniofacial superimposition process, the skull-face overlay stage just focuses on achieving the best possible overlay of the skull and a single ante mortem image of the suspect. Although craniofacial superimposition has been in use for over a century, skull-face overlay is still applied by means of a trial-and-error approach without an automatic method. Practitioners finish the process once they consider that a good enough overlay has been attained. Hence, skull-face overlay is a very challenging, subjective, error prone, and time consuming part of the whole process. Though the numerical assessment of the method quality has not been achieved yet, computer vision and soft computing arise as powerful tools to automate it, dramatically reducing the time taken by the expert and obtaining an unbiased overlay result. In this manuscript, we justify and analyze the use of these techniques to properly model the skull-face overlay problem. We also present the automatic technical procedure we have developed using these computational methods and show the four overlays obtained in two craniofacial superimposition cases. This automatic procedure can be thus considered as a tool to aid forensic anthropologists to develop the skull-face overlay, automating and avoiding subjectivity of the most tedious task within craniofacial superimposition. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Achieving optimum diffraction based overlay performance

Science.gov (United States)

Leray, Philippe; Laidler, David; Cheng, Shaunee; Coogans, Martyn; Fuchs, Andreas; Ponomarenko, Mariya; van der Schaar, Maurits; Vanoppen, Peter

2010-03-01

Diffraction Based Overlay (DBO) metrology has been shown to have significantly reduced Total Measurement Uncertainty (TMU) compared to Image Based Overlay (IBO), primarily due to having no measurable Tool Induced Shift (TIS). However, the advantages of having no measurable TIS can be outweighed by increased susceptibility to WIS (Wafer Induced Shift) caused by target damage, process non-uniformities and variations. The path to optimum DBO performance lies in having well characterized metrology targets, which are insensitive to process non-uniformities and variations, in combination with optimized recipes which take advantage of advanced DBO designs. In this work we examine the impact of different degrees of process non-uniformity and target damage on DBO measurement gratings and study their impact on overlay measurement accuracy and precision. Multiple wavelength and dual polarization scatterometry are used to characterize the DBO design performance over the range of process variation. In conclusion, we describe the robustness of DBO metrology to target damage and show how to exploit the measurement capability of a multiple wavelength, dual polarization scatterometry tool to ensure the required measurement accuracy for current and future technology nodes.

KML Super Overlay to WMS Translator

Science.gov (United States)

Plesea, Lucian

2007-01-01

This translator is a server-based application that automatically generates KML super overlay configuration files required by Google Earth for map data access via the Open Geospatial Consortium WMS (Web Map Service) standard. The translator uses a set of URL parameters that mirror the WMS parameters as much as possible, and it also can generate a super overlay subdivision of any given area that is only loaded when needed, enabling very large areas of coverage at very high resolutions. It can make almost any dataset available as a WMS service visible and usable in any KML application, without the need to reformat the data.

Longer Lasting Bridge Deck Overlays

Science.gov (United States)

2018-04-01

The objective of this report is to determine the most effective method for bridge deck overlay construction and repair by assessing current practices; examining new products and technologies; and reviewing NCHRP (National Cooperative Highway Research...

Diffraction-based overlay measurement on dedicated mark using rigorous modeling method

Science.gov (United States)

Lu, Hailiang; Wang, Fan; Zhang, Qingyun; Chen, Yonghui; Zhou, Chang

2012-03-01

Diffraction Based Overlay (DBO) is widely evaluated by numerous authors, results show DBO can provide better performance than Imaging Based Overlay (IBO). However, DBO has its own problems. As well known, Modeling based DBO (mDBO) faces challenges of low measurement sensitivity and crosstalk between various structure parameters, which may result in poor accuracy and precision. Meanwhile, main obstacle encountered by empirical DBO (eDBO) is that a few pads must be employed to gain sufficient information on overlay-induced diffraction signature variations, which consumes more wafer space and costs more measuring time. Also, eDBO may suffer from mark profile asymmetry caused by processes. In this paper, we propose an alternative DBO technology that employs a dedicated overlay mark and takes a rigorous modeling approach. This technology needs only two or three pads for each direction, which is economic and time saving. While overlay measurement error induced by mark profile asymmetry being reduced, this technology is expected to be as accurate and precise as scatterometry technologies.

Examination of overlay pipe weldments removed from the Hatch-2 reactor

International Nuclear Information System (INIS)

Park, J.Y.; Kupperman, D.S.; Shack, W.J.

1985-02-01

Laboratory ultrasonic examination (UT), dye penetrant examination (PT), metallography, and sensitization measurements were performed on Type 304 stainless steel overlay pipe weldments from the Hatch-2 BWR to determine the effectiveness of UT through overlays and the effects of the overlays on crack propagation in the weldments. Little correlation was observed between the results of earlier in-service ultrasonic inspection and the results of PT and destructive examination. Considerable difficulty was encountered in correctly detecting the presence of cracks by UT in the laboratory. Blunting of the crack tip by the weld overlay was observed, but there was no evidence of tearing or throughwall extension of the crack beyond the blunted region

Tack coat optimization for HMA overlays : accelerated pavement test report.

Science.gov (United States)

2009-02-01

Interface bonding between hot-mix asphalt (HMA) overlays and Portland cement concrete (PCC) pavements is one : of the most significant factors affecting overlay service life. This study was performed to quantify the effects of HMA type, : tack coat t...

Modern methods of overlay welding for corrosion protection of power generating equipment

International Nuclear Information System (INIS)

Ershov, A.V.; Shul'man, I.E.; Potapov, N.N.

1989-01-01

Methods for overlay welding of inner surfaces of power equipment for corrosion protection are analysed. Various methods of electroslag overlay welding by a band electrode (overlay welding by two-electrode bands by a wide band with magnetic control, by an electrode band with high melting velocity) are marked to be the most perspective for cladding of NPP vessel equipment

VT Data - Overlay District 20170419, Colchester

Data.gov (United States)

Vermont Center for Geographic Information — The following Overlay Districts are included in the data:General Development Four Commercial DistrictGeneral Development Four Openspace DistrictShoreland...

Overlay Spectrum Sharing using Improper Gaussian Signaling

KAUST Repository

Amin, Osama

2016-11-30

Improper Gaussian signaling (IGS) scheme has been recently shown to provide performance improvements in interference limited networks as opposed to the conventional proper Gaussian signaling (PGS) scheme. In this paper, we implement the IGS scheme in overlay cognitive radio system, where the secondary transmitter broadcasts a mixture of two different signals. The first signal is selected from the PGS scheme to match the primary message transmission. On the other hand, the second signal is chosen to be from the IGS scheme in order to reduce the interference effect on the primary receiver. We then optimally design the overlay cognitive radio to maximize the secondary link achievable rate while satisfying the primary network quality of service requirements. In particular, we consider full and partial channel knowledge scenarios and derive the feasibility conditions of operating the overlay cognitive radio systems. Moreover, we derive the superiority conditions of the IGS schemes over the PGS schemes supported with closed form expressions for the corresponding power distribution and the circularity coefficient and parameters. Simulation results are provided to support our theoretical derivations.

Change in antimicrobial susceptibility of Mycoplasma gallisepticum field isolates.

Science.gov (United States)

Gharaibeh, Saad; Al-Rashdan, Mohammad

2011-06-02

This study compares the antimicrobial susceptibility over time between two groups of Mycoplasma gallisepticum (MG) isolates from the same geographical area. Minimum inhibitory concentration of 13 antimicrobials was determined against two groups of MG isolates from chickens. Group 1 strains (n=22) were isolated in 2004-2005 while group 2 strains (n=7) were isolated in 2007-2008. Minimum inhibitory concentration 50 for group 1 versus group 2 was 4/4, 0.5/0.5, ≤ 0.031/≥ 64, ≤ 0.031/2, ≤ 0.031/0.125, 1/0.5, 1/1, ≤ 0.031/≤ 0.031, ≤ 0.031/2, ≤ 0.031/2, 1/4, ≤ 0.031/0.062, and 0.062/2 μg/ml against gentamicin, spectinomycin, erythromycin, tilmicosin, tylosin, florfenicol, thiamphenicol, tiamulin, ciprofloxacin, enrofloxacin, chlortetracycline, doxycycline, and oxytetracycline, respectively. There was a statistically significant increase in resistance of group 2 to erythromycin, tilmicosin, tylosin, ciprofloxacin, enrofloxacin, chlortetracycline, doxycycline, and oxytetracycline. This dramatic increase in resistance against 8 antimicrobials belonging to three different families of antimicrobials in a relatively short period of time appears to be rare and of concern. The cause of this increased resistance observed in group 2 of MG isolates was not determined and should be further investigated. Monitoring of MG field strain susceptibility is highly recommended to implement successful treatment and prophylaxis programs in endemic areas. Copyright © 2011 Elsevier B.V. All rights reserved.

Application of advanced diffraction based optical metrology overlay capabilities for high-volume manufacturing

Science.gov (United States)

Chen, Kai-Hsiung; Huang, Guo-Tsai; Hsieh, Hung-Chih; Ni, Wei-Feng; Chuang, S. M.; Chuang, T. K.; Ke, Chih-Ming; Huang, Jacky; Rao, Shiuan-An; Cumurcu Gysen, Aysegul; d'Alfonso, Maxime; Yueh, Jenny; Izikson, Pavel; Soco, Aileen; Wu, Jon; Nooitgedagt, Tjitte; Ottens, Jeroen; Kim, Yong Ho; Ebert, Martin

2017-03-01

On-product overlay requirements are becoming more challenging with every next technology node due to the continued decrease of the device dimensions and process tolerances. Therefore, current and future technology nodes require demanding metrology capabilities such as target designs that are robust towards process variations and high overlay measurement density (e.g. for higher order process corrections) to enable advanced process control solutions. The impact of advanced control solutions based on YieldStar overlay data is being presented in this paper. Multi patterning techniques are applied for critical layers and leading to additional overlay measurement demands. The use of 1D process steps results in the need of overlay measurements relative to more than one layer. Dealing with the increased number of overlay measurements while keeping the high measurement density and metrology accuracy at the same time presents a challenge for high volume manufacturing (HVM). These challenges are addressed by the capability to measure multi-layer targets with the recently introduced YieldStar metrology tool, YS350. On-product overlay results of such multi-layers and standard targets are presented including measurement stability performance.

VT Data - Overlay District 20070306, Marlboro

Data.gov (United States)

Vermont Center for Geographic Information — Cartographic version of overlay district (surface water buffer), Marlboro, Vermont. Base zoning districts are in a separate shapefile. Data were originally created...

Visualization of Disciplinary Profiles: Enhanced Science Overlay Maps

Directory of Open Access Journals (Sweden)

Stephen Carley

2017-08-01

Full Text Available Purpose: The purpose of this study is to modernize previous work on science overlay maps by updating the underlying citation matrix, generating new clusters of scientific disciplines, enhancing visualizations, and providing more accessible means for analysts to generate their own maps. Design/methodology/approach: We use the combined set of 2015 Journal Citation Reports for the Science Citation Index (n of journals = 8,778 and the Social Sciences Citation Index (n = 3,212 for a total of 11,365 journals. The set of Web of Science Categories in the Science Citation Index and the Social Sciences Citation Index increased from 224 in 2010 to 227 in 2015. Using dedicated software, a matrix of 227 × 227 cells is generated on the basis of whole-number citation counting. We normalize this matrix using the cosine function. We first develop the citing-side, cosine-normalized map using 2015 data and VOSviewer visualization with default parameter values. A routine for making overlays on the basis of the map (“wc15.exe” is available at http://www.leydesdorff.net/wc15/index.htm. Findings: Findings appear in the form of visuals throughout the manuscript. In Figures 1–9 we provide basemaps of science and science overlay maps for a number of companies, universities, and technologies. Research limitations: As Web of Science Categories change and/or are updated so is the need to update the routine we provide. Also, to apply the routine we provide users need access to the Web of Science. Practical implications: Visualization of science overlay maps is now more accurate and true to the 2015 Journal Citation Reports than was the case with the previous version of the routine advanced in our paper. Originality/value: The routine we advance allows users to visualize science overlay maps in VOSviewer using data from more recent Journal Citation Reports.

Epidemiological survey on Mycoplasma gallisepticum and M. synoviae by multiplex PCR in commercial poultry Investigação epidemiológica de Mycoplasma gallisepticum e M. synoviae por PCR Multiplex em estabelecimentos comerciais de aves

Directory of Open Access Journals (Sweden)

Marcos Roberto Buim

2009-07-01

Full Text Available Mycoplasmas are important avian pathogens, which cause respiratory and joint diseases that result in large economic losses in Brazilian and world-wide poultry industry. This investigation regarding the main species of mycoplasmas, Mycoplasma gallisepticum (MG and M. synoviae (MS, responsible for the above mentioned conditions, was carried out through PCR Multiplex analysis. One thousand and forty-six (1,046 samples of tracheal swabs and piped embryos were collected from 33 farms with laying hens, breeders, broilers or hatchery, located in the Brazilian states of São Paulo, Paraná and Pernambuco, where respiratory problems or drops in egg production had occurred. The MG and MS prevalence on the farms was 72.7%. These results indicated (1 high dissemination of mycoplasmas in the evaluated farms, with predominance of MS, either as single infectious agent or associated with other mycoplasmas in 20 farms (60.6%, and (2 an increase of MS and decrease of MG infection in Brazilian commercial poultry.Os Micoplasmas são importantes patógenos aviários que causam doenças respiratórias e de articulações que resultam em grandes perdas econômicas para a indústria avícola brasileira e mundial. O estudo das principais espécies de Mycoplasma, Mycoplasma gallisepticum (MG e M. synoviae (MS, responsáveis pelas doenças mencionadas acima, foram analisadas pela técnica de PCR Multiplex. Foram colhidas 1046 amostras de suabe traqueal e embriões bicados de 33 estabelecimentos de aves de postura, matrizes, frangos de corte e um incubatório, localizados nos Estados brasileiros de São Paulo, Paraná e Pernambuco, as quais apresentavam problemas respiratórios ou queda na produção de ovos. A prevalência de MS e MG nas granjas foi de 72,7%. Os resultados indicaram uma alta disseminação de Mycoplasma nas granjas avaliadas, com predominância de MS, como um único agente infeccioso ou associado com outros micoplasmas em 20 granjas (60,6%. Assim, este

Axial compression behavior of concrete masonry wallettes strengthened with cement mortar overlays

Directory of Open Access Journals (Sweden)

F. L. De Oliveira

Full Text Available This paper presents the results of a series of axial compression tests on concrete block wallettes coated with cement mortar overlays. Different types of mortars and combinations with steel welded meshes and fibers were tested. The experimental results were discussed based on different theoretical approaches: analytical and Finite Element Method models. The main conclusions are: a the application of mortar overlays increases the wall strength, but not in a uniform manner; b the strengthening efficiency of wallettes loaded in axial compression is not proportional to the overlay mortar strength because it can be affected by the failure mechanisms of the wall; c steel mesh reinforced overlays in combination with high strength mortar show better efficiency, because the steel mesh mitigates the damage effects in the block wall and in the overlays themselves; d simplified theoretical methods of analysis as described in this paper can give satisfactory predictions of masonry wall behavior up to a certain level.

Development and immunogenicity of recombinant GapA(+) Mycoplasma gallisepticum vaccine strain ts-11 expressing infectious bronchitis virus-S1 glycoprotein and chicken interleukin-6.

Science.gov (United States)

Shil, Pollob K; Kanci, Anna; Browning, Glenn F; Markham, Philip F

2011-04-12

Mycoplasma gallisepticum (MG) is a major pathogen of poultry that causes chronic respiratory disease in chickens and infectious sinusitis in turkeys. A live attenuated vaccine, ts-11, has been used for the control of MG in several countries. The efficacy of this vaccine is highly dose dependent and the flock antibody response is weak. To improve the functionality of the vaccine and investigate its potential as a delivery vector for foreign antigens and immunomodulatory proteins, we developed a derivative of ts-11 expressing infectious bronchitis virus-S1 glycoprotein (IBV-S1) and releasing chicken interleukin-6 into the extracellular milieu (MG ts-11 C3 (+CS)) using a transposon-based delivery vector. Following administration of MG ts-11 C3 (+CS) to chickens by eye-drop, an antibody response to MG and IBV-S1, as determined by the rapid serum agglutination test (RSA) and Western blotting, respectively, could be detected. Birds inoculated with the recombinant vaccine had significantly enhanced weight gain and were partially protected against damage by pathogenic IBV. These results indicate that the ChIL-6 released by MG ts-11 C3 (+CS) may have had a non-specific effect on growth rate. They also suggest that ts-11 is a promising vaccine vector, capable of delivering heterologous protective antigens, and may also provide non-specific benefits when engineered to express immunomodulatory proteins. With some improvements in the expression system, it could be used to induce a targeted immune response against specific mucosal pathogens, and co-expression of several antigens would allow development of a novel multivalent vaccine. Copyright © 2011 Elsevier Ltd. All rights reserved.

Latex-modified fiber-reinforced concrete bridge deck overlay : construction/interim report.

Science.gov (United States)

1993-06-01

Latex-modified concrete (LMC) is Portland cement concrete (PCC) with an admixture of latex. LMC is considered to be nearly impermeable to chlorides and is extensively used to construct bridge deck overlays. Unfortunately, some of these overlays have ...

A Persistent Structured Hierarchical Overlay Network to Counter Intentional Churn Attack

Directory of Open Access Journals (Sweden)

Ramanpreet Kaur

2016-01-01

Full Text Available The increased use of structured overlay network for a variety of applications has attracted a lot of attention from both research community and attackers. However, the structural constraints, open nature (anybody can join and anybody may leave, and unreliability of its participant nodes significantly affect the performance of these applications and make it vulnerable to a variety of attacks such as eclipse, Sybil, and churn. One attack to compromise the service availability in overlay network is intentional churn (join/leave attack, where a large number of malicious users will join and leave the overlay network so frequently that the entire structure collapses and becomes unavailable. The focus of this paper is to provide a new robust, efficient, and scalable hierarchical overlay architecture that will counter these attacks by providing a structure that can accommodate the fleeting behaviour of nodes without causing much structural inconsistencies. The performance evaluation showed that the proposed architecture has more failure resilience and self-organization as compared to chord based architecture. Experimental results have demonstrated that the effect of failures on an overlay is proportional to the size of failure.

Characterisation of hydrocarbonaceous overlayers important in metal-catalysed selective hydrogenation reactions

Energy Technology Data Exchange (ETDEWEB)

Lennon, David; Warringham, Robbie [School of Chemistry, Joseph Black Building, University of Glasgow, Glasgow G12 8QQ (United Kingdom); Guidi, Tatiana [ISIS Facility, STFC Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire OX11 0QX (United Kingdom); Parker, Stewart F., E-mail: stewart.parker@stfc.ac.uk [ISIS Facility, STFC Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire OX11 0QX (United Kingdom)

2013-12-12

Highlights: • Inelastic neutron scattering spectroscopy of a commercial dehydrogenation catalyst. • The overlayer present on the catalyst is predominantly aliphatic. • A population of strongly hydrogen bonded hydroxyls is also present. - Abstract: The hydrogenation of alkynes to alkenes over supported metal catalysts is an important industrial process and it has been shown that hydrocarbonaceous overlayers are important in controlling selectivity profiles of metal-catalysed hydrogenation reactions. As a model system, we have selected propyne hydrogenation over a commercial Pd(5%)/Al{sub 2}O{sub 3} catalyst. Inelastic neutron scattering studies show that the C–H stretching mode ranges from 2850 to 3063 cm{sup −1}, indicating the mostly aliphatic nature of the overlayer and this is supported by the quantification of the carbon and hydrogen on the surface. There is also a population of strongly hydrogen-bonded hydroxyls, their presence would indicate that the overlayer probably contains some oxygen functionality. There is little evidence for any olefinic or aromatic species. This is distinctly different from the hydrogen-poor overlayers that are deposited on Ni/Al{sub 2}O{sub 3} catalysts during methane reforming.

Comparison of Inoculation with the InoqulA and WASP Automated Systems with Manual Inoculation

Science.gov (United States)

Croxatto, Antony; Dijkstra, Klaas; Prod'hom, Guy

2015-01-01

The quality of sample inoculation is critical for achieving an optimal yield of discrete colonies in both monomicrobial and polymicrobial samples to perform identification and antibiotic susceptibility testing. Consequently, we compared the performance between the InoqulA (BD Kiestra), the WASP (Copan), and manual inoculation methods. Defined mono- and polymicrobial samples of 4 bacterial species and cloudy urine specimens were inoculated on chromogenic agar by the InoqulA, the WASP, and manual methods. Images taken with ImagA (BD Kiestra) were analyzed with the VisionLab version 3.43 image analysis software to assess the quality of growth and to prevent subjective interpretation of the data. A 3- to 10-fold higher yield of discrete colonies was observed following automated inoculation with both the InoqulA and WASP systems than that with manual inoculation. The difference in performance between automated and manual inoculation was mainly observed at concentrations of >106 bacteria/ml. Inoculation with the InoqulA system allowed us to obtain significantly more discrete colonies than the WASP system at concentrations of >107 bacteria/ml. However, the level of difference observed was bacterial species dependent. Discrete colonies of bacteria present in 100- to 1,000-fold lower concentrations than the most concentrated populations in defined polymicrobial samples were not reproducibly recovered, even with the automated systems. The analysis of cloudy urine specimens showed that InoqulA inoculation provided a statistically significantly higher number of discrete colonies than that with WASP and manual inoculation. Consequently, the automated InoqulA inoculation greatly decreased the requirement for bacterial subculture and thus resulted in a significant reduction in the time to results, laboratory workload, and laboratory costs. PMID:25972424

On cooperative and efficient overlay network evolution based on a group selection pattern.

Science.gov (United States)

Nakao, Akihiro; Wang, Yufeng

2010-04-01

In overlay networks, the interplay between network structure and dynamics remains largely unexplored. In this paper, we study dynamic coevolution between individual rational strategies (cooperative or defect) and the overlay network structure, that is, the interaction between peer's local rational behaviors and the emergence of the whole network structure. We propose an evolutionary game theory (EGT)-based overlay topology evolution scheme to drive a given overlay into the small-world structure (high global network efficiency and average clustering coefficient). Our contributions are the following threefold: From the viewpoint of peers' local interactions, we explicitly consider the peer's rational behavior and introduce a link-formation game to characterize the social dilemma of forming links in an overlay network. Furthermore, in the evolutionary link-formation phase, we adopt a simple economic process: Each peer keeps one link to a cooperative neighbor in its neighborhood, which can slightly speed up the convergence of cooperation and increase network efficiency; from the viewpoint of the whole network structure, our simulation results show that the EGT-based scheme can drive an arbitrary overlay network into a fully cooperative and efficient small-world structure. Moreover, we compare our scheme with a search-based economic model of network formation and illustrate that our scheme can achieve the experimental and analytical results in the latter model. In addition, we also graphically illustrate the final overlay network structure; finally, based on the group selection model and evolutionary set theory, we theoretically obtain the approximate threshold of cost and draw the conclusion that the small value of the average degree and the large number of the total peers in an overlay network facilitate the evolution of cooperation.

Overlay control methodology comparison: field-by-field and high-order methods

Science.gov (United States)

Huang, Chun-Yen; Chiu, Chui-Fu; Wu, Wen-Bin; Shih, Chiang-Lin; Huang, Chin-Chou Kevin; Huang, Healthy; Choi, DongSub; Pierson, Bill; Robinson, John C.

2012-03-01

Overlay control in advanced integrated circuit (IC) manufacturing is becoming one of the leading lithographic challenges in the 3x and 2x nm process nodes. Production overlay control can no longer meet the stringent emerging requirements based on linear composite wafer and field models with sampling of 10 to 20 fields and 4 to 5 sites per field, which was the industry standard for many years. Methods that have emerged include overlay metrology in many or all fields, including the high order field model method called high order control (HOC), and field by field control (FxFc) methods also called correction per exposure. The HOC and FxFc methods were initially introduced as relatively infrequent scanner qualification activities meant to supplement linear production schemes. More recently, however, it is clear that production control is also requiring intense sampling, similar high order and FxFc methods. The added control benefits of high order and FxFc overlay methods need to be balanced with the increased metrology requirements, however, without putting material at risk. Of critical importance is the proper control of edge fields, which requires intensive sampling in order to minimize signatures. In this study we compare various methods of overlay control including the performance levels that can be achieved.

Faster diffraction-based overlay measurements with smaller targets using 3D gratings

Science.gov (United States)

Li, Jie; Kritsun, Oleg; Liu, Yongdong; Dasari, Prasad; Volkman, Catherine; Hu, Jiangtao

2012-03-01

Diffraction-based overlay (DBO) technologies have been developed to address the overlay metrology challenges for 22nm technology node and beyond. Most DBO technologies require specially designed targets that consist of multiple measurement pads, which consume too much space and increase measurement time. The traditional empirical approach (eDBO) using normal incidence spectroscopic reflectometry (NISR) relies on linear response of the reflectance with respect to overlay displacement within a small range. It offers convenience of quick recipe setup since there is no need to establish a model. However it requires three or four pads per direction (x or y) which adds burden to throughput and target size. Recent advances in modeling capability and computation power enabled mDBO, which allows overlay measurement with reduced number of pads, thus reducing measurement time and DBO target space. In this paper we evaluate the performance of single pad mDBO measurements using two 3D targets that have different grating shapes: squares in boxes and L-shapes in boxes. Good overlay sensitivities are observed for both targets. The correlation to programmed shifts and image-based overlay (IBO) is excellent. Despite the difference in shapes, the mDBO results are comparable for square and L-shape targets. The impact of process variations on overlay measurements is studied using a focus and exposure matrix (FEM) wafer. Although the FEM wafer has larger process variations, the correlation of mDBO results with IBO measurements is as good as the normal process wafer. We demonstrate the feasibility of single pad DBO measurements with faster throughput and smaller target size, which is particularly important in high volume manufacturing environment.

Driving imaging and overlay performance to the limits with advanced lithography optimization

Science.gov (United States)

Mulkens, Jan; Finders, Jo; van der Laan, Hans; Hinnen, Paul; Kubis, Michael; Beems, Marcel

2012-03-01

Immersion lithography is being extended to 22-nm and even below. Next to generic scanner system improvements, application specific solutions are needed to follow the requirements for CD control and overlay. Starting from the performance budgets, this paper discusses how to improve (in volume manufacturing environment) CDU towards 1-nm and overlay towards 3-nm. The improvements are based on deploying the actuator capabilities of the immersion scanner. The latest generation immersion scanners have extended the correction capabilities for overlay and imaging, offering freeform adjustments of lens, illuminator and wafer grid. In order to determine the needed adjustments the recipe generation per user application is based on a combination wafer metrology data and computational lithography methods. For overlay, focus and CD metrology we use an angle resolved optical scatterometer.

A study of swing-curve physics in diffraction-based overlay

Science.gov (United States)

Bhattacharyya, Kaustuve; den Boef, Arie; Storms, Greet; van Heijst, Joost; Noot, Marc; An, Kevin; Park, Noh-Kyoung; Jeon, Se-Ra; Oh, Nang-Lyeom; McNamara, Elliott; van de Mast, Frank; Oh, SeungHwa; Lee, Seung Yoon; Hwang, Chan; Lee, Kuntack

2016-03-01

With the increase of process complexity in advanced nodes, the requirements of process robustness in overlay metrology continues to tighten. Especially with the introduction of newer materials in the film-stack along with typical stack variations (thickness, optical properties, profile asymmetry etc.), the signal formation physics in diffraction-based overlay (DBO) becomes an important aspect to apply in overlay metrology target and recipe selection. In order to address the signal formation physics, an effort is made towards studying the swing-curve phenomena through wavelength and polarizations on production stacks using simulations as well as experimental technique using DBO. The results provide a wealth of information on target and recipe selection for robustness. Details from simulation and measurements will be reported in this technical publication.

Simultaneous overlay and CD measurement for double patterning: scatterometry and RCWA approach

Science.gov (United States)

Li, Jie; Liu, Zhuan; Rabello, Silvio; Dasari, Prasad; Kritsun, Oleg; Volkman, Catherine; Park, Jungchul; Singh, Lovejeet

2009-03-01

As optical lithography advances to 32 nm technology node and beyond, double patterning technology (DPT) has emerged as an attractive solution to circumvent the fundamental optical limitations. DPT poses unique demands on critical dimension (CD) uniformity and overlay control, making the tolerance decrease much faster than the rate at which critical dimension shrinks. This, in turn, makes metrology even more challenging. In the past, multi-pad diffractionbased overlay (DBO) using empirical approach has been shown to be an effective approach to measure overlay error associated with double patterning [1]. In this method, registration errors for double patterning were extracted from specially designed diffraction targets (three or four pads for each direction); CD variation is assumed negligible within each group of adjacent pads and not addressed in the measurement. In another paper, encouraging results were reported with a first attempt at simultaneously extracting overlay and CD parameters using scatterometry [2]. In this work, we apply scatterometry with a rigorous coupled wave analysis (RCWA) approach to characterize two double-patterning processes: litho-etch-litho-etch (LELE) and litho-freeze-litho-etch (LFLE). The advantage of performing rigorous modeling is to reduce the number of pads within each measurement target, thus reducing space requirement and improving throughput, and simultaneously extract CD and overlay information. This method measures overlay errors and CDs by fitting the optical signals with spectra calculated from a model of the targets. Good correlation is obtained between the results from this method and that of several reference techniques, including empirical multi-pad DBO, CD-SEM, and IBO. We also perform total measurement uncertainty (TMU) analysis to evaluate the overall performance. We demonstrate that scatterometry provides a promising solution to meet the challenging overlay metrology requirement in DPT.

VMCast: A VM-Assisted Stability Enhancing Solution for Tree-Based Overlay Multicast.

Directory of Open Access Journals (Sweden)

Weidong Gu

Full Text Available Tree-based overlay multicast is an effective group communication method for media streaming applications. However, a group member's departure causes all of its descendants to be disconnected from the multicast tree for some time, which results in poor performance. The above problem is difficult to be addressed because overlay multicast tree is intrinsically instable. In this paper, we proposed a novel stability enhancing solution, VMCast, for tree-based overlay multicast. This solution uses two types of on-demand cloud virtual machines (VMs, i.e., multicast VMs (MVMs and compensation VMs (CVMs. MVMs are used to disseminate the multicast data, whereas CVMs are used to offer streaming compensation. The used VMs in the same cloud datacenter constitute a VM cluster. Each VM cluster is responsible for a service domain (VMSD, and each group member belongs to a specific VMSD. The data source delivers the multicast data to MVMs through a reliable path, and MVMs further disseminate the data to group members along domain overlay multicast trees. The above approach structurally improves the stability of the overlay multicast tree. We further utilized CVM-based streaming compensation to enhance the stability of the data distribution in the VMSDs. VMCast can be used as an extension to existing tree-based overlay multicast solutions, to provide better services for media streaming applications. We applied VMCast to two application instances (i.e., HMTP and HCcast. The results show that it can obviously enhance the stability of the data distribution.

Effects of Spectral Overlays on Reading Performance of Brazilian Elementary School Children.

Science.gov (United States)

Garcia, Ana Carla Oliveira; Momensohn-Santos, Teresa Maria; Vilhena, Douglas de Araújo

2018-03-20

To investigate the effects of spectral overlays on reading performance of Brazilian elementary school children. Sixty-eight children (aged 9-12 years) enrolled in the 5th and 6th grade were included in the study. The Rate of Reading Test (RRT - Brazilian Portuguese version) was used to evaluate reading speed and the Irlen Reading Perceptual Scale was used to allocate the sample according to reading difficulty/discomfort symptoms and to define the optimal spectral overlays. A total of 13% of the children presented an improvement of at least 15% in reading speed with the use of spectral overlays. Pupils with severe reading difficulties tended to have more improvement in RRT with spectral overlays. Children with severe reading discomfort obtained the highest gains in RRT, with an average of 9.6% improvement with intervention, compared to a decrease of -8.2% in the control group. Participants with severe discomfort had an odds ratio of 3.36 to improve reading speed with intervention compared to the control group. The use of spectral overlays can improve reading performance, particularly in those children with severe visual discomfort. © 2018 S. Karger AG, Basel.

Modelling of control options for an outbreak of Mycoplasma gallisepticum in egg production: a decision support tool.

Science.gov (United States)

Bennett, R M; McClement, I; McFarlane, I D; Parker, C D

2013-12-01

Mycoplasma gallisepticum (MG) is a bacterium that causes respiratory disease in chickens, leading to reduced egg production. A dynamic simulation model was developed that can be used to assess the costs and benefits of control using antimicrobials or vaccination in caged or free range systems. The intended users are veterinarians and egg producers. A user interface is provided for input of flock specific parameters. The economic consequence of an MG outbreak is expressed as a reduction in expected egg output. The model predicts that either vaccination or microbial treatment can approximately halve potential losses from MG in some circumstances. Sensitivity analysis is used to test assumptions about infection rate and timing of an outbreak. Feedback from veterinarians points to the value of the model as a discussion tool with producers. Copyright © 2013 Elsevier Ltd. All rights reserved.

Holistic metrology qualification extension and its application to characterize overlay targets with asymmetric effects

Science.gov (United States)

Dos Santos Ferreira, Olavio; Sadat Gousheh, Reza; Visser, Bart; Lie, Kenrick; Teuwen, Rachel; Izikson, Pavel; Grzela, Grzegorz; Mokaberi, Babak; Zhou, Steve; Smith, Justin; Husain, Danish; Mandoy, Ram S.; Olvera, Raul

2018-03-01

Ever increasing need for tighter on-product overlay (OPO), as well as enhanced accuracy in overlay metrology and methodology, is driving semiconductor industry's technologists to innovate new approaches to OPO measurements. In case of High Volume Manufacturing (HVM) fabs, it is often critical to strive for both accuracy and robustness. Robustness, in particular, can be challenging in metrology since overlay targets can be impacted by proximity of other structures next to the overlay target (asymmetric effects), as well as symmetric stack changes such as photoresist height variations. Both symmetric and asymmetric contributors have impact on robustness. Furthermore, tweaking or optimizing wafer processing parameters for maximum yield may have an adverse effect on physical target integrity. As a result, measuring and monitoring physical changes or process abnormalities/artefacts in terms of new Key Performance Indicators (KPIs) is crucial for the end goal of minimizing true in-die overlay of the integrated circuits (ICs). IC manufacturing fabs often relied on CD-SEM in the past to capture true in-die overlay. Due to destructive and intrusive nature of CD-SEMs on certain materials, it's desirable to characterize asymmetry effects for overlay targets via inline KPIs utilizing YieldStar (YS) metrology tools. These KPIs can also be integrated as part of (μDBO) target evaluation and selection for final recipe flow. In this publication, the Holistic Metrology Qualification (HMQ) flow was extended to account for process induced (asymmetric) effects such as Grating Imbalance (GI) and Bottom Grating Asymmetry (BGA). Local GI typically contributes to the intrafield OPO whereas BGA typically impacts the interfield OPO, predominantly at the wafer edge. Stack height variations highly impact overlay metrology accuracy, in particular in case of multi-layer LithoEtch Litho-Etch (LELE) overlay control scheme. Introducing a GI impact on overlay (in nm) KPI check quantifies the

Effectiveness of polymer bridge deck overlays in highway noise reduction : technical paper.

Science.gov (United States)

2016-04-01

The Kansas Department of Transportation (KDOT) began placing multi-layer polymer bridge deck overlays in 1999 and at the present time have over 200 in service. A few years after placing the overlays, individuals indicated that they noticed how quiet ...

Intermittent-contact scanning capacitance microscopy imaging and modeling for overlay metrology

International Nuclear Information System (INIS)

Mayo, S.; Kopanski, J. J.; Guthrie, W. F.

1998-01-01

Overlay measurements of the relative alignment between sequential layers are one of the most critical issues for integrated circuit (IC) lithography. We have implemented on an AFM platform a new intermittent-contact scanning capacitance microscopy (IC-SCM) mode that is sensitive to the tip proximity to an IC interconnect, thus making it possible to image conductive structures buried under planarized dielectric layers. Such measurements can be used to measure IC metal-to-resist lithography overlay. The AFM conductive cantilever probe oscillating in a vertical plane was driven at frequency ω, below resonance. By measuring the tip-to-sample capacitance, the SCM signal is obtained as the difference in capacitance, ΔC(ω), at the amplitude extremes. Imaging of metallization structures was obtained with a bars-in-bars aluminum structure embedded in a planarized dielectric layer 1 μm thick. We have also modeled, with a two-dimensional (2D) electrostatic field simulator, IC-SCM overlay data of a metallization structure buried under a planarized dielectric having a patterned photoresist layer deposited on it. This structure, which simulates the metal-to-resist overlay between sequential IC levels, allows characterization of the technique sensitivity. The capacitance profile across identical size electrically isolated or grounded metal lines embedded in a dielectric was shown to be different. The floating line shows capacitance enhancement at the line edges, with a minimum at the line center. The grounded line shows a single capacitance maximum located at the line center, with no edge enhancement. For identical line dimensions, the capacitance is significantly larger for grounded lines making them easier to image. A nonlinear regression algorithm was developed to extract line center and overlay parameters with approximately 3 nm resolution at the 95% confidence level, showing the potential of this technique for sub-micrometer critical dimension metrology. Symmetric test

Solidification paths in modified Inconel 625 weld overlay material

DEFF Research Database (Denmark)

Chandrasekaran, Karthik; Tiedje, Niels Skat; Hald, John

2009-01-01

Inconel 625 is commonly used for overlay welding to protect the base metal against high temperature corrosion. The efficiency of corrosion protection depends on effective mixing of the overlay weld with the base metal and the subsequent segregation of alloy elements during solidification....... Metallographic analysis of solidified samples of Inconel 625 with addition of selected elements is compared with thermodynamic modelling of segregation during solidification. The influence of changes in the melt chemistry on the formation of intermetallic phases during solidification is shown. In particular...

Dynamics of a metal overlayer on metallic substrates: High temperature effects

International Nuclear Information System (INIS)

Rahman, T.S.; Black, J.E.; Tian, Zeng Ju

1992-01-01

We have explored the structure and the dynamics of a bimetallic system consisting of a hexagonal (almost) overlayer of Ag on a square lattice (Ni(100) and Cu(100)), as a function of the surface temperature. In each case the structure is ''nearly'' incommensurate giving rise to a low frequency Goldstone mode. Also, the overlayer atoms slosh back and forth over the substrate in a corrugated fashion. The calculated dispersion of the Ag/metal vertical mode, at room temperature, is in excellent agreement with experimental data. At higher temperatures floater atoms appear on top of the overlayer displaying a variety of cluster formations and also exchanges with the substrate atoms leading to surface disordering, interdiffusion and melting

Multi-wavelength approach towards on-product overlay accuracy and robustness

Science.gov (United States)

Bhattacharyya, Kaustuve; Noot, Marc; Chang, Hammer; Liao, Sax; Chang, Ken; Gosali, Benny; Su, Eason; Wang, Cathy; den Boef, Arie; Fouquet, Christophe; Huang, Guo-Tsai; Chen, Kai-Hsiung; Cheng, Kevin; Lin, John

2018-03-01

Success of diffraction-based overlay (DBO) technique1,4,5 in the industry is not just for its good precision and low toolinduced shift, but also for the measurement accuracy2 and robustness that DBO can provide. Significant efforts are put in to capitalize on the potential that DBO has to address measurement accuracy and robustness. Introduction of many measurement wavelength choices (continuous wavelength) in DBO is one of the key new capabilities in this area. Along with the continuous choice of wavelengths, the algorithms (fueled by swing-curve physics) on how to use these wavelengths are of high importance for a robust recipe setup that can avoid the impact from process stack variations (symmetric as well as asymmetric). All these are discussed. Moreover, another aspect of boosting measurement accuracy and robustness is discussed that deploys the capability to combine overlay measurement data from multiple wavelength measurements. The goal is to provide a method to make overlay measurements immune from process stack variations and also to report health KPIs for every measurement. By combining measurements from multiple wavelengths, a final overlay measurement is generated. The results show a significant benefit in accuracy and robustness against process stack variation. These results are supported by both measurement data as well as simulation from many product stacks.

[Design of SCM inoculation device].

Science.gov (United States)

Qian, Mingli; Xie, Haiyuan

2014-01-01

The first step of bacilli culture is inoculation bacteria on culture medium. Designing a device to increase efficiency of inoculation is significative. The new device is controlled by SCM. The stepper motor can drive the culture medium rotating, accelerating, decelerating, overturn and suspending. The device is high practicability and efficient, let inoculation easy for operator.

A hybrid solution using computational prediction and measured data to accurately determine process corrections with reduced overlay sampling

Science.gov (United States)

Noyes, Ben F.; Mokaberi, Babak; Mandoy, Ram; Pate, Alex; Huijgen, Ralph; McBurney, Mike; Chen, Owen

2017-03-01

Reducing overlay error via an accurate APC feedback system is one of the main challenges in high volume production of the current and future nodes in the semiconductor industry. The overlay feedback system directly affects the number of dies meeting overlay specification and the number of layers requiring dedicated exposure tools through the fabrication flow. Increasing the former number and reducing the latter number is beneficial for the overall efficiency and yield of the fabrication process. An overlay feedback system requires accurate determination of the overlay error, or fingerprint, on exposed wafers in order to determine corrections to be automatically and dynamically applied to the exposure of future wafers. Since current and future nodes require correction per exposure (CPE), the resolution of the overlay fingerprint must be high enough to accommodate CPE in the overlay feedback system, or overlay control module (OCM). Determining a high resolution fingerprint from measured data requires extremely dense overlay sampling that takes a significant amount of measurement time. For static corrections this is acceptable, but in an automated dynamic correction system this method creates extreme bottlenecks for the throughput of said system as new lots have to wait until the previous lot is measured. One solution is using a less dense overlay sampling scheme and employing computationally up-sampled data to a dense fingerprint. That method uses a global fingerprint model over the entire wafer; measured localized overlay errors are therefore not always represented in its up-sampled output. This paper will discuss a hybrid system shown in Fig. 1 that combines a computationally up-sampled fingerprint with the measured data to more accurately capture the actual fingerprint, including local overlay errors. Such a hybrid system is shown to result in reduced modelled residuals while determining the fingerprint, and better on-product overlay performance.

Cross-Genome Comparisons of Newly Identified Domains in Mycoplasma gallisepticum and Domain Architectures with Other Mycoplasma species

Directory of Open Access Journals (Sweden)

Chandra Sekhar Reddy Chilamakuri

2011-01-01

Full Text Available Accurate functional annotation of protein sequences is hampered by important factors such as the failure of sequence search methods to identify relationships and the inherent diversity in function of proteins related at low sequence similarities. Earlier, we had employed intermediate sequence search approach to establish new domain relationships in the unassigned regions of gene products at the whole genome level by taking Mycoplasma gallisepticum as a specific example and established new domain relationships. In this paper, we report a detailed comparison of the conservation status of the domain and domain architectures of the gene products that bear our newly predicted domains amongst 14 other Mycoplasma genomes and reported the probable implications for the organisms. Some of the domain associations, observed in Mycoplasma that afflict humans and other non-human primates, are involved in regulation of solute transport and DNA binding suggesting specific modes of host-pathogen interactions.

Approaches of multilayer overlay process control for 28nm FD-SOI derivative applications

Science.gov (United States)

Duclaux, Benjamin; De Caunes, Jean; Perrier, Robin; Gatefait, Maxime; Le Gratiet, Bertrand; Chapon, Jean-Damien; Monget, Cédric

2018-03-01

Derivative technology like embedded Non-Volatile Memories (eNVM) is raising new types of challenges on the "more than Moore" path. By its construction: overlay is critical across multiple layers, by its running mode: usage of high voltage are stressing leakages and breakdown, and finally with its targeted market: Automotive, Industry automation, secure transactions… which are all requesting high device reliability (typically below 1ppm level). As a consequence, overlay specifications are tights, not only between one layer and its reference, but also among the critical layers sharing the same reference. This work describes a broad picture of the key points for multilayer overlay process control in the case of a 28nm FD-SOI technology and its derivative flows. First, the alignment trees of the different flow options have been optimized using a realistic process assumptions calculation for indirect overlay. Then, in the case of a complex alignment tree involving heterogeneous scanner toolset, criticality of tool matching between reference layer and critical layers of the flow has been highlighted. Improving the APC control loops of these multilayer dependencies has been studied with simulations of feed-forward as well as implementing new rework algorithm based on multi-measures. Finally, the management of these measurement steps raises some issues for inline support and using calculations or "virtual overlay" could help to gain some tool capability. A first step towards multilayer overlay process control has been taken.

Precise X-ray and video overlay for augmented reality fluoroscopy.

Science.gov (United States)

Chen, Xin; Wang, Lejing; Fallavollita, Pascal; Navab, Nassir

2013-01-01

The camera-augmented mobile C-arm (CamC) augments any mobile C-arm by a video camera and mirror construction and provides a co-registration of X-ray with video images. The accurate overlay between these images is crucial to high-quality surgical outcomes. In this work, we propose a practical solution that improves the overlay accuracy for any C-arm orientation by: (i) improving the existing CamC calibration, (ii) removing distortion effects, and (iii) accounting for the mechanical sagging of the C-arm gantry due to gravity. A planar phantom is constructed and placed at different distances to the image intensifier in order to obtain the optimal homography that co-registers X-ray and video with a minimum error. To alleviate distortion, both X-ray calibration based on equidistant grid model and Zhang's camera calibration method are implemented for distortion correction. Lastly, the virtual detector plane (VDP) method is adapted and integrated to reduce errors due to the mechanical sagging of the C-arm gantry. The overlay errors are 0.38±0.06 mm when not correcting for distortion, 0.27±0.06 mm when applying Zhang's camera calibration, and 0.27±0.05 mm when applying X-ray calibration. Lastly, when taking into account all angular and orbital rotations of the C-arm, as well as correcting for distortion, the overlay errors are 0.53±0.24 mm using VDP and 1.67±1.25 mm excluding VDP. The augmented reality fluoroscope achieves an accurate video and X-ray overlay when applying the optimal homography calculated from distortion correction using X-ray calibration together with the VDP.

Two Dimensional Array Based Overlay Network for Balancing Load of Peer-to-Peer Live Video Streaming

International Nuclear Information System (INIS)

Ibrahimy, Abdullah Faruq Ibn; Rafiqul, Islam Md; Anwar, Farhat; Ibrahimy, Muhammad Ibn

2013-01-01

The live video data is streaming usually in a tree-based overlay network or in a mesh-based overlay network. In case of departure of a peer with additional upload bandwidth, the overlay network becomes very vulnerable to churn. In this paper, a two dimensional array-based overlay network is proposed for streaming the live video stream data. As there is always a peer or a live video streaming server to upload the live video stream data, so the overlay network is very stable and very robust to churn. Peers are placed according to their upload and download bandwidth, which enhances the balance of load and performance. The overlay network utilizes the additional upload bandwidth of peers to minimize chunk delivery delay and to maximize balance of load. The procedure, which is used for distributing the additional upload bandwidth of the peers, distributes the additional upload bandwidth to the heterogeneous strength peers in a fair treat distribution approach and to the homogeneous strength peers in a uniform distribution approach. The proposed overlay network has been simulated by Qualnet from Scalable Network Technologies and results are presented in this paper

Two Dimensional Array Based Overlay Network for Balancing Load of Peer-to-Peer Live Video Streaming

Science.gov (United States)

Faruq Ibn Ibrahimy, Abdullah; Rafiqul, Islam Md; Anwar, Farhat; Ibn Ibrahimy, Muhammad

2013-12-01

The live video data is streaming usually in a tree-based overlay network or in a mesh-based overlay network. In case of departure of a peer with additional upload bandwidth, the overlay network becomes very vulnerable to churn. In this paper, a two dimensional array-based overlay network is proposed for streaming the live video stream data. As there is always a peer or a live video streaming server to upload the live video stream data, so the overlay network is very stable and very robust to churn. Peers are placed according to their upload and download bandwidth, which enhances the balance of load and performance. The overlay network utilizes the additional upload bandwidth of peers to minimize chunk delivery delay and to maximize balance of load. The procedure, which is used for distributing the additional upload bandwidth of the peers, distributes the additional upload bandwidth to the heterogeneous strength peers in a fair treat distribution approach and to the homogeneous strength peers in a uniform distribution approach. The proposed overlay network has been simulated by Qualnet from Scalable Network Technologies and results are presented in this paper.

Overlay field application program, Pennsylvania US-119.

Science.gov (United States)

2010-11-01

The Concrete Overly Filed Application program is administered by FHWA and the National Concrete Pavement Technology Center (CP Tech Center). The overall objective of this program is to increase the awareness and knowledge of concrete overlay applicat...

Implementation and benefits of advanced process control for lithography CD and overlay

Science.gov (United States)

Zavyalova, Lena; Fu, Chong-Cheng; Seligman, Gary S.; Tapp, Perry A.; Pol, Victor

2003-05-01

Due to the rapidly reduced imaging process windows and increasingly stingent device overlay requirements, sub-130 nm lithography processes are more severely impacted than ever by systamic fault. Limits on critical dimensions (CD) and overlay capability further challenge the operational effectiveness of a mix-and-match environment using multiple lithography tools, as such mode additionally consumes the available error budgets. Therefore, a focus on advanced process control (APC) methodologies is key to gaining control in the lithographic modules for critical device levels, which in turn translates to accelerated yield learning, achieving time-to-market lead, and ultimately a higher return on investment. This paper describes the implementation and unique challenges of a closed-loop CD and overlay control solution in high voume manufacturing of leading edge devices. A particular emphasis has been placed on developing a flexible APC application capable of managing a wide range of control aspects such as process and tool drifts, single and multiple lot excursions, referential overlay control, 'special lot' handling, advanced model hierarchy, and automatic model seeding. Specific integration cases, including the multiple-reticle complementary phase shift lithography process, are discussed. A continuous improvement in the overlay and CD Cpk performance as well as the rework rate has been observed through the implementation of this system, and the results are studied.

Reduction of image-based ADI-to-AEI overlay inconsistency with improved algorithm

Science.gov (United States)

Chen, Yen-Liang; Lin, Shu-Hong; Chen, Kai-Hsiung; Ke, Chih-Ming; Gau, Tsai-Sheng

2013-04-01

In image-based overlay (IBO) measurement, the measurement quality of various measurement spectra can be judged by quality indicators and also the ADI-to-AEI similarity to determine the optimum light spectrum. However we found some IBO measured results showing erroneous indication of wafer expansion from the difference between the ADI and the AEI maps, even after their measurement spectra were optimized. To reduce this inconsistency, an improved image calculation algorithm is proposed in this paper. Different gray levels composed of inner- and outer-box contours are extracted to calculate their ADI overlay errors. The symmetry of intensity distribution at the thresholds dictated by a range of gray levels is used to determine the particular gray level that can minimize the ADI-to-AEI overlay inconsistency. After this improvement, the ADI is more similar to AEI with less expansion difference. The same wafer was also checked by the diffraction-based overlay (DBO) tool to verify that there is no physical wafer expansion. When there is actual wafer expansion induced by large internal stress, both the IBO and the DBO measurements indicate similar expansion results. The scanning white-light interference microscope was used to check the variation of wafer warpage during the ADI and AEI stages. It predicts a similar trend with the overlay difference map, confirming the internal stress.

VT Data - Cons/Rec Overlay District 20110301, Winhall

Data.gov (United States)

Vermont Center for Geographic Information — Conservation and Recreatioal Protection overaly districts for the Town of Winhall, Vermont. Other overlay districts (Transfer of Development Rights, and Scenic...

Effects of concrete moisture on polymer overlay bond over new concrete : [technical summary].

Science.gov (United States)

2015-06-01

Epoxy polymer overlays have been used for decades on existing bridge decks to protect : the deck and extend its service life. The polymer overlays ability to seal a bridge deck : is now being specified for new construction. Questions exist about t...

Bandwidth and power allocation for two-way relaying in overlay cognitive radio systems

KAUST Repository

Alsharoa, Ahmad M.; Ghazzai, Hakim; Yaacoub, Elias E.; Alouini, Mohamed-Slim

2014-01-01

In this paper, the problem of both bandwidth and power allocation for two-way multiple relay systems in overlay cognitive radio (CR) setup is investigated. In the CR overlay mode, primary users (PUs) cooperate with cognitive users (CUs) for mutual

Performance of thin bonded epoxy overlays on asphalt and concrete bridge deck surfaces.

Science.gov (United States)

2014-06-01

This study is the evaluation of two thin bonded epoxy overlays: SafeLane (marketed by Cargill), and Flexogrid : (developed by PolyCarb). SafeLane is advertised as an anti-skid/anti-icing overlay that stores deicing chemicals for : release during wint...

Combination of Bayesian Network and Overlay Model in User Modeling

Directory of Open Access Journals (Sweden)

Loc Nguyen

2009-12-01

Full Text Available The core of adaptive system is user model containing personal information such as knowledge, learning styles, goals… which is requisite for learning personalized process. There are many modeling approaches, for example: stereotype, overlay, plan recognition… but they don’t bring out the solid method for reasoning from user model. This paper introduces the statistical method that combines Bayesian network and overlay modeling so that it is able to infer user’s knowledge from evidences collected during user’s learning process.

Overlay Spectrum Sharing using Improper Gaussian Signaling

KAUST Repository

Amin, Osama; Abediseid, Walid; Alouini, Mohamed-Slim

2016-01-01

in overlay cognitive radio system, where the secondary transmitter broadcasts a mixture of two different signals. The first signal is selected from the PGS scheme to match the primary message transmission. On the other hand, the second signal is chosen

Necessity of mycorrhizal re-inoculation in the transplantation of banana in areas with precedent of inoculated canavalia with AMF

Directory of Open Access Journals (Sweden)

Jaime Enrique Simó González

2016-07-01

Full Text Available From being the banana, a mycotrophic crop and previous results on the potential of green manure inoculated as a way to mycorrhizal economic crops, this work was developed in order to assess whether a precedent Canavalia ensiformis cultivation, inoculated with efficient strains of arbuscular mycorrhizal fungi (AMF inoculation, it is necessary the banana inoculation, ‘FHIA-18’ (AAAB cultivar in the transplant field. Four treatments were evaluated: a control without application of fertilizers and other organic-mineral fertilizers (100% FOM, both without canavalia and two other treatments that are used above canavalia inoculated AMF and half also received organic-mineral fertilizer applications: (50% FOM, one of which, the banana was reinoculated in the transplant field and the other one not. The experimental design used, was randomized blocks, with four replications. The experiment ended after three productive cycles (mother plant, stems 1 and 2. Canavalia inoculated treatments and 50 % of FOM, guaranteed high yields and satisfactory nutritional content similar to that received 100 % of FOM and significantly higher than those obtained with the control treatment. This together with the values of colonization percentages and pores at both high and inoculated treatments were no significant differences between them, indicated not only the effectiveness of mycorrhizal inoculation but rather green manure inoculation was successful to inoculate bananas and re-inoculation of the same was not needed on the transplant.

The inoculation method affects colonization and performance of bacterial inoculant strains in the phytoremediation of soil contaminated with diesel oil.

Science.gov (United States)

Afzal, Muhammad; Yousaf, Sohail; Reichenauer, Thomas G; Sessitsch, Angela

2012-01-01

Plants in combination with microorganisms can remediate soils, which are contaminated with organic pollutants such as petroleum hydrocarbons. Inoculation of plants with degrading bacteria is one approach to improve remediation processes, but is often not successful due to the competition with resident microorganisms. It is therefore of high importance to address the persistence and colonization behavior of inoculant strains. The objective of this study was to determine whether the inoculation method (seed imbibement and soil inoculation) influences bacterial colonization, plant growth promotion and hydrocarbon degradation. Italian ryegrass was grown in non-sterilized soil polluted with diesel and inoculated with different alkane-degrading strains Pantoea sp. ITSI10, Pantoea sp. BTRH79 and Pseudomonas sp. MixRI75 individually as well as in combination. Inoculation generally had a beneficial effect on plant biomass production and hydrocarbon degradation, however, strains inoculated in soil performed better than applied by seed imbibement. Performance correlated with the colonization efficiency of the inoculated strains. The highest hydrocarbon degradation was observed in the treatment, in which all three strains were inoculated in combination into soil. Our study revealed that besides the degradation potential and competitive ability of inoculant strains the inoculation method plays an important role in determining the success of microbial inoculation.

SURVEILLANCE FOR NEWCASTLE DISEASE VIRUS, AVIAN INFLUENZA VIRUS AND MYCOPLASMA GALLISEPTICUM IN WILD BIRDS NEAR COMMERCIAL POULTRY FARMS SURROUNDED BY ATLANTIC RAINFOREST REMNANTS, SOUTHEASTERN BRAZIL

Directory of Open Access Journals (Sweden)

MB Guimarães

Full Text Available ABSTRACT The geographic overlap between areas of Atlantic rainforest and human activities allows interactions to occur between humans and wild and domestic animals. Despite the great importance of the domestic animal-wildlife-human interface that occurs at poultry farms in terms of public health, economic production and wildlife conservation, there are few studies in Brazil examining the distribution and health of wild birds that interact with poultry farms. From January to December 2010, mist nets were used to capture 166 free-ranging birds that were within close proximity to three poultry farms in Atlantic rainforest remnants in south-eastern Brazil. The species composition was examined, and molecular methods were used to test for avian influenza virus, Newcastle disease virus, and Mycoplasma gallisepticum. The avian communities near the poultry farms were dominated by three synanthropic species, which corresponded to 70% of all captured individuals: house sparrows Passer domesticus (33%, saffron finches (Sicalis flaveola (22%, and ruddy ground-doves (Columbina talpacoti (15%. These predominant bird species were in poor body condition (27%, were infested with feather mites (43%, or presented both conditions (23%. No evidence of infection by avian influenza virus, Newcastle disease virus or M. gallisepticum was identified in any of the studied birds. Although no evidence of the studied pathogens was, our findings demonstrate that differences in the environmental characteristics and biosecurity practices influence the wild bird community near poultry farms, which in turn may affect the health status of these synanthropic birds and strengthen their role in the transmission of pathogens.

Welding overlay analysis of dissimilar metal weld cracking of feedwater nozzle

International Nuclear Information System (INIS)

Tsai, Y.L.; Wang, Li. H.; Fan, T.W.; Ranganath, Sam; Wang, C.K.; Chou, C.P.

2010-01-01

Inspection of the weld between the feedwater nozzle and the safe end at one Taiwan BWR showed axial indications in the Alloy 182 weld. The indication was sufficiently deep that continued operation could not be justified considering the crack growth for one cycle. A weld overlay was decided to implement for restoring the structural margin. This study reviews the cracking cases of feedwater nozzle welds in other nuclear plants, and reports the lesson learned in the engineering project of this weld overlay repair. The overlay design, the FCG calculation and the stress analysis by FEM are presented to confirm that the Code Case structural margins are met. The evaluations of the effect of weld shrinkage on the attached feedwater piping are also included. A number of challenges encountered in the engineering and analysis period are proposed for future study.

Residual stress measurement in 304 stainless steel weld overlay pipes

International Nuclear Information System (INIS)

Yen, H.J.; Lin, M.C.C.; Chen, L.J.

1996-01-01

Welding overlay repair (WOR) is commonly employed to rebuild piping systems suffering from intergranular stress corrosion cracking (IGSCC). To understand the effects of this repair, it is necessary to investigate the distribution of residual stresses in the welding pipe. The overlay welding technique must induce compressive residual stress at the inner surface of the welded pipe to prevent IGSCC. To understand the bulk residual stress distribution, the stress profile as a function of location within wall is examined. In this study the full destructive residual stress measurement technique -- a cutting and sectioning method -- is used to determine the residual stress distribution. The sample is type 304 stainless steel weld overlay pipe with an outside diameter of 267 mm. A pipe segment is cut from the circular pipe; then a thin layer is removed axially from the inner to the outer surfaces until further sectioning is impractical. The total residual stress is calculated by adding the stress relieved by cutting the section away to the stress relieved by axially sectioning. The axial and hoop residual stresses are compressive at the inner surface of the weld overlay pipe. Compressive stress exists not only at the surface but is also distributed over most of the pipe's cross section. On the one hand, the maximum compressive hoop residual stress appears at the pipe's inner surface. The thermal-mechanical induced crack closure from significant compressive residual stress is discussed. This crack closure can thus prevent IGSCC very effectively

OVERLAY DENTURES: A REVIEW AND REPORT OF FOUR CASES

Directory of Open Access Journals (Sweden)

Deeksha SHARMA

2013-12-01

Full Text Available Patients with ectodermal dysplasia or having under‑ gone cleft surgery with anodontia or hypodontia, hypo‑ plastic conical teeth and patients with severely worn dentition are difficult to treat because of the poor remaining tooth structure. These patients often exhibit loss of vertical dimension of occlusion and aesthetic problems and usually need complex prosthetic treatments. Financial constraints or other priorities often restrict one from choosing the most desirable treatment. The overlay removable denture is a covering prosthesis partially supported by natural teeth, tooth roots, or dental implants, providing an efficient alter‑ native of treatment. Clinical reports describe the various applications of overlay dentures.

Inoculation of sugarcane with diazotrophic bacteria

Directory of Open Access Journals (Sweden)

Nivaldo Schultz

2014-04-01

Full Text Available The sugarcane industry, a strategic crop in Brazil, requires technological improvements in production efficiency to increase the crop energy balance. Among the various currently studied alternatives, inoculation with diazotrophic bacteria proved to be a technology with great potential. In this context, the efficiency of a mixture of bacterial inoculant was evaluated with regard to the agronomic performance and N nutrition of sugarcane. The experiment was carried out on an experimental field of Embrapa Agrobiologia, in Seropédica, Rio de Janeiro, using a randomized block, 2 × 3 factorial design (two varieties and three treatments with four replications, totaling 24 plots. The varieties RB867515 and RB72454 were tested in treatments consisting of: inoculation with diazotrophic bacteria, N-fertilized control with 120 kg ha-1 N and absolute control (no inoculation and no N fertilizer. The inoculum was composed of five strains of five diazotrophic species. The yield, dry matter accumulation, total N in the shoot dry matter and the contribution of N by biological fixation were evaluated, using the natural 15N abundance in non-inoculated sugarcane as reference. The bacterial inoculant increased the stalk yield of variety RB72454 similarly to fertilization with 120 kg ha-1 N in the harvests of plant-cane and first ratoon crops, however the contribution of biological N fixation was unchanged by inoculation, indicating that the benefits of the inoculant in sugarcane may have resulted from plant growth promotion.

Opportunistic transmitter selection for selfless overlay cognitive radios

KAUST Repository

Shaqfeh, Mohammad; Zafar, Ammar; Alnuweiri, Hussein M.; Alouini, Mohamed-Slim

2013-01-01

We propose an opportunistic strategy to grant channel access to the primary and secondary transmitters in causal selfless overlay cognitive radios over block-fading channels. The secondary transmitter helps the primary transmitter by relaying

Evaluation of Pure Aluminium Inoculated with Varying Grain Sizes of an Agro-waste based Inoculant

Directory of Open Access Journals (Sweden)

Adeyemi I. Olabisi

2017-04-01

Full Text Available Pure Aluminium and its alloy are widely utilized in Engineering and Industrial applications due to certain significant properties such as softness, ductility, corrosion resistance, and high electrical conductivity which it possesses. Addition of an agro-waste based grain refiner to the melt can alter the characteristics positively or negatively. Therefore, the aim of this paper is to investigate the inoculating capability of an agro-waste based inoculant and the effect of adding varying sizes of its grains on some of the properties of pure aluminium after solidification. The beneficial outcome of this investigation would enhance the economic value of the selected agro-waste and also broaden the applications of aluminium in Engineering. The assessed properties include; microstructure, micro hardness, ductility, and tensile strength. The agro-waste used as the grain refiner is pulverised cocoa bean shells (CBS. Three sets of test samples were produced using dry sand moulding process, with each melt having a specified grain size of the inoculant added to it (150, 225 and 300microns respectively. Ladle inoculation method was adopted. The cast samples after solidification were machined to obtain various shapes/sizes for the different analysis. The microstructural examination showed that the mechanical properties are dependent on the matrix as the aluminium grains became more refined with increasing grain size of the inoculant. I.e. Due to increasing grain size of the inoculant, the micro hardness increased (56, 61, 72HB as the aluminium crystal size became finer. Meanwhile, the tensile strength (284, 251, 223N/mm2 and ductility (1.82, 0.91, 0.45%E decreased as grain size of the inoculant increased. The overall results showed that the used agro-waste based inoculant has the capability of refining the crystal size of pure aluminium as its grain size increases. This will make the resulting aluminium alloy applicable in areas where hardness is of

Advancements of diffraction-based overlay metrology for double patterning

Science.gov (United States)

Li, Jie; Kritsun, Oleg; Liu, Yongdong; Dasari, Prasad; Weher, Ulrich; Volkman, Catherine; Mazur, Martin; Hu, Jiangtao

2011-03-01

As the dimensions of integrated circuit continue to shrink, diffraction based overlay (DBO) technologies have been developed to address the tighter overlay control challenges. Previously data of high accuracy and high precision were reported for litho-etch-litho-etch double patterning (DP) process using normal incidence spectroscopic reflectometry on specially designed targets composed of 1D gratings in x and y directions. Two measurement methods, empirical algorithm (eDBO) using four pads per direction (2x4 target) and modeling based algorithm (mDBO) using two pads per direction (2x2 target) were performed. In this work, we apply DBO techniques to measure overlay errors for a different DP process, litho-freeze-litho-etch process. We explore the possibility of further reducing number of pads in a DBO target using mDBO. For standard targets composed of 1D gratings, we reported results for eDBO 2x4 targets, mDBO 2x2 targets, and mDBO 2x1 target. The results of all three types of targets are comparable in terms of accuracy, dynamic precision, and TIS. TMU (not including tool matching) is less than 0.1nm. In addition, we investigated the possibility of measuring overlay with one single pad that contains 2D gratings. We achieved good correlation to blossom measurements. TMU (not including tool matching) is ~ 0.2nm. To our best knowledge, this is the first time that DBO results are reported on a single pad. eDBO allows quick recipe setup but takes more space and measurement time. Although mDBO needs details of optical properties and modeling, it offers smaller total target size and much faster throughput, which is important in high volume manufacturing environment.

A Measurement Study of the Structured Overlay Network in P2P File-Sharing Systems

Directory of Open Access Journals (Sweden)

Mo Zhou

2007-01-01

Full Text Available The architecture of P2P file-sharing applications has been developing to meet the needs of large scale demands. The structured overlay network, also known as DHT, has been used in these applications to improve the scalability, and robustness of the system, and to make it free from single-point failure. We believe that the measurement study of the overlay network used in the real file-sharing P2P systems can provide guidance for the designing of such systems, and improve the performance of the system. In this paper, we perform the measurement in two different aspects. First, a modified client is designed to provide view to the overlay network from a single-user vision. Second, the instances of crawler programs deployed in many nodes managed to crawl the user information of the overlay network as much as possible. We also find a vulnerability in the overlay network, combined with the character of the DNS service, a more serious DDoS attack can be launched.

Detection of Mycoplasma gallisepticum in House Finches ( Haemorhous mexicanus) from Arizona.

Science.gov (United States)

Staley, Molly; Bonneaud, Camille; McGraw, Kevin J; Vleck, Carol M; Hill, Geoffrey E

2018-03-01

In 1994, an endemic poultry pathogen, Mycoplasma gallisepticum (MG), was identified as the causative agent of a novel disease in house finches ( Haemorhous mexicanus). After an initial outbreak in Maryland, MG spread rapidly throughout eastern North American populations of house finches. Subsequently, MG spread slowly through the northern interior of North America and then into the Pacific Northwest, finally reaching California in 2006. Until 2009, there were no reports of MG in the southwestern United States east of California. In August 2011, after reports of house finches displaying conjunctivitis characteristic of MG infection in Arizona, we trapped house finches at bird feeders in central Arizona (Tempe) and southern Arizona (Tucson and Green Valley) to assay for MG infection. Upon capture, we noted whether birds exhibited conjunctivitis, and we collected choanal swabs to test for the presence of MG DNA using PCR. We detected MG in finches captured from Green Valley (in ∼12% of birds captured), but not in finches from Tucson or Tempe. Based on resampling of house finches at these sites in July 2014, we suggest that central Arizona finches likely remain unexposed to MG. We also suggest that low urban connectivity between arid habitats of southern and central Arizona or a reduction in the prevalence of MG after its initial arrival in Arizona may be limiting the spread of MG from south to north in Arizona. In addition, the observed conjunctivitis-like signs in house finches that were negative for MG by PCR may be caused primarily by avian pox virus.

Image-based overlay and alignment metrology through optically opaque media with sub-surface probe microscopy

Science.gov (United States)

van Es, Maarten H.; Mohtashami, Abbas; Piras, Daniele; Sadeghian, Hamed

2018-03-01

Nondestructive subsurface nanoimaging through optically opaque media is considered to be extremely challenging and is essential for several semiconductor metrology applications including overlay and alignment and buried void and defect characterization. The current key challenge in overlay and alignment is the measurement of targets that are covered by optically opaque layers. Moreover, with the device dimensions moving to the smaller nodes and the issue of the so-called loading effect causing offsets between between targets and product features, it is increasingly desirable to perform alignment and overlay on product features or so-called on-cell overlay, which requires higher lateral resolution than optical methods can provide. Our recently developed technique known as SubSurface Ultrasonic Resonance Force Microscopy (SSURFM) has shown the capability for high-resolution imaging of structures below a surface based on (visco-)elasticity of the constituent materials and as such is a promising technique to perform overlay and alignment with high resolution in upcoming production nodes. In this paper, we describe the developed SSURFM technique and the experimental results on imaging buried features through various layers and the ability to detect objects with resolution below 10 nm. In summary, the experimental results show that the SSURFM is a potential solution for on-cell overlay and alignment as well as detecting buried defects or voids and generally metrology through optically opaque layers.

Measured residual stresses in overlay pipe weldments removed from service

International Nuclear Information System (INIS)

Shack, W.J.

1985-02-01

Surface and throughwall residual stresses were measured on an elbow-to-pipe weldment that had been removed from the Hatch-2 reactor about a year after the application of a weld overlay. The results were compared with experimental measurements on three mock-up weldments and with finite-element calculations. The comparison shows that there are significant differences in the form and magnitude of the residual stress distributions. However, even after more than a year of service, the residual stresses over most of the inner surface of the actual plant weldment with an overlay were strongly compressive. 3 refs., 7 figs

Cluster-assembled overlayers and high-temperature superconductors

International Nuclear Information System (INIS)

Ohno, T.R.; Yang, Y.; Kroll, G.H.; Krause, K.; Schmidt, L.D.; Weaver, J.H.; Kimachi, Y.; Hidaka, Y.; Pan, S.H.; de Lozanne, A.L.

1991-01-01

X-ray photoemission results for interfaces prepared by cluster assembly with nanometer-size clusters deposited on high-T c superconductors (HTS's) show a reduction in reactivity because atom interactions with the surface are replaced by cluster interactions. Results for conventional atom deposition show the formation of overlayer oxides that are related to oxygen depletion and disruption of the near-surface region of the HTS's. For cluster assembly of Cr and Cu, there is a very thin reacted region on single-crystal Bi 2 Sr 2 CaCu 2 O 8 . Reduced reactivity is observed for Cr cluster deposition on single-crystal YBa 2 Cu 3 O 7 -based interfaces. There is no evidence of chemical modification of the surface for Ge and Au cluster assembly on Bi 2 Sr 2 CaCu 2 O 8 (100). The overlayer grown by Au cluster assembly on Bi 2 Sr 2 CaCu 2 O 8 covers the surface at low temperature but roughening occurs upon warming to 300 K. Scanning-tunneling-microscopy results for the Au(cluster)/Bi 2 Sr 2 CaCu 2 O 8 system warmed to 300 K shows individual clusters that have coalesced into large clusters. These results offer insight into the role of surface energies and cluster interactions in determining the overlayer morphology. Transmission-electron-microscopy results for Cu cluster assembly on silica show isolated irregularly shaped clusters that do not interact at low coverage. Sintering and labyrinth formation is observed at intermediate coverage and, ultimately, a continuous film is achieved at high coverage. Silica surface wetting by Cu clusters demonstrates that dispersive force are important for these small clusters

Performance polymeric concrete with synthetic fiber reinforcement against reflective cracking in rigid pavement overlay

International Nuclear Information System (INIS)

Khan, N.U.; Khan, B.

2012-01-01

Cement concrete pavements are used for heavy traffic loads throughout the world owing to its better and economical performance. Placing of a concrete overlay on the existing pavement is the most prevalent rehabilitating method for such pavements, however, the problem associated with the newly placed overlay is the occurrence of reflective cracking. This paper presents an assessment of the performance of polymeric concrete with synthetic fiber reinforcement against reflective cracking in an overlay system. The performance of polymeric concrete with synthetic fibers as an overlay material is measured in terms of the load-deflection, strain-deflection and load-strain behavior of beams of the polymeric concrete. For this purpose, five types of beams having different number of fiber wires and position are tested for flexure strength. Deflection/strains for each increment of load are recorded. In addition, cubes of plain concrete and of concrete with synthetic fiber needles were tested after 7 and 28 days for compressive strengths. Finite element models in ANSYS software for the beams have also been developed. Beams with greater number of longitudinal fiber wires displayed relatively better performance against deflection whilst beams with synthetic fiber needles showed better performance against strains. Thus, polymeric concrete overlay with fiber reinforcement will serve relatively better against occurrence of reflective cracking. (author)

Detection of infectious bronchitis virus 793B, avian metapneumovirus, Mycoplasma gallisepticum and Mycoplasma synoviae in poultry in Ethiopia.

Science.gov (United States)

Hutton, S; Bettridge, J; Christley, R; Habte, T; Ganapathy, K

2017-02-01

A survey was conducted into respiratory infectious diseases of poultry on a chicken breeder farm run by the Ethiopian Institute of Agricultural Research (EIAR), located in Debre Zeit, Ethiopia. Oropharyngeal swabs were collected from 117 randomly selected birds, and blood was taken from a subset of 73 of these birds. A combination of serological and molecular methods was used for detection of pathogens. For the first time in Ethiopia, we report the detection of variant infectious bronchitis virus (793B genotype), avian metapneumovirus subtype B and Mycoplasma synoviae in poultry. Mycoplasma gallisepticum was also found to be present; however, infectious laryngotracheitis virus was not detected by PCR. Newcastle disease virus (NDV) was not detected by PCR, but variable levels of anti-NDV HI antibody titres shows possible exposure to virulent strains or poor vaccine take, or both. For the burgeoning-intensive industry in Ethiopia, this study highlights several circulating infectious respiratory pathogens that can impact on poultry welfare and productivity.

Inoculation Expedition of Agar wood

International Nuclear Information System (INIS)

Peng, C.S.; Mohd Fajri Osman; Rusli Zakaria

2015-01-01

Inoculation expedition of agar wood is a main field works for researcher in Nuclear Malaysia to prove the real inoculation of agar wood in real jungle. These expeditions was conducted fourth times in the jungles of Malaysia including Gunung Tebu in Terengganu, Murum in Belaga, Sarawak, Kampung Timbang in Kota Belud, Sabah and Nuclear Malaysia itself. This expedition starts from preparation of samples and equipment, transportation into the jungle, searching and recognition of agar wood and lastly, inoculation of the agar wood. Safety aspects precedence set out in the preparation and implementation of this expedition. (author)

Intrauterine inoculation of minipigs with Chlamydia trachomatis during diestrus establishes a longer lasting infection compared to vaginal inoculation during estrus.

Science.gov (United States)

Lorenzen, Emma; Follmann, Frank; Secher, Jan O; Goericke-Pesch, Sandra; Hansen, Mette S; Zakariassen, Hannah; Olsen, Anja W; Andersen, Peter; Jungersen, Gregers; Agerholm, Jørgen S

2017-06-01

Advanced animal models, such as minipigs, are needed for the development of a globally requested human Chlamydia vaccine. Previous studies have shown that vaginal inoculation of sexually mature Göttingen minipigs with Chlamydia trachomatis resulted in an infection lasting only 3-5 days. The aim of this study was to evaluate the effect of targeting the upper porcine genital tract by transcervical and transabdominal intrauterine inoculation, compared to previously performed vaginal inoculation. Furthermore, we investigated the effect of the hormonal cycle, estrus vs. diestrus, on the establishment of a C. trachomatis infection in the minipig. Targeting the upper genital tract (transcervical inoculation) resulted in a longer lasting infection (at least 7 days) compared to vaginal inoculation (3-5 days). When comparing intrauterine inoculation during estrus and diestrus, inoculation during diestrus resulted in a longer lasting infection (at least 10 days) compared to estrus (3-5 days). Furthermore, we found a significant C. trachomatis specific IFN-γ response in pigs inoculated during estrus correlating with the accelerated clearance of infection in these pigs. These findings suggest that for implementation of an optimal model of C. trachomatis in minipigs, inoculation should bypass the cervix and preferable be performed during diestrus. Copyright © 2017 The Author(s). Published by Elsevier Masson SAS.. All rights reserved.

New inoculants on maize silage fermentation

Directory of Open Access Journals (Sweden)

Fábia Giovana do Val de Assis

2014-08-01

Full Text Available The objective of this study was to evaluate the effect of bacterial inoculants at two inoculation rates on chemical and biological characteristics of maize silage. The treatments consisted of two inoculating rates (5 and 6 log cfu g-1 of forage for each strain of lactic acid bacteria (LAB identified as Lactobacillus buchneri, L. hilgardii, or L. plantarum. The maize was ensiled in experimental PVC silos. Samples were taken for the determination of the contents of dry matter (DM, crude protein (CP, neutral detergent fiber (NDF, water-soluble carbohydrates (WSC, organic acids and alcohols, for the evaluation of the populations of lactic acid bacteria, yeasts, filamentous fungi, and for the determination of pH values during ensilage and after 30 or 90 days of fermentation. The doses of inoculants did not promote significant differences on the evaluated characteristics. There was effect of inoculants on acetic acid, 1.2-propanediol, LAB population, filamentous fungi, and pH value. No significant influence of the treatments with inoculants was observed in the variables DM, WSC, CP, lactic acid concentrations, or ethanol. The maximum temperature, i.e., the time to achieve the maximum temperature (TMT and aerobic stability (AS, was not influencied by treatments. However, a decrease in maximum temperature, an increase in TMT, and improvement in the AS were observed after 90 days of fermentation. These results proved the advantage of microbial inoculation. The treatments influenced LAB populations and filamentous fungi, but no effect was observed on the yeast population. The best inoculation dose is 6 cfu g-1 of forage because it provides higher reduction of filamentous fungi in maize silage, thereby decreasing the aerobic deterioration by these microorganisms.

Visualization of disciplinary profiles: Enhanced science overlay maps

NARCIS (Netherlands)

Carley, S.; Porter, A.L.; Rafols, I.; Leydesdorff, L.

Purpose The purpose of this study is to modernize previous work on science overlay maps by updating the underlying citation matrix, generating new clusters of scientific disciplines, enhancing visualizations, and providing more accessible means for analysts to generate their own maps.

Inoculation Technique for Fungus Cultures

Science.gov (United States)

Fusaro, Ramon M.

1972-01-01

A plastic straw and wood applicator stick serve as a simple, inexpensive, and disposable inoculation unit for fungal studies. The method gives a uniform and intact inoculum. The technique is especially useful because a large number of agar plates can be inoculated rapidly. Images PMID:5059618

Effect of SiO2 Overlayer on WO3 Sensitivity to Ammonia

Directory of Open Access Journals (Sweden)

Vibha Srivastava

2010-06-01

Full Text Available Ammonia gas sensing properties of tungsten trioxide thick film sensor was investigated. The doping of noble catalysts such as Pt, Pd, Au enhanced the gas sensitivity. Platinum doping was found to result in highest sensitivity. Remarkable sensitivity enhancement was realized by coating WO3 thick film sensors with SiO2 overlayer. Sol gel process derived silica overlayer increased ammonia gas sensitivity for doped as well as undoped sensor.

Digitizing geographic data with GRIDOT; a generalized program for drawing overlay grids in various map projections

International Nuclear Information System (INIS)

Edwards, R.G.; Durfee, R.C.

1976-09-01

The GRIDOT computer program draws overlay grids on a Calcomp plotter for use in digitizing information from maps, rectified aerial photographs, and other sources of spatially distributed data related to regional environmental problems. The options of the program facilitate use of the overlays with standard maps and map projections of the continental United States. The overlay grid may be defined as a latitude-longitude grid (geodetic grid), a Universal Transverse Mercator Grid, or one of the standard state-plane coordinate system grids. The map for which the overlay is intended may be in an Albers Equal Area projection, a Lambert Conformal projection, a Polyconic projection, a Transverse Mercator projection, a Universal Transverse Mercator projection, or any of the standard state-plane projections

Visually assessed colour overlay features in shear-wave elastography for breast masses: quantification and diagnostic performance.

Science.gov (United States)

Gweon, Hye Mi; Youk, Ji Hyun; Son, Eun Ju; Kim, Jeong-Ah

2013-03-01

To determine whether colour overlay features can be quantified by the standard deviation (SD) of the elasticity measured in shear-wave elastography (SWE) and to evaluate the diagnostic performance for breast masses. One hundred thirty-three breast lesions in 119 consecutive women who underwent SWE before US-guided core needle biopsy or surgical excision were analysed. SWE colour overlay features were assessed using two different colour overlay pattern classifications. Quantitative SD of the elasticity value was measured with the region of interest including the whole breast lesion. For the four-colour overlay pattern, the area under the ROC curve (Az) was 0.947; with a cutoff point between pattern 2 and 3, sensitivity and specificity were 94.4 % and 81.4 %. According to the homogeneity of the elasticity, the Az was 0.887; with a cutoff point between reasonably homogeneous and heterogeneous, sensitivity and specificity were 86.1 % and 82.5 %. For the SD of the elasticity, the Az was 0.944; with a cutoff point of 12.1, sensitivity and specificity were 88.9 % and 89.7 %. The colour overlay features showed significant correlations with the quantitative SD of the elasticity (P < 0.001). The colour overlay features and the SD of the elasticity in SWE showed excellent diagnostic performance and showed good correlations between them.

On the influence of latency estimation on dynamic group communication using overlays

Science.gov (United States)

Vik, Knut-Helge; Griwodz, Carsten; Halvorsen, Pål

2009-01-01

Distributed interactive applications tend to have stringent latency requirements and some may have high bandwidth demands. Many of them have also very dynamic user groups for which all-to-all communication is needed. In online multiplayer games, for example, such groups are determined through region-of-interest management in the application. We have investigated a variety of group management approaches for overlay networks in earlier work and shown that several useful tree heuristics exist. However, these heuristics require full knowledge of all overlay link latencies. Since this is not scalable, we investigate the effects that latency estimation techqniues have ton the quality of overlay tree constructions. We do this by evaluating one example of our group management approaches in Planetlab and examing how latency estimation techqniues influence their quality. Specifically, we investigate how two well-known latency estimation techniques, Vivaldi and Netvigator, affect the quality of tree building.

Effect of Inoculant Alloy Selection and Particle Size on Efficiency of Isomorphic Inoculation of Ti-Al.

Science.gov (United States)

Kennedy, J R; Rouat, B; Daloz, D; Bouzy, E; Zollinger, J

2018-04-25

The process of isomorphic inoculation relies on precise selection of inoculant alloys for a given system. Three alloys, Ti-10Al-25Nb, Ti-25Al-10Ta, and Ti-47Ta (at %) were selected as potential isomorphic inoculants for a Ti-46Al alloy. The binary Ti-Ta alloy selected was found to be ineffective as an inoculant due to its large density difference with the melt, causing the particles to settle. Both ternary alloys were successfully implemented as isomorphic inoculants that decreased the equiaxed grain size and increased the equiaxed fraction in their ingots. The degree of grain refinement obtained was found to be dependent on the number of particles introduced to the melt. Also, more new grains were formed than particles added to the melt. The grains/particle efficiency varied from greater than one to nearly twenty as the size of the particle increased. This is attributed to the breaking up of particles into smaller particles by dissolution in the melt. For a given particle size, Ti-Al-Ta and Ti-Al-Nb particles were found to have a roughly similar grain/particle efficiency.

Investigation of Iron Aluminide Weld Overlays

Energy Technology Data Exchange (ETDEWEB)

Banovic, S.W.; DuPont, J.B.; Levin, B.F.; Marder, A.R.

1999-08-02

Conventional fossil fired boilers have been retrofitted with low NO(sub)x burners in order for the power plants to comply with new clean air regulations. Due to the operating characteristics of these burners, boiler tube sulfidation corrosion typically has been enhanced resulting in premature tube failure. To protect the existing panels from accelerated attack, weld overlay coatings are typically being applied. By depositing an alloy that offers better corrosion resistance than the underlying tube material, the wastage rates can be reduced. While Ni-based and stainless steel compositions are presently providing protection, they are expensive and susceptible to failure via corrosion-fatigue due to microsegregation upon solidification. Another material system presently under consideration for use as a coating in the oxidation/sulfidation environments is iron-aluminum. These alloys are relatively inexpensive, exhibit little microsegregation, and show excellent corrosion resistance. However, their use is limited due to weldability issues and their lack of corrosion characterization in simulated low NO(sub)x gas compositions. Therefore a program was initiated in 1996 to evaluate the use of iron-aluminum weld overlay coatings for erosion/corrosion protection of boiler tubes in fossil fired boilers with low NO(sub)x burners. Investigated properties included weldability, corrosion behavior, erosion resistance, and erosion-corrosion performance.

Improving Overlay in Nanolithography with a Deformable Mask Holder

National Research Council Canada - National Science Library

Harriott, L. R

2004-01-01

In very fine-line VLSI photolithography, alignment and overlay errors due to distortion in the projected image of a photomask relative to an existing pattern on a silicon wafer are becoming such serious problems...

Utilizing Lab Tests to Predict Asphalt Concrete Overlay Performance

Science.gov (United States)

2017-12-01

A series of five experimental projects and three demonstration projects were constructed to better understand the performance of pavement overlays using various levels of asphalt binder replacement (ABR) from reclaimed asphalt pavement (RAP), recycle...

Effect of Fe content on the friction and abrasion properties of copper base overlay on steel substrate by TIG welding

Institute of Scientific and Technical Information of China (English)

Lü Shixiong; Song Jianling; Liu Lei; Yang Shiqin

2009-01-01

Copper base alloy was overlaid onto 35CrMnSiA steel plate by tungsten inert gas (TIG) welding method. The heat transfer process was simulated, the microstructures of the copper base overlay were analyzed by scanning electron microscopy (SEM) and energy dispersive spectrometer (EDS), and the friction and abrasion properties of the overlay were measured. The results show that the Fe content increases in the overlay with increasing the welding current. And with the increase of Fe content in the overlay, the friction coefficient increases and the wear mechanism changes from oxidation wear to abrasive wear and plough wear, which is related to the size and quantity of Fe grains in the overlay. While with the increase of Fe content in the overlay, the protection of oxidation layer against the oxidation wear on the melted metal decreases.

Influence of curing time, overlay material and thickness on three light-curing composites used for luting indirect composite restorations.

Science.gov (United States)

D'Arcangelo, Camillo; De Angelis, Francesco; Vadini, Mirco; Carluccio, Fabio; Vitalone, Laura Merla; D'Amario, Maurizio

2012-08-01

To assess the microhardness of three resin composites employed in the adhesive luting of indirect composite restorations and examine the influence of the overlay material and thickness as well as the curing time on polymerization rate. Three commercially available resin composites were selected: Enamel Plus HRI (Micerium) (ENA), Saremco ELS (Saremco Dental) (SAR), Esthet-X HD (Dentsply/DeTrey) (EST-X). Post-polymerized cylinders of 6 different thicknesses were produced and used as overlays: 2 mm, 3 mm, 3.5 mm, 4 mm, 5 mm, and 6 mm. Two-mm-thick disks were produced and employed as underlays. A standardized amount of composite paste was placed between the underlay and the overlay surfaces which were maintained at a fixed distance of 0.5 mm. Light curing of the luting composite layer was performed through the overlays for 40, 80, or 120 s. For each specimen, the composite to be cured, the cured overlay, and the underlay were made out of the same batch of resin composite. All specimens were assigned to three experimental groups on the basis of the resin composite used, and to subgroups on the basis of the overlay thickness and the curing time, resulting in 54 experimental subgroups (n = 5). Forty-five additional specimens, 15 for each material under investigation, were produced and subjected to 40, 80, or 120 s of light curing using a microscope glass as an overlay; they were assigned to 9 control subgroups (n = 5). Three Vicker's hardness (VH) indentations were performed on each specimen. Means and standard deviations were calculated. Data were statistically analyzed using 3-way ANOVA. Within the same material, VH values lower than 55% of control were not considered acceptable. The used material, the overlay thickness, and the curing time significantly influenced VH values. In the ENA group, acceptable hardness values were achieved with 3.5-mm or thinner overlays after 120 or 80 s curing time (VH 41.75 and 39.32, respectively), and with 2-mm overlays after 40 s (VH 54

Performance Evaluation of Cognitive Interference Channels Using a Spectrum Overlay Strategy

Science.gov (United States)

Knoblock, Eric J.

2018-01-01

The use of cognitive radios (CR) and cooperative communications techniques may assist in interference mitigation via sensing of the environment and dynamically altering communications parameters through the use of various mechanisms - one of which is the overlay technique. This report provides a performance analysis of an interference channel with a cognitive transceiver operating in an overlay configuration to evaluate the gains from using cognition. As shown in this report, a cognitive transceiver can simultaneously share spectrum while enhancing performance of non-cognitive nodes via knowledge of the communications channel as well as knowledge of neighboring users' modulation and coding schemes.

Investigation of Tensile Creep of a Normal Strength Overlay Concrete.

Science.gov (United States)

Drexel, Martin; Theiner, Yvonne; Hofstetter, Günter

2018-06-12

The present contribution deals with the experimental investigation of the time-dependent behavior of a typical overlay concrete subjected to tensile stresses. The latter develop in concrete overlays, which are placed on existing concrete structures as a strengthening measure, due to the shrinkage of the young overlay concrete, which is restrained by the substrate concrete. Since the tensile stresses are reduced by creep, creep in tension is investigated on sealed and unsealed specimens, loaded at different concrete ages. The creep tests as well as the companion shrinkage tests are performed in a climatic chamber at constant temperature and constant relative humidity. Since shrinkage depends on the change of moisture content, the evolution of the mass water content is determined at the center of each specimen by means of an electrolytic resistivity-based system. Together with the experimental results for compressive creep from a previous study, a consistent set of time-dependent material data, determined for the same composition of the concrete mixture and on identical specimens, is now available. It consists of the hygral and mechanical properties, creep and shrinkage strains for both sealed and drying conditions, the respective compliance functions, and the mass water contents in sealed and unsealed, loaded and load-free specimens.

Genetic diversity of symbiotic Bradyrhizobium elkanii populations recovered from inoculated and non-inoculated Acacia mangium field trials in Brazil.

Science.gov (United States)

Perrineau, M M; Le Roux, C; de Faria, S M; de Carvalho Balieiro, F; Galiana, A; Prin, Y; Béna, G

2011-07-01

Acacia mangium is a legume tree native to Australasia. Since the eighties, it has been introduced into many tropical countries, especially in a context of industrial plantations. Many field trials have been set up to test the effects of controlled inoculation with selected symbiotic bacteria versus natural colonization with indigenous strains. In the introduction areas, A. mangium trees spontaneously nodulate with local and often ineffective bacteria. When inoculated, the persistence of inoculants and possible genetic recombination with local strains remain to be explored. The aim of this study was to describe the genetic diversity of bacteria spontaneously nodulating A. mangium in Brazil and to evaluate the persistence of selected strains used as inoculants. Three different sites, several hundred kilometers apart, were studied, with inoculated and non-inoculated plots in two of them. Seventy-nine strains were isolated from nodules and sequenced on three housekeeping genes (glnII, dnaK and recA) and one symbiotic gene (nodA). All but one of the strains belonged to the Bradyrhizobium elkanii species. A single case of housekeeping gene transfer was detected among the 79 strains, suggesting an extremely low rate of recombination within B. elkanii, whereas the nodulation gene nodA was found to be frequently transferred. The fate of the inoculant strains varied depending on the site, with a complete disappearance in one case, and persistence in another. We compared our results with the sister species Bradyrhizobium japonicum, both in terms of population genetics and inoculant strain destiny. Copyright © 2011 Elsevier GmbH. All rights reserved.

Accessing inoculation methods of maize and wheat with Azospirillum brasilense.

Science.gov (United States)

Fukami, Josiane; Nogueira, Marco Antonio; Araujo, Ricardo Silva; Hungria, Mariangela

2016-03-01

The utilization of inoculants containing Azospirillum is becoming more popular due to increasing reports of expressive gains in grain yields. However, incompatibility with pesticides used in seed treatments represents a main limitation for a successful inoculation. Therefore, in this study we searched for alternatives methods for seed inoculation of maize and wheat, aiming to avoid the direct contact of bacteria with pesticides. Different doses of inoculants containing Azospirillum brasilense were employed to perform inoculation in-furrow, via soil spray at sowing and via leaf spray after seedlings had emerged, in comparison to seed inoculation. Experiments were conducted first under greenhouse controlled conditions and then confirmed in the field at different locations in Brazil. In the greenhouse, most parameters measured responded positively to the largest inoculant dose used in foliar sprays, but benefits could also be observed from both in-furrow and soil spray inoculation. However, our results present evidence that field inoculation with plant-growth promoting bacteria must consider inoculant doses, and point to the need of fine adjustments to avoid crossing the threshold of growth stimulation and inhibition. All inoculation techniques increased the abundance of diazotrophic bacteria in plant tissues, and foliar spray improved colonization of leaves, while soil inoculations favored root and rhizosphere colonization. In field experiments, inoculation with A. brasilense allowed for a 25 % reduction in the need for N fertilizers. Our results have identified alternative methods of inoculation that were as effective as the standard seed inoculation that may represent an important strategy to avoid the incompatibility between inoculant bacteria and pesticides employed for seed treatment.

Seroprevalensi dan Faktor Risiko Penularan Mycoplasma gallisepticum pada Peternakan Ayam Petelur Komersial di Kabupaten Blitar (SEROPREVALENCE AND( RISK FACTORS OF MYCOPLASMA GALLISEPTICUM INFECTION IN COMMERCIAL LAYER FARM IN BLITAR DISTRICT

Directory of Open Access Journals (Sweden)

Diyantoro Diyantoro

2017-06-01

Full Text Available This study aimed to figure out the prevalence and risk factors of Mycoplasma gallisepticum (MG infection in commercial layer farm in Blitar District. Blood samples and questionnaires were taken during December 2014 to February 2015. A total of 264 sera samples were collected from 22 commercial layer farm. Based on serum plate agglutination test, 26 sera samples were MG positive that were indicated an infection prevalence was 9.85%. The highest SRR value for MG infection was occurred in Bakung Subdistrict (SRR = 2.5. Based on Analysis of multivariate logistic regression showed that a very significant influenced risk factors of MG infection have occurred in flocking density more than 3,000 birds per flock (?2= 11.10; p= 0.001; OR= 6.1, flocking density about 1,501 to 3,000 birds per flock (?2 = 11.10; p= 0.001; OR= 6.1, bird feeding once a day (?2= 9.32; p= 0.002; OR= 0.3, house desinfection once in every two weeks (?2 =7.70; p= 0.009; OR= 1.2, house desinfection once a month or only in case (?2= 9.36; p= 0.006; OR= 3.9. It was concluded that seroprevalence of MG infection in studied area was 9,85%. the MG seroprevalence were influenced by flocking density more than 3,000 birds per flock, flocking density about 1,501 to 3,000 birds per flock, bird feeding once a day, house desinfection once every two weeks, and house desinfection once a month or only in case. ABSTRAK Mycoplasmosis merupakan salah satu penyakit paling penting yang dihadapi oleh industri perunggasan di Indonesia. Penelitian ini bertujuan untuk mengetahui prevalensi dan faktor risiko penularan Mycoplasma gallisepticum (MG pada peternakan ayam petelur komersial di Kabupaten Blitar, Jawa Timur. Contoh darah dan kuisioner diambil selama periode Desember 2014 hingga Februari 2015. Sebanyak 264 contoh serum dikumpulkan dari 22 peternakan ayam petelur komersial. Berdasarkan uji Rapid Serum Agglutination (RSA, 26 contoh ditemukan positif MG dengan prevalensi infeksi MG di Kabupaten Blitar

Analysis of mechanical tensile properties of irradiated and annealed RPV weld overlay cladding

Energy Technology Data Exchange (ETDEWEB)

Novak, J [Czech Nuclear Society, Prague (Czech Republic)

1994-12-31

Mechanical tensile properties of irradiated and annealed outer layer of reactor pressure vessel weld overlay cladding, composed of Cr19Ni10Nb alloy, have been experimentally determined by conventional tensile testing and indentation testing. The constitutive properties of weld overlay cladding are then modelled with two homogenization models of the constitutive properties of elastic-plastic matrix-inclusion composites; numerical and experimental results are then compared. 10 refs., 4 figs., 4 tabs.

Analysis of mechanical tensile properties of irradiated and annealed RPV weld overlay cladding

International Nuclear Information System (INIS)

Novak, J.

1993-01-01

Mechanical tensile properties of irradiated and annealed outer layer of reactor pressure vessel weld overlay cladding, composed of Cr19Ni10Nb alloy, have been experimentally determined by conventional tensile testing and indentation testing. The constitutive properties of weld overlay cladding are then modelled with two homogenization models of the constitutive properties of elastic-plastic matrix-inclusion composites; numerical and experimental results are then compared. 10 refs., 4 figs., 4 tabs

Characterizing the Global Impact of P2P Overlays on the AS-Level Underlay

Science.gov (United States)

Rasti, Amir Hassan; Rejaie, Reza; Willinger, Walter

This paper examines the problem of characterizing and assessing the global impact of the load imposed by a Peer-to-Peer (P2P) overlay on the AS-level underlay. In particular, we capture Gnutella snapshots for four consecutive years, obtain the corresponding AS-level topology snapshots of the Internet and infer the AS-paths associated with each overlay connection. Assuming a simple model of overlay traffic, we analyze the observed load imposed by these Gnutella snapshots on the AS-level underlay using metrics that characterize the load seen on individual AS-paths and by the transit ASes, illustrate the churn among the top transit ASes during this 4-year period, and describe the propagation of traffic within the AS-level hierarchy.

On-demand Overlay Networks for Large Scientific Data Transfers

Energy Technology Data Exchange (ETDEWEB)

Ramakrishnan, Lavanya [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Guok, Chin [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Jackson, Keith [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Kissel, Ezra [Univ. of Delaware, Newark, DE (United States); Swany, D. Martin [Univ. of Delaware, Newark, DE (United States); Agarwal, Deborah [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2009-10-12

Large scale scientific data transfers are central to scientific processes. Data from large experimental facilities have to be moved to local institutions for analysis or often data needs to be moved between local clusters and large supercomputing centers. In this paper, we propose and evaluate a network overlay architecture to enable highthroughput, on-demand, coordinated data transfers over wide-area networks. Our work leverages Phoebus and On-demand Secure Circuits and AdvanceReservation System (OSCARS) to provide high performance wide-area network connections. OSCARS enables dynamic provisioning of network paths with guaranteed bandwidth and Phoebus enables the coordination and effective utilization of the OSCARS network paths. Our evaluation shows that this approach leads to improved end-to-end data transfer throughput with minimal overheads. The achievedthroughput using our overlay was limited only by the ability of the end hosts to sink the data.

Topical Administration Is a Promising Inoculating Route versus Intramuscular Inoculation for the Nanoparticle-Carried DNA Vaccine to Prevent Corneal Infections.

Science.gov (United States)

Hu, Kai; Malla, Tejsu; Zhai, Yujia; Dong, Lili; Tang, Ru

2015-01-01

To evaluate the comparative effect of topical versus intramuscular administration of nanoparticle-carried DNA vaccine in preventing corneal herpes simplex virus type 1 (HSV-1) infection. Nanoparticle [polyethylenimine (PEI)-Fe3O4]-carried DNA vaccine (PEI-Fe3O4-pRSC-gD-IL-21) or DNA vaccine (pRSC-gD-IL-21) alone were topically versus intramuscularly inoculated into one eye each of mice on days 0, 14 and 28. Three weeks after the final immunization, the specific immune responses and clinical degrees of primary herpes simplex keratitis were evaluated. Topical inoculation of nanoparticle-carried DNA vaccine induced mice to generate similar levels of specific HSV-1-neutralizing antibody, IFN-γ and IL-4 in serum and specific killing (cytotoxicity) and proliferative activities of the splenic lymphocytes, but a significantly higher level of secretory IgA in tears compared to those of intramuscular inoculation. More importantly, the mice inoculated topically showed a significantly decreased herpes simplex keratitis severity than the mice inoculated intramuscularly after HSV-1 challenge on the corneas of the mice. Topical inoculation of nanoparticle-carried DNA vaccine elicits a stronger specific local immune response and more effectively inhibits herpes simplex keratitis as compared to intramuscular inoculation in an HSV-1 ocular challenge mouse model. Thus, topical administration may be a promising inoculating route for the nanoparticle-carried DNA vaccine to prevent corneal infections. © 2015 S. Karger AG, Basel.

Effect of constraint condition and internal medium on residual stress under overlay welding for dissimilar metal welding

International Nuclear Information System (INIS)

Song, Tae Kwang; Kim, Yun Jae; Lee, Kyoung Soo; Park, Chi Yong; Kim, Jong Sung; Kim, Jin Weon

2007-01-01

In nuclear power plants, residual stress of dissimilar metal weld propagates cracks in the weld metal which is susceptible to stress corrosion cracking. Overlay welding is a process widely used to mitigate residual stress replacing inside tensile stress by compression stress. However, according to the result of this study the effect of overlay welding on residual stress depends on both internal medium and constraint condition. The purpose of this study is to maximize the positive effect of overlay welding by finite element analyses

Hydrogen absorption kinetics of niobium with an ion-plated nickel overlayer

International Nuclear Information System (INIS)

Nakamura, K.

1981-01-01

The hydrogen absorption rate for nickel-ion-plated niobium was measured as a function of hydrogen pressure and temperature. The observed absorption curves of c(mean)/csub(e) against time (c(mean) and csub(e) are the mean and equilibrium hydrogen concentrations respectively) exhibited a marked hydrogen pressure dependence below 628 K but this was less marked above 723 K. The results were analysed on the basis of the proposed model that the rate-determining step is the hydrogen permeation through the nickel overlayer and that the permeation is driven by the hydrogen activity difference between the two interfaces, namely the H 2 -Ni and Ni-Nb interfaces. The marked pressure dependence can be attributed to the fact that the hydrogen activity coefficient in nickel is constant and that in niobium it varies markedly with concentration, i.e. with hydrogen pressure and temperature. It was also found that the change in the nickel overlayer structure caused by the dilatation of bulk niobium during hydrogen absorption enhances the hydrogen absorption rates. The temperature dependence of the hydrogen absorption rate is also discussed in comparison with that for tantalum with a vacuum-deposited nickel overlayer. (Auth.)

C-arm cone beam computed tomography needle path overlay for fluoroscopic guided vertebroplasty.

Science.gov (United States)

Tam, Alda L; Mohamed, Ashraf; Pfister, Marcus; Chinndurai, Ponraj; Rohm, Esther; Hall, Andrew F; Wallace, Michael J

2010-05-01

Retrospective review. To report our early clinical experience using C-arm cone beam computed tomography (C-arm CBCT) with fluoroscopic overlay for needle guidance during vertebroplasty. C-arm CBCT is advanced three-dimensional (3-D) imaging technology that is currently available on state-of-the-art flat panel based angiography systems. The imaging information provided by C-arm CBCT allows for the acquisition and reconstruction of "CT-like" images in flat panel based angiography/interventional suites. As part of the evolution of this technology, enhancements allowing the overlay of cross-sectional imaging information can now be integrated with real time fluoroscopy. We report our early clinical experience with C-arm CBCT with fluoroscopic overlay for needle guidance during vertebroplasty. This is a retrospective review of 10 consecutive oncology patients who underwent vertebroplasty of 13 vertebral levels using C-arm CBCT with fluoroscopic overlay for needle guidance from November 2007 to December 2008. Procedural data including vertebral level, approach (transpedicular vs. extrapedicular), access (bilateral vs. unilateral) and complications were recorded. Technical success with the overlay technology was assessed based on accuracy which consisted of 4 measured parameters: distance from target to needle tip, distance from planned path to needle tip, distance from midline to needle tip, and distance from the anterior 1/3 of the vertebral body to needle tip. Success within each parameter required that the distance between the needle tip and parameter being evaluated be no more than 5 mm on multiplanar CBCT or fluoroscopy. Imaging data for 12 vertebral levels was available for review. All vertebral levels were treated using unilateral access and 9 levels were treated with an extrapedicular approach. Technical success rates were 92% for both distance from planned path and distance from midline to final needle tip, 100% when distance from needle tip to the anterior 1

Forensic Study of Early Failures with Unbonded Concrete Overlays

Science.gov (United States)

2017-11-01

A forensic investigation was conducted to identify failure mechanisms responsible for early failures of unbonded concrete overlays on selected projects in Ohio, including I-70 in Madison County, I-77 in Washington and Noble Counties, and I-90 in Lake...

Evaluation of a novel ultra small target technology supporting on-product overlay measurements

Science.gov (United States)

Smilde, Henk-Jan H.; den Boef, Arie; Kubis, Michael; Jak, Martin; van Schijndel, Mark; Fuchs, Andreas; van der Schaar, Maurits; Meyer, Steffen; Morgan, Stephen; Wu, Jon; Tsai, Vincent; Wang, Cathy; Bhattacharyya, Kaustuve; Chen, Kai-Hsiung; Huang, Guo-Tsai; Ke, Chih-Ming; Huang, Jacky

2012-03-01

Reducing the size of metrology targets is essential for in-die overlay metrology in advanced semiconductor manufacturing. In this paper, μ-diffraction-based overlay (μDBO) measurements with a YieldStar metrology tool are presented for target-sizes down to 10 × 10 μm2. The μDBO technology enables selection of only the diffraction efficiency information from the grating by efficiently separating it from product structure reflections. Therefore, μDBO targets -even when located adjacent to product environment- give excellent correlation with 40 × 160 μm2 reference targets. Although significantly smaller than standard scribe-line targets, they can achieve total-measurement-uncertainty values of below 0.5 nm on a wide range of product layers. This shows that the new μDBO technique allows for accurate metrology on ultra small in-die targets, while retaining the excellent TMU performance of diffraction-based overlay metrology.

Yield impact for wafer shape misregistration-based binning for overlay APC diagnostic enhancement

Science.gov (United States)

Jayez, David; Jock, Kevin; Zhou, Yue; Govindarajulu, Venugopal; Zhang, Zhen; Anis, Fatima; Tijiwa-Birk, Felipe; Agarwal, Shivam

2018-03-01

The importance of traditionally acceptable sources of variation has started to become more critical as semiconductor technologies continue to push into smaller technology nodes. New metrology techniques are needed to pursue the process uniformity requirements needed for controllable lithography. Process control for lithography has the advantage of being able to adjust for cross-wafer variability, but this requires that all processes are close in matching between process tools/chambers for each process. When this is not the case, the cumulative line variability creates identifiable groups of wafers1 . This cumulative shape based effect is described as impacting overlay measurements and alignment by creating misregistration of the overlay marks. It is necessary to understand what requirements might go into developing a high volume manufacturing approach which leverages this grouping methodology, the key inputs and outputs, and what can be extracted from such an approach. It will be shown that this line variability can be quantified into a loss of electrical yield primarily at the edge of the wafer and proposes a methodology for root cause identification and improvement. This paper will cover the concept of wafer shape based grouping as a diagnostic tool for overlay control and containment, the challenges in implementing this in a manufacturing setting, and the limitations of this approach. This will be accomplished by showing that there are identifiable wafer shape based signatures. These shape based wafer signatures will be shown to be correlated to overlay misregistration, primarily at the edge. It will also be shown that by adjusting for this wafer shape signal, improvements can be made to both overlay as well as electrical yield. These improvements show an increase in edge yield, and a reduction in yield variability.

A study and simulation of the impact of high-order aberrations to overlay error distribution

Science.gov (United States)

Sun, G.; Wang, F.; Zhou, C.

2011-03-01

With reduction of design rules, a number of corresponding new technologies, such as i-HOPC, HOWA and DBO have been proposed and applied to eliminate overlay error. When these technologies are in use, any high-order error distribution needs to be clearly distinguished in order to remove the underlying causes. Lens aberrations are normally thought to mainly impact the Matching Machine Overlay (MMO). However, when using Image-Based overlay (IBO) measurement tools, aberrations become the dominant influence on single machine overlay (SMO) and even on stage repeatability performance. In this paper, several measurements of the error distributions of the lens of SMEE SSB600/10 prototype exposure tool are presented. Models that characterize the primary influence from lens magnification, high order distortion, coma aberration and telecentricity are shown. The contribution to stage repeatability (as measured with IBO tools) from the above errors was predicted with simulator and compared to experiments. Finally, the drift of every lens distortion that impact to SMO over several days was monitored and matched with the result of measurements.

Colors, colored overlays, and reading skills

OpenAIRE

Uccula, Arcangelo; Enna, Mauro; Mulatti, Claudio

2014-01-01

In this article, we are concerned with the role of colors in reading written texts. It has been argued that colored overlays applied above written texts positively influence both reading fluency and reading speed. These effects would be particularly evident for those individuals affected by the so called Meares-Irlen syndrome, i.e., who experience eyestrain and/or visual distortions – e.g., color, shape, or movement illusions – while reading. This condition would interest the 12–14% of the ge...

He atom-surface scattering: Surface dynamics of insulators, overlayers and crystal growth

International Nuclear Information System (INIS)

Safron, S.A.; Skofronick, J.G.

1994-01-01

This progress report describes work carried out in the study of surface structure and dynamics of ionic insulators, the microscopic interactions controlling epitaxial growth and the formation of overlayers, and energy exchange in multiphonon surface scattering. The approach used is to employ high resolution helium atom scattering to study the geometry and structural features of the surfaces. Experiments have been carried out on the surface dynamics of RbCl and preliminary studies done on CoO and NiO. Epitaxial growth and overlayer dynamics experiments on the systems NaCl/NaCl(001), KBr/NaCl(001), NaCl/KBr(001) and KBr/RbCl(001) have been performed. They have collaborated with two theoretical groups to explore models of overlayer dynamics with which to compare and to interpret their experimental results. They have carried out extensive experiments on the multiphonon scattering of helium atoms from NaCl and, particularly, LiF. Work has begun on self-assembling organic films on gold and silver surfaces (alkyl thiols/Au(111) and Ag(111))

Comparison of bedside inoculation of culture media with ...

African Journals Online (AJOL)

Background: The yield of bacterial cultures from cerebrospinal fluid (CSF) at Kenyatta National Hospital (KNH) is very low. Bedside inoculation of culture media with CSF may improve yields. Objective: To compare the culture yield of CSF inoculated onto culture medium at the bedside to that of CSF inoculated onto culture ...

Behaviour of Parallel Coupled Microstrip Band Pass Filter and Simple Microstripline due to Thin-Film Al2O3 Overlay

Directory of Open Access Journals (Sweden)

S. B. Rane

1996-01-01

Full Text Available The X-band behaviour of a seven-section parallel-coupled microstrip band pass filter and microstripline due to thin-film Al2O3 overlay of different thickness is reported in this paper. This Al2O3 film can give a homogeneous overlay structure. There is a substantial increase in the bandwidth due to the overlay, the pass band extending towards higher frequency side. In most of the cases, an increase in the pass band transmittance of a microstripline also increases due to a thin-film Al2O3 overlay, especially for frequencies less than 9.0 GHz. At higher frequencies, random variations are observed. It is felt that thin-film overlays can be used to modify the microstripline circuit properties, thereby avoiding costly and time consuming elaborate design procedures.

Iowa task report : US 18 concrete overlay construction under traffic.

Science.gov (United States)

2012-05-01

The National Concrete Pavement Technology Center, Iowa Department of Transportation, and Federal Highway Administration set out to demonstrate and document the design and construction of portland cement concrete (PCC) overlays on two-lane roadways wh...

Molecular characterization and determination of antimicrobial resistance of Mycoplasma gallisepticum isolated from chickens.

Science.gov (United States)

Pakpinyo, Somsak; Sasipreeyajan, Jiroj

2007-11-15

In this study, three consecutive approaches of molecular characterization, determination of minimum inhibitory concentration (MIC) and antimicrobial tested on Mycoplasma gallisepticum (MG) isolated from chicken farms were investigated. These approaches were conducted between 2004 and 2005 to 134 MG samples collected from five different regions of the intensive farming area of Thailand. Twenty MG isolates and four reference strains including S6, F, ts-11, and 6/85 were classified according to Random Amplification of Polymorphic DNA (RAPD) patterns prior to the antimicrobial tests. These isolates exhibited 5 different genotypes (A-E). Consequently, MG isolates representing each genotype were tested on 11 registered antibiotics. The levels of MIC were determined. Three antibiotics, doxycycline (0.20 microg/ml), tiamulin (0.10 microg/ml), and tylosin (0.33 microg/ml), gave the least MICs among all effective drugs. Break point comparisons of each antimicrobial suggested that the MG isolates were most sensitive to lincomycin, oxytetracycline, tiamulin, and tylosin. Some MG isolates had an intermediate effect on josamycin and were resistant to enrofloxacin and erythromycin. Our results also indicated that MG isolated and collected from the region and nearby districts had similar RAPD patterns showing properties of antimicrobial resistance. The RAPD patterns may imply the frequent use of antibiotics and a resistant strain of MG. This is the first report of genetic characterization using RAPD reflected by the levels of MIC against MG. The information is useful to plan for prophylactic and therapeutic impacts on the poultry industry especially in the area of intensive use of antibiotics.

Inoculation message treatments for curbing noncommunicable disease development.

Science.gov (United States)

Mason, Alicia M; Miller, Claude H

2013-07-01

To study the effect of various types of inoculation message treatments on resistance to persuasive and potentially deceptive health- and nutrition-related (HNR) content claims of commercial food advertisers. A three-phase experiment was conducted among 145 students from a Midwestern U.S. university. Quantitative statistical analyses were used to interpret the results. RESULTS provide clear evidence that integrating regulatory focus/fit considerations enhances the treatment effectiveness of inoculation messages. Inoculation messages that employed a preventative, outcome focus with concrete language were most effective at countering HNR advertising claims. The findings indicate that inoculation fosters resistance equally across the most common types of commercially advertised HNR product claims (e.g., absolute, general, and structure/function claims). As the drive to refine the inoculation process model continues, further testing and application of this strategy in a public health context is needed to counter ongoing efforts by commercial food advertisers to avoid government regulations against deceptive practices such as dubious health/nutrition claims. This research advances inoculation theory by providing evidence that 1) good regulatory fit strengthens the effect of refutational preemption and 2) an inoculation approach is highly effective at fostering resistance to commercial advertisers' HNR content claims. This macro approach appears far superior to education or information-based promotional health campaigns targeted solely at specific populations demonstrating rising rates of noncommunicable disease.

Inoculation message treatments for curbing noncommunicable disease development

Directory of Open Access Journals (Sweden)

Alicia M. Mason

2013-07-01

Full Text Available OBJECTIVE: To study the effect of various types of inoculation message treatments on resistance to persuasive and potentially deceptive health- and nutrition-related (HNR content claims of commercial food advertisers. METHODS: A three-phase experiment was conducted among 145 students from a Midwestern U.S. university. Quantitative statistical analyses were used to interpret the results. Results: Results provide clear evidence that integrating regulatory focus/fit considerations enhances the treatment effectiveness of inoculation messages. Inoculation messages that employed a preventative, outcome focus with concrete language were most effective at countering HNR advertising claims. The findings indicate that inoculation fosters resistance equally across the most common types of commercially advertised HNR product claims (e.g., absolute, general, and structure/function claims. CONCLUSIONS: As the drive to refine the inoculation process model continues, further testing and application of this strategy in a public health context is needed to counter ongoing efforts by commercial food advertisers to avoid government regulations against deceptive practices such as dubious health/nutrition claims. This research advances inoculation theory by providing evidence that 1 good regulatory fit strengthens the effect of refutational preemption and 2 an inoculation approach is highly effective at fostering resistance to commercial advertisers' HNR content claims. This macro approach appears far superior to education or information-based promotional health campaigns targeted solely at specific populations demonstrating rising rates of noncommunicable disease.

Antioxidant properties of soybean seedlings inoculated with Trichoderma asperellum

Directory of Open Access Journals (Sweden)

Manojlović Ana S.

2017-01-01

Full Text Available This study was conducted in order to assess the effect of inoculation of soybean (Glycine max L. seeds with Trichoderma asperellum, followed by mites (Tetranychus urticae exposure on lipid peroxidation (LP process and the activity of antioxidant enzymes. T. urticae is an occasional pest of soybean that causes biotic stress. Biotic stress leads to overproduction of reactive oxygen species (ROS which may cause damage to vital biomolecules. Enzymatic antioxidant defense systems protect plants against oxidative stress. T. asperellum is commonly used as biocontrol agent against plant pathogens. It has been suggested that previous inoculation of seeds with T. asperellum may cause induced resistance against biotic stress. The aim of this study was to determine LP intensity and antioxidant enzymes activity in inoculated and non-inoculated soybean seedlings with and without exposure to mites. Noticeably higher LP intensity was detected in non-inoculated group treated with mites compared to control group. Inoculated soybean seedlings treated with mites had lower LP intensity compared to noninoculated group. Also, it has been noticed that inoculation with Trichoderma asperellum itself, produced mild stress in plants. In addition, positive correlation between enzymes activity and LP was noticed. The level of oxidative stress in plants was followed by the change of LP intensity. According to results obtained, it was concluded that the greatest oxidative stress occurred in non-inoculated group treated with mites and that inoculation successfully reduced oxidative stress. The results indicate that inoculation of soybean seeds with T. asperellum improves resistance of soybean seedlings against mites attack. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. TR-31022

Key factors to inoculate Botrytis cinerea in tomato plants

OpenAIRE

Borges,Álefe Vitorino; Saraiva,Rodrigo Moreira; Maffia,Luiz Antonio

2014-01-01

Studies addressing the biological control of Botrytis cinerea have been unsuccessful because of fails in inoculating tomato plants with the pathogen. With the aim of establishing a methodology for inoculation into stems, experiments were designed to assess: i. the aggressiveness of pathogen isolates; ii. the age at which tomato plants should be inoculated; iii. the susceptibility of tissues at different stem heights; iv. the need for a moist chamber after inoculation; and v. the effectiveness...

Use of Hydrogen Chemisorption and Ethylene Hydrogenation as Predictors for Aqueous Phase Reforming of Lactose over Ni@Pt and Co@Pt Bimetallic Overlayer Catalysts

Energy Technology Data Exchange (ETDEWEB)

Lai, Qinghua; Skoglund, Michael D.; Zhang, Chen; Morris, Allen R.; Holles, Joseph H.

2016-10-20

Overlayer Pt on Ni (Ni@Pt) or Co (Co@Pt) were synthesized and tested for H2 generation from APR of lactose. H2 chemisorption descriptor showed that Ni@Pt and Co@Pt overlayer catalysts had reduced H2 adsorption strength compared to a Pt only catalyst, which agree with computational predictions. The overlayer catalysts also demonstrated lower activity for ethylene hydrogenation than the Pt only catalyst, which likely resulted from decreased H2 binding strength decreasing the surface coverage of H2. XAS results showed that overlayer catalysts exhibited higher white line intensity than the Pt catalyst, which indicates a negative d-band shift for the Pt overlayer, further providing evidence for overlayer formation. Lactose APR studies showed that lactose can be used as feedstock to produce H2 and CO under desirable reaction conditions. The Pt active sites of Ni@Pt and Co@Pt overlayer catalysts showed significantly enhanced H2 production selectivity and activity when compared with that of a Pt only catalyst. The single deposition overlayer with the largest d-band shift showed the highest H2 activity. The results suggest that overlayer formation using directed deposition technique could modify the behavior of the surface metal and ultimately modify the APR activity.

Klebsiella pneumoniae inoculants for enhancing plant growth

Science.gov (United States)

Triplett, Eric W [Middleton, WI; Kaeppler, Shawn M [Oregon, WI; Chelius, Marisa K [Greeley, CO

2008-07-01

A biological inoculant for enhancing the growth of plants is disclosed. The inoculant includes the bacterial strains Herbaspirillum seropedicae 2A, Pantoea agglomerans P101, Pantoea agglomerans P102, Klebsiella pneumoniae 342, Klebsiella pneumoniae zmvsy, Herbaspirillum seropedicae Z152, Gluconacetobacter diazotrophicus PA15, with or without a carrier. The inoculant also includes strains of the bacterium Pantoea agglomerans and K. pneumoniae which are able to enhance the growth of cereal grasses. Also disclosed are the novel bacterial strains Herbaspirillum seropedicae 2A, Pantoea agglomerans P101 and P102, and Klebsiella pneumoniae 342 and zmvsy.

Effects of layering technique on the shade of resin overlays and the microhardness of dual cure resin cement

Directory of Open Access Journals (Sweden)

Hoon-Sang Chang

2014-06-01

Full Text Available The purpose of this study was to assess the color of layered resin overlays and to test the early microhardness of dual cure resin cement (DCRC light cured through the layered resin overlays. Resin overlays of 1.5 mm thickness were fabricated with the A3 shade of Z350 (Group 1L, the A3B and A3E shades of Supreme XT (Group 2L, and the A3, E3, and T1 shades of Sinfony (Group 3L using one, two, and three layers, respectively (n = 7. Each layer of the resin overlays was set in equal thickness. The color of the resin overlays was measured with a colorimeter and compared with an A3 shade resin denture tooth. DCRC was light cured through the resin overlays, and the early microhardness of the DCRC was measured. The ΔE value between the denture tooth and the resin overlays and the Vickers hardness number (VHN of the DCRC were analyzed with one-way ANOVA and Tukey’s HSD test. The color differences were 8.9 ± 0.5, 5.3 ± 1.0, and 7.3 ± 0.5 and the VHNs were 19.4 ± 1.1, 21.1 ± 0.9, and 29.3 ± 0.6 for Groups 1L, 2L, and 3L, respectively. Therefore, to match the designated tooth color of resin inlays and to increase the early microhardness of DCRC, layered resin inlays are more appropriate than single-dentin-layer resin inlays. However, the translucent layer should be used cautiously because the color difference of resin inlays with a translucent layer was affected more than those without a translucent layer.

Effect of SiO2 passivation overlayers on hillock formation in Al thin films

International Nuclear Information System (INIS)

Kim, Deok-kee

2012-01-01

Hillock formation in Al thin films with varying thicknesses of SiO 2 as a passivation layer was investigated during thermal cycling. Based on the stress measurements and the number of hillocks, 250 nm thick SiO 2 was thick enough to suppress the hillock formation and the suppression of hillock at 250 nm passivation and the lack of suppression at thinner passivation is related to the presence/absence of protection against the diffusive flow of atoms from the surrounding area to the surface due to the biaxial compressive stresses present in the film through the weak spots in the passivation layer. The stress state of Al films measured during annealing (the driving force for hillock formation) did not vary much with SiO 2 thickness. A small number of hillocks formed during the plasma enhanced chemical vapor deposition of SiO 2 overlayers at 300 °C. - Highlights: ► We examined the effect of SiO 2 overlayers on hillock formation in Al thin films. ► Thin overlayers were not effective in suppressing diffusive flow to the surface. ► A thick overlayer suppressed the diffusive flow from the interior to the surface. ► The stress state of Al films did not vary much with SiO 2 passivation thickness. ► High mechanical strength provided a large driving force for the large grain growth.

Reducing overlay sampling for APC-based correction per exposure by replacing measured data with computational prediction

Science.gov (United States)

Noyes, Ben F.; Mokaberi, Babak; Oh, Jong Hun; Kim, Hyun Sik; Sung, Jun Ha; Kea, Marc

2016-03-01

One of the keys to successful mass production of sub-20nm nodes in the semiconductor industry is the development of an overlay correction strategy that can meet specifications, reduce the number of layers that require dedicated chuck overlay, and minimize measurement time. Three important aspects of this strategy are: correction per exposure (CPE), integrated metrology (IM), and the prioritization of automated correction over manual subrecipes. The first and third aspects are accomplished through an APC system that uses measurements from production lots to generate CPE corrections that are dynamically applied to future lots. The drawback of this method is that production overlay sampling must be extremely high in order to provide the system with enough data to generate CPE. That drawback makes IM particularly difficult because of the throughput impact that can be created on expensive bottleneck photolithography process tools. The goal is to realize the cycle time and feedback benefits of IM coupled with the enhanced overlay correction capability of automated CPE without impacting process tool throughput. This paper will discuss the development of a system that sends measured data with reduced sampling via an optimized layout to the exposure tool's computational modelling platform to predict and create "upsampled" overlay data in a customizable output layout that is compatible with the fab user CPE APC system. The result is dynamic CPE without the burden of extensive measurement time, which leads to increased utilization of IM.

Biological Inoculants in Forage Conservation

Directory of Open Access Journals (Sweden)

Judit Peter Szucs

2011-05-01

Full Text Available 3rd generation biological inoculants –containing lactic acid bacteria and enzymes – are prefered nowadays in order to coordinate the fermentation in such a way that they increase lactic acid production by leaps and bounds at the beginning of the fermentation and improve the quality and stability of silage during the fermentation and feeding. The quality of raw material (maturity of plant, chop lenght, spreading of inoculant uniformly and the proper filling, compacting, covering and wrapping have a great influence on the effectiveness of the inoculant. The mycotoxin content of malfermented silages is an undesirable risk factor. The authors established, that the Lactobacillus buchneri and enzymes containing inoculant protected better the carotene content of low, medium- and high wilteed lucerne haylages (P<0,05 compare to untreated ones Aerobic stability experiment by Honnig 1990 method was carried out with medium wilted (36 % DM lucerne haylage which was treatedtreated before ensilage with , the dosage of 105 CFU/g Pediococcus acidilactici, 1,5x105 CFU/g Lactobacillus buchneri and cellulase and hemicellulase enzimes (20 000 CMC /g remained stabyle, unspoiled after 9 days exposure to the air, while the untreated haylages spoiled after 2;4;or 7days on aerobic condition. The different Lactobacillus plantarum strains (50.000 CFU of Lactobacillus plantarum DSM 16568 + 50.000 CFU of Lactobacillus plantarum DSM 4784/ g FM of maize applied together were able to improve the aerobic stability of silomaize silage.

Detection and differentiation of Mycoplasma gallisepticum and Mycoplasma synoviaeby PCR from tracheal swabs from birds with respiratory symptoms

International Nuclear Information System (INIS)

Ventura, Cesar E; Ramirez, Gloria; Vera, Victor

2012-01-01

Mycoplasmas are worldwide pathogens that affect the poultry industry causing respiratory illness which cause a negative economic impact. Two mycoplasmas species are the most important in the commercial poultry: mycoplasma gallisepticum (MG) and mycoplasma synoviae (MS). By its importance and necessity to know and differentiate between mycoplasmas species in local's poultry houses this study used the PCR technique like a diagnosis tool, using tracheal swabs from bird with respiratory symptoms. A total of 91 samples from broilers, layers and breeders farms located in the departments of Cundinamarca and Boyaca was processed. The punctual prevalence founded in this study was 39.6 % for mg and 47.3 % for MS. statistical differences for type of production and positive samples for mg y MS (p < 0.05) were founded, a bigger number of positive samples from layers and breeder in comparison to broilers were found. In the same way, the positive samples for the layers and breeder from the age group between 20 and 60 weeks was greater, while for the broilers group most of the positive samples were from five weeks old birds for mg and two weeks old birds for MS.

Diagnostic performance and color overlay pattern in shear wave elastography (SWE) for palpable breast mass.

Science.gov (United States)

Park, Jiyoon; Woo, Ok Hee; Shin, Hye Seon; Cho, Kyu Ran; Seo, Bo Kyoung; Kang, Eun Young

2015-10-01

The purpose of this study is to evaluate the diagnostic performance of SWE in palpable breast mass and to compare with color overlay pattern in SWE with conventional US and quantitative SWE for assessing palpable breast mass. SWE and conventional breast US were performed in 133 women with 156 palpable breast lesions (81 benign, 75 malignant) between August 2013 to June 2014. Either pathology or periodic imaging surveillance more than 2 years was a reference standard. Existence of previous image was blinded to performing radiologists. US BI-RADS final assessment, qualitative and quantitative SWE measurements were evaluated. Diagnostic performances of grayscale US, SWE and US combined to SWE were calculated and compared. Correlation between pattern classification and quantitative SWE was evaluated. Both color overlay pattern and quantitative SWE improved the specificity of conventional US, from 81.48% to 96.30% (p=0.0005), without improvement in sensitivity. Color overlay pattern was significantly related to all quantitative SWE parameters and malignancy rate (pbreast mass, conventional US combine to SWE improves specificity and reduces the number of biopsies that ultimately yield a benign result. Color overlay pattern classification is more quick and easy and may represent quantitative SWE measurements with similar diagnostic performances. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Description of the signal and background event mixing as implemented in the Marlin processor OverlayTiming

CERN Document Server

Schade, P

2011-01-01

This note documents OverlayTiming, a processor in the Marlin software frame- work. OverlayTiming can model the timing structure of a linear collider bunch train and offers the possibility to merge simulated physics events with beam-beam background events. In addition, a realistic structure of the detector readout can be imitated by defining readout time windows for each subdetector.

Modeling and simulation of adaptive Neuro-fuzzy based intelligent system for predictive stabilization in structured overlay networks

Directory of Open Access Journals (Sweden)

Ramanpreet Kaur

2017-02-01

Full Text Available Intelligent prediction of neighboring node (k well defined neighbors as specified by the dht protocol dynamism is helpful to improve the resilience and can reduce the overhead associated with topology maintenance of structured overlay networks. The dynamic behavior of overlay nodes depends on many factors such as underlying user’s online behavior, geographical position, time of the day, day of the week etc. as reported in many applications. We can exploit these characteristics for efficient maintenance of structured overlay networks by implementing an intelligent predictive framework for setting stabilization parameters appropriately. Considering the fact that human driven behavior usually goes beyond intermittent availability patterns, we use a hybrid Neuro-fuzzy based predictor to enhance the accuracy of the predictions. In this paper, we discuss our predictive stabilization approach, implement Neuro-fuzzy based prediction in MATLAB simulation and apply this predictive stabilization model in a chord based overlay network using OverSim as a simulation tool. The MATLAB simulation results present that the behavior of neighboring nodes is predictable to a large extent as indicated by the very small RMSE. The OverSim based simulation results also observe significant improvements in the performance of chord based overlay network in terms of lookup success ratio, lookup hop count and maintenance overhead as compared to periodic stabilization approach.

EPES information depth for an overlayer/substrate system with a diffuse interface

International Nuclear Information System (INIS)

Zommer, L.

2009-01-01

The information depth (ID) of elastic peak electron spectroscopy (EPES) was considered for an overlayer/substrate system with a diffuse interface. The interface was assumed to have an exponential concentration profile. The paradox previously found by Zommer and Jablonski for the Rh/Al and Al/Rh systems with sharp interfaces also occurs for these systems with diffuse interfaces. We compared IDs for diffuse and sharp interfaces. Deviations between the IDs depend on the interface width, overlayer thickness, and selected system for a given primary energy (here 2000 eV). The deviations for the Rh/Al and Al/Rh systems differ profoundly. These results are of importance when interpreting EPES measurements of layered system

The hilum overlay sign in a child

Directory of Open Access Journals (Sweden)

M J Van Wyk

2010-12-01

Full Text Available A 9-month-old girl presented with a 1-month history of coughing. A chest X-ray (CXR was performed, and the antero-posterior view demonstrated the hilum overlay sign. Furthermore, there was absence of the azygo-oesophageal line and bilateral paraspinal lines. The lateral CXR revealed a posterior mediastinal mass. Subsequently, a computed tomogram of the chest confirmed a posterior mediastinal mass, with calcifications and intraspinal extension consistent with neuroblastoma. Histological analysis confirmed this mass as a neuroblastoma.

I-line stepper based overlay evaluation method for wafer bonding applications

Science.gov (United States)

Kulse, P.; Sasai, K.; Schulz, K.; Wietstruck, M.

2018-03-01

In the last decades the semiconductor technology has been driven by Moore's law leading to high performance CMOS technologies with feature sizes of less than 10 nm [1]. It has been pointed out that not only scaling but also the integration of novel components and technology modules into CMOS/BiCMOS technologies is becoming more attractive to realize smart and miniaturized systems [2]. Driven by new applications in the area of communication, health and automation, new components and technology modules such as BiCMOS embedded RF-MEMS, high-Q passives, Sibased microfluidics and InP-SiGe BiCMOS heterointegration have been demonstrated [3-6]. In contrast to standard VLSI processes fabricated on front side of the silicon wafer, these new technology modules additionally require to process the backside of the wafer; thus require an accurate alignment between the front and backside of the wafer. In previous work an advanced back to front side alignment technique and implementation into IHP's 0.25/0.13 µm high performance SiGe:C BiCMOS backside process module has been presented [7]. The developed technique enables a high resolution and accurate lithography on the backside of BiCMOS wafer for additional backside processing. In addition to the aforementioned back side process technologies, new applications like Through-Silicon Vias (TSV) for interposers and advanced substrate technologies for 3D heterogeneous integration demand not only single wafer fabrication but also processing of wafer stacks provided by temporary and permanent wafer bonding [8-9]. In this work, the non-contact infrared alignment system of the Nikon® i-line Stepper NSR-SF150 for both alignment and the overlay determination of bonded wafer stacks with embedded alignment marks are used to achieve an accurate alignment between the different wafer sides. The embedded field image alignment (FIA) marks of the interface and the device wafer top layer are measured in a single measurement job. By taking the

Mycorrhizal inoculation affects the phytochemical content in strawberry fruits

Directory of Open Access Journals (Sweden)

Ana Paula Cecatto

2016-04-01

Full Text Available The aim of this research was to evaluate the effect of the inoculation date of arbuscular mycorrhizal fungi on the fruit quality and the content of phytochemicals in a strawberry soilless growing system. The experiment was performed in Huelva (Spain and was conducted in a greenhouse on the La Rábida Campus of Huelva University under natural light and temperature from October 2013 to June 2014. Three short-day strawberry cultivars (‘Splendor’, ‘Sabrina’ and ‘Fortuna’ were grown in polyethylene bags filled with coconut fibres. Randomized block design, with 3 repetitions and factorial arrangement (3 cultivars x 3 treatments, was established. Each replicate consisted of one bag with 12 plants supporting structures at 40 cm height. The treatments were: T1 = mycorrhizal inoculation in the transplantation; T2 = mycorrhizal inoculation 30 days after transplantation (DAT; and T0 = control treatment, without inoculation. Arbuscular mycorrhizal fungi inoculation significantly affected the contents of anthocyanin and phenolics. When the inoculation is performed in the transplantation, the fruits showed a high content of anthocyanin and total phenolics. The mycorrhizal inoculation influences decreasing the acidity in fruit throughout the growing season and increase firmness only during the early stage of production.

Design and performance evaluation of very thin overlays in Texas.

Science.gov (United States)

2009-06-01

Very thin overlays 1-inch thick or less were placed as surface layers on five major highways in Texas. : These mixes were designed in the laboratory to have a balance of good rut resistance as measured by : TxDOTs Hamburg Wheel Tracking test and g...

A comparative study between xerographic, computer-assisted overlay generation and animated-superimposition methods in bite mark analyses.

Science.gov (United States)

Tai, Meng Wei; Chong, Zhen Feng; Asif, Muhammad Khan; Rahmat, Rabiah A; Nambiar, Phrabhakaran

2016-09-01

This study was to compare the suitability and precision of xerographic and computer-assisted methods for bite mark investigations. Eleven subjects were asked to bite on their forearm and the bite marks were photographically recorded. Alginate impressions of the subjects' dentition were taken and their casts were made using dental stone. The overlays generated by xerographic method were obtained by photocopying the subjects' casts and the incisal edge outlines were then transferred on a transparent sheet. The bite mark images were imported into Adobe Photoshop® software and printed to life-size. The bite mark analyses using xerographically generated overlays were done by comparing an overlay to the corresponding printed bite mark images manually. In computer-assisted method, the subjects' casts were scanned into Adobe Photoshop®. The bite mark analyses using computer-assisted overlay generation were done by matching an overlay and the corresponding bite mark images digitally using Adobe Photoshop®. Another comparison method was superimposing the cast images with corresponding bite mark images employing the Adobe Photoshop® CS6 and GIF-Animator©. A score with a range of 0-3 was given during analysis to each precision-determining criterion and the score was increased with better matching. The Kruskal Wallis H test showed significant difference between the three sets of data (H=18.761, p<0.05). In conclusion, bite mark analysis using the computer-assisted animated-superimposition method was the most accurate, followed by the computer-assisted overlay generation and lastly the xerographic method. The superior precision contributed by digital method is discernible despite the human skin being a poor recording medium of bite marks. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

High order field-to-field corrections for imaging and overlay to achieve sub 20-nm lithography requirements

Science.gov (United States)

Mulkens, Jan; Kubis, Michael; Hinnen, Paul; de Graaf, Roelof; van der Laan, Hans; Padiy, Alexander; Menchtchikov, Boris

2013-04-01

Immersion lithography is being extended to the 20-nm and 14-nm node and the lithography performance requirements need to be tightened further to enable this shrink. In this paper we present an integral method to enable high-order fieldto- field corrections for both imaging and overlay, and we show that this method improves the performance with 20% - 50%. The lithography architecture we build for these higher order corrections connects the dynamic scanner actuators with the angle resolved scatterometer via a separate application server. Improvements of CD uniformity are based on enabling the use of freeform intra-field dose actuator and field-to-field control of focus. The feedback control loop uses CD and focus targets placed on the production mask. For the overlay metrology we use small in-die diffraction based overlay targets. Improvements of overlay are based on using the high order intra-field correction actuators on a field-tofield basis. We use this to reduce the machine matching error, extending the heating control and extending the correction capability for process induced errors.

Friction and wear of stainless steel, titanium and aluminium with various surface treatments, ion implantation and overlay hard coatings

International Nuclear Information System (INIS)

Bunshah, R.F.

1979-01-01

This paper deals with the evaluation of the wear properties of 304 stainless steel, commercial grade titanium and commercial grade aluminium without and with different surface treatments, i.e., ion implantation of boron and nitrogen, and overlay coating of superhard materials, titanium carbide and nitride by the Biased Activated Reactive Evaporation (BARE) process. Wear properties were evaluated in adhesive, erosive and abrasive modes of wear. In the case of adhesive wear, ion implantation resulted in an improved wear behaviour in lubricated conditions but had no beneficial effect in dry wear conditions. Overlay coatings on the other hand resulted in improved wear behaviour for both the dry and lubricating conditions. In the case of erosive wear with SiC particles at high velocities, overlay coatings showed higher erosion rates (typical of brittle materials in normal impingement) whereas ion implanted materials behaved similarly as untreated materials; i.e., a lower wear rate than the specimens with overlay coatings. In the case of abrasive wear, it was again observed that the wear rates of overlay coatings is far lower than the wear rates of untreated or ion implanted materials. (author)

Microstructure and Mechanical Properties of Inconel 625 Alloy on Low Carbon Steel by Heat Treatment after Overlay Welding

International Nuclear Information System (INIS)

Kim, Seungpil; Jang, Jaeho; Kim, Jungsoo; Kim, Byung Jun; Sohn, Keun Yong; Nam, Dae-Geun

2016-01-01

Overlay welding technique is one of methods used to improve metal mechanical properties such as strength, toughness and corrosion resistance. Generally, Inconel 625 alloy is used for overlay welding layer on low carbon steels for economic consideration. However, the method produces some problems in the microstructure of the cast structure and some defects, caused by the elevated temperatures of the overlay process. To resolve these problems, heat treatments are required. In this study, Inconel 625 alloy was welded on a low carbon steel by the overlay welding process to investigate the resulting microstructure and mechanical properties. A double heat treatment was performed to improve the mechanical properties of the welding and substrate layers. It was found that Inconel 625 alloy had an austenite microstructure after the first heat treatment, but the low carbon steel had a ferrite-pearlite microstructure after the second heat treatment. After the double heat treatment, the sample showed the optimum hardness because of grain refinement and homogenization of the microstructure.

Distributed fiber optic sensor-enhanced detection and prediction of shrinkage-induced delamination of ultra-high-performance concrete overlay

Science.gov (United States)

Bao, Yi; Valipour, Mahdi; Meng, Weina; Khayat, Kamal H.; Chen, Genda

2017-08-01

This study develops a delamination detection system for smart ultra-high-performance concrete (UHPC) overlays using a fully distributed fiber optic sensor. Three 450 mm (length) × 200 mm (width) × 25 mm (thickness) UHPC overlays were cast over an existing 200 mm thick concrete substrate. The initiation and propagation of delamination due to early-age shrinkage of the UHPC overlay were detected as sudden increases and their extension in spatial distribution of shrinkage-induced strains measured from the sensor based on pulse pre-pump Brillouin optical time domain analysis. The distributed sensor is demonstrated effective in detecting delamination openings from microns to hundreds of microns. A three-dimensional finite element model with experimental material properties is proposed to understand the complete delamination process measured from the distributed sensor. The model is validated using the distributed sensor data. The finite element model with cohesive elements for the overlay-substrate interface can predict the complete delamination process.

Microstructure and Mechanical Properties of Inconel 625 Alloy on Low Carbon Steel by Heat Treatment after Overlay Welding

Energy Technology Data Exchange (ETDEWEB)

Kim, Seungpil; Jang, Jaeho; Kim, Jungsoo; Kim, Byung Jun; Sohn, Keun Yong; Nam, Dae-Geun [Korea Institute of Industrial Technology, Busan (Korea, Republic of)

2016-08-15

Overlay welding technique is one of methods used to improve metal mechanical properties such as strength, toughness and corrosion resistance. Generally, Inconel 625 alloy is used for overlay welding layer on low carbon steels for economic consideration. However, the method produces some problems in the microstructure of the cast structure and some defects, caused by the elevated temperatures of the overlay process. To resolve these problems, heat treatments are required. In this study, Inconel 625 alloy was welded on a low carbon steel by the overlay welding process to investigate the resulting microstructure and mechanical properties. A double heat treatment was performed to improve the mechanical properties of the welding and substrate layers. It was found that Inconel 625 alloy had an austenite microstructure after the first heat treatment, but the low carbon steel had a ferrite-pearlite microstructure after the second heat treatment. After the double heat treatment, the sample showed the optimum hardness because of grain refinement and homogenization of the microstructure.

An Overlay Architecture for Throughput Optimal Multipath Routing

Science.gov (United States)

2017-01-14

maximum throughput. Finally, we propose a threshold-based policy (BP-T) and a heuristic policy (OBP), which dynamically control traffic bifurcations...network stability region is available . Second, given any subset of nodes that are controllable, we also wish to develop an optimal routing policy that...case when tunnels do not overlap. We also develop a heuristic overlay control policy for use on general topologies, and show through simulation that

Integrated scatterometry for tight overlay and CD control to enable 20-nm node wafer manufacturing.

Science.gov (United States)

Benschop, Jos; Engelen, Andre; Cramer, Hugo; Kubis, Michael; Hinnen, Paul; van der Laan, Hans; Bhattacharyya, Kaustuve; Mulkens, Jan

2013-04-01

The overlay, CDU and focus requirements for the 20nm node can only be met using a holistic lithography approach whereby full use is made of high-order, field-by-field, scanner correction capabilities. An essential element in this approach is a fast, precise and accurate in-line metrology sensor, capable to measure on product. The capabilities of the metrology sensor as well as the impact on overlay, CD and focus will be shared in this paper.

Single-Layer Limit of Metallic Indium Overlayers on Si(111).

Science.gov (United States)

Park, Jae Whan; Kang, Myung Ho

2016-09-09

Density-functional calculations are used to identify one-atom-thick metallic In phases grown on the Si(111) surface, which have long been sought in quest of the ultimate two-dimensional (2D) limit of metallic properties. We predict two metastable single-layer In phases, one sqrt[7]×sqrt[3] phase with a coverage of 1.4 monolayer (ML; here 1 ML refers to one In atom per top Si atom) and the other sqrt[7]×sqrt[7] phase with 1.43 ML, which indeed agree with experimental evidences. Both phases reveal quasi-1D arrangements of protruded In atoms, leading to 2D-metallic but anisotropic band structures and Fermi surfaces. This directional feature contrasts with the free-electron-like In-overlayer properties that are known to persist up to the double-layer thickness, implying that the ultimate 2D limit of In overlayers may have been achieved in previous studies of double-layer In phases.

Microeconomics-based resource allocation in overlay networks by using non-strategic behavior modeling

Science.gov (United States)

Analoui, Morteza; Rezvani, Mohammad Hossein

2011-01-01

Behavior modeling has recently been investigated for designing self-organizing mechanisms in the context of communication networks in order to exploit the natural selfishness of the users with the goal of maximizing the overall utility. In strategic behavior modeling, the users of the network are assumed to be game players who seek to maximize their utility with taking into account the decisions that the other players might make. The essential difference between the aforementioned researches and this work is that it incorporates the non-strategic decisions in order to design the mechanism for the overlay network. In this solution concept, the decisions that a peer might make does not affect the actions of the other peers at all. The theory of consumer-firm developed in microeconomics is a model of the non-strategic behavior that we have adopted in our research. Based on it, we have presented distributed algorithms for peers' "joining" and "leaving" operations. We have modeled the overlay network as a competitive economy in which the content provided by an origin server can be viewed as commodity and the origin server and the peers who multicast the content to their downside are considered as the firms. On the other hand, due to the dual role of the peers in the overlay network, they can be considered as the consumers as well. On joining to the overlay economy, each peer is provided with an income and tries to get hold of the service regardless to the behavior of the other peers. We have designed the scalable algorithms in such a way that the existence of equilibrium price (known as Walrasian equilibrium price) is guaranteed.

Inducing Resistance to Conspiracy Theory Propaganda: Testing Inoculation and Metainoculation Strategies

Science.gov (United States)

Banas, John A.; Miller, Gregory

2013-01-01

This investigation examined the boundaries of inoculation theory by examining how inoculation can be applied to conspiracy theory propaganda as well as inoculation itself (called metainoculation). A 3-phase experiment with 312 participants compared 3 main groups: no-treatment control, inoculation, and metainoculation. Research questions explored…

Lightweight storage and overlay networks for fault tolerance.

Energy Technology Data Exchange (ETDEWEB)

Oldfield, Ron A.

2010-01-01

The next generation of capability-class, massively parallel processing (MPP) systems is expected to have hundreds of thousands to millions of processors, In such environments, it is critical to have fault-tolerance mechanisms, including checkpoint/restart, that scale with the size of applications and the percentage of the system on which the applications execute. For application-driven, periodic checkpoint operations, the state-of-the-art does not provide a scalable solution. For example, on today's massive-scale systems that execute applications which consume most of the memory of the employed compute nodes, checkpoint operations generate I/O that consumes nearly 80% of the total I/O usage. Motivated by this observation, this project aims to improve I/O performance for application-directed checkpoints through the use of lightweight storage architectures and overlay networks. Lightweight storage provide direct access to underlying storage devices. Overlay networks provide caching and processing capabilities in the compute-node fabric. The combination has potential to signifcantly reduce I/O overhead for large-scale applications. This report describes our combined efforts to model and understand overheads for application-directed checkpoints, as well as implementation and performance analysis of a checkpoint service that uses available compute nodes as a network cache for checkpoint operations.

Surface crystallographic structures of cellulose nanofiber films and overlayers of pentacene

Science.gov (United States)

Nakayama, Yasuo; Mori, Toshiaki; Tsuruta, Ryohei; Yamanaka, Soichiro; Yoshida, Koki; Imai, Kento; Koganezawa, Tomoyuki; Hosokai, Takuya

2018-03-01

Cellulose nanofibers or nanocellulose is a promising recently developed biomass and biodegradable material used for various applications. In order to utilize this material as a substrate in organic electronic devices, thorough understanding of the crystallographic structures of the surfaces of the nanocellulose composites and of their interfaces with organic semiconductor molecules is essential. In this work, surface crystallographic structures of nanocellulose films (NCFs) and overlayers of pentacene were investigated by two-dimensional grazing-incidence X-ray diffraction. The NCFs are found to crystallize on solid surfaces with the crystal lattice preserving the same structure of the known bulk phase, whereas distortion of interchain packing toward the surface normal direction is suggested. The pentacene overlayers on the NCFs are found to form the thin-film phase with an in-plane mean crystallite size of over 10 nm.

Numerical evaluation of weld overlay applied to a pressurized water reactor nozzle mock-up

Energy Technology Data Exchange (ETDEWEB)

Rabello, Emerson G.; Silva, Luiz L.; Gomes, Paulo T.V., E-mail: egr@cdtn.b, E-mail: silvall@cdtn.b, E-mail: gomespt@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Servico de Integridade Estrutural

2011-07-01

The primary water stress corrosion cracking (PWSCC) is a major mechanism of failure in the primary circuit of PWR type nuclear power plants. The PWSCC is associated with the presence of corrosive environment, the susceptibility to corrosion cracking of the materials involved and the tensile stresses presence. Residual stresses generated during dissimilar materials welding can contribute to PWSCC. An alternative to the PWSCC mitigation is the application of external weld layers in the regions of greatest susceptibility to corrosion cracking. This process, called Weld Overlay (WOL), has been widely used in regions of dissimilar weld (low alloy steel and stainless steel with nickel alloy addition) of nozzles and pipes on the primary circuit in order to promote internal compressive stresses on the wall of these components. This paper presents the steps required to the numerical stress evaluation (by finite element method) during the dissimilar materials welding as well as application of Weld Overlay process in a nozzle mock-up. Thus, one can evaluate the effectiveness of the application of weld overlay process to internal compressive stress generation on the wall nozzle. (author)

Numerical evaluation of weld overlay applied to a pressurized water reactor nozzle mock-up

International Nuclear Information System (INIS)

Rabello, Emerson G.; Silva, Luiz L.; Gomes, Paulo T.V.

2011-01-01

The primary water stress corrosion cracking (PWSCC) is a major mechanism of failure in the primary circuit of PWR type nuclear power plants. The PWSCC is associated with the presence of corrosive environment, the susceptibility to corrosion cracking of the materials involved and the tensile stresses presence. Residual stresses generated during dissimilar materials welding can contribute to PWSCC. An alternative to the PWSCC mitigation is the application of external weld layers in the regions of greatest susceptibility to corrosion cracking. This process, called Weld Overlay (WOL), has been widely used in regions of dissimilar weld (low alloy steel and stainless steel with nickel alloy addition) of nozzles and pipes on the primary circuit in order to promote internal compressive stresses on the wall of these components. This paper presents the steps required to the numerical stress evaluation (by finite element method) during the dissimilar materials welding as well as application of Weld Overlay process in a nozzle mock-up. Thus, one can evaluate the effectiveness of the application of weld overlay process to internal compressive stress generation on the wall nozzle. (author)

Conditions Affecting Shelf-Life of Inoculated Legume Seed

Directory of Open Access Journals (Sweden)

Greg Gemell

2012-02-01

Full Text Available Microbial inoculants are becoming more available as sustainable alternatives to fertilizers and other agrichemicals in broad-acre cropping. However, with the exception of legume inoculants little is understood about effective delivery and survival of the inoculum. Legume inoculants are applied to both seed and soil but seed inoculation is the most economical technique. Large quantities of pasture seed in Australia are inoculated by commercial seed coating companies, but the long-term survival of seed-applied inoculum is variable and monitoring of viability requires specialist microbiology skills and facilities. The aim of our research was to define optimum storage conditions for survival of rhizobia on legume seed and evaluate water activity as a means of monitoring shelf-life. The relationship between survival and water activity varied according to seed species, inoculum preparation, coating ingredients, initial water activity and time suggesting that storage conditions would need to be defined for each different combination. Although drying seeds after coating significantly reduced viable numbers of rhizobia, survival of rhizobia on dried commercially coated lucerne seed after 11 weeks was less variable than seeds that had not been dried. The highest numbers were maintained when seeds remained dry with water activities of between 0.47 and 0.38. The quality of inoculated seed could be improved by reducing the death rate of inoculum during preparation and providing optimum storage conditions for long-term survival.

FEM Analysis and Measurement of Residual Stress by Neutron Diffraction on the Dissimilar Overlay Weld Pipe

International Nuclear Information System (INIS)

Kim, Kang Soo; Lee, Ho Jin; Woo, Wan Chuck; Seong, Baek Seok; Byeon, Jin Gwi; Park, Kwang Soo; Jung, In Chul

2010-01-01

Much research has been done to estimate the residual stress on a dissimilar metal weld. There are many methods to estimate the weld residual stress and FEM (Finite Element Method) is generally used due to the advantage of the parametric study. And the X-ray method and a Hole Drilling technique for an experimental method are also usually used. The aim of this paper is to develop the appropriate FEM model to estimate the residual stresses of the dissimilar overlay weld pipe. For this, firstly, the specimen of the dissimilar overlay weld pipe was manufactured. The SA 508 Gr3 nozzle, the SA 182 safe end and SA376 pipe were welded by the Alloy 182. And the overlay weld by the Alloy 52M was performed. The residual stress of this specimen was measured by using the Neutron Diffraction device in the HANARO (High-flux Advanced Neutron Application ReactOr) research reactor, KAERI (Korea Atomic Energy Research Institute). Secondly, FEM Model on the dissimilar overlay weld pipe was made and analyzed by the ABAQUS Code (ABAQUS, 2004). Thermal analysis and stress analysis were performed, and the residual stress was calculated. Thirdly, the results of the FEM analysis were compared with those of the experimental methods

Passivation of surface states of α-Fe2O3(0001) surface by deposition of Ga2O3 overlayers: A density functional theory study.

Science.gov (United States)

Ulman, Kanchan; Nguyen, Manh-Thuong; Seriani, Nicola; Gebauer, Ralph

2016-03-07

There is a big debate in the community regarding the role of surface states of hematite in the photoelectrochemical water splitting. Experimental studies on non-catalytic overlayers passivating the hematite surface states claim a favorable reduction in the overpotential for the water splitting reaction. As a first step towards understanding the effect of these overlayers, we have studied the system Ga2O3 overlayers on hematite (0001) surfaces using first principles computations in the PBE+U framework. Our computations suggest that stoichiometric terminations of Ga2O3 overlayers are energetically more favored than the bare surface, at ambient oxygen chemical potentials. Energetics suggest that the overlayers prefer to grow via a layer-plus-island (Stranski-Krastanov) growth mode with a critical layer thickness of 1-2 layers. Thus, a complete wetting of the hematite surface by an overlayer of gallium oxide is thermodynamically favored. We establish that the effect of deposition of the Ga2O3 overlayers on the bare hematite surface is to passivate the surface states for the stoichiometric termination. For the oxygen terminated surface which is the most stable termination under photoelectrochemical conditions, the effect of deposition of the Ga2O3 overlayer is to passivate the hole-trapping surface state.

Corrosion resistance and microstructure of alloy 625 weld overlay on ASTM A516 grade 70

Energy Technology Data Exchange (ETDEWEB)

Moradi, Mohammad J. [Amirkabir Univ. of Technology, Tehran (Iran, Islamic Republic of). Petroleum Engineering Dept.; Ketabchi, Mostafa [Amirkabir Univ. of Technology, Tehran (Iran, Islamic Republic of). Mining and Metallurgical Engineering Dept.

2016-02-01

Nickel-based alloys are a crucial class of materials because of their excellent corrosion resistance. In the present study, single layer and two layers alloy 625 weld overlays were deposited by GTAW process on A516 grade 70 carbon steel. The dilution in terms of Fe, Ni, Mo and Nb content was calculated in 30 points of weld overlay. Microstructure observations showed that alloy 625 had austenitic structure with two types of Laves and NbC secondary phases. The uniform and pitting corrosion resistance of alloy 625 weld overlay as casted and as forged were evaluated in accordance with ASTM G48-2011 standard at different temperatures to determine the weight loss and critical pitting temperature. For achieving a better comparison, samples from alloy 625 as casted and as forged were tested under the same conditions. The results point out that single layer alloy 625 weld overlay is not suitable for chloride containing environments, two layers alloy 625 weld overlay and alloy 625 as casted have acceptable corrosion resistance and almost the same critical pitting temperature. Alloy 625 as forged has the best corrosion resistance and the highest critical pitting temperature among all test specimens. Also, the corrosion behavior was evaluated in accordance with ASTM G28 standard. The corrosion rate of single layer weld overlay was unacceptable. The average corrosion rate of two layers weld overlay and in casted condition were 35.82 and 33.01 mpy, respectively. [German] Nickellegierungen sind aufgrund ihres exzellenten Korrosionswiderstandes eine bedeutende Werkstoffklasse. In der diesem Beitrag zugrunde liegenden Studie wurden mittels WIG-Schweissens ein- und zweilagige Schweissplattierungen auf den Kohlenstoffstahl A516 (Grade 70) aufgebracht. Die Vermischung in Form des Fe-, Ni-, Mo- und Nb-Gehaltes wurde an 30 Punkten der Schweissplattierungen berechnet. Die mikrostrukturellen Untersuchungen ergaben, dass die Legierung 625 eine austenitische Struktur mit zwei Arten von

Effect of preemptive weld overlay on residual stress mitigation for dissimilar metal weld of nuclear power plant pressurizer

International Nuclear Information System (INIS)

Song, Tae Kwang; Bae, Hong Yeol; Chun, Yun Bae; Oh, Chang Young; Kim, Yun Jae; Lee, Kyoung Soo; Park, Chi Yong

2008-01-01

Weld overlay is one of the residual stress mitigation methods which arrest crack initiation and crack growth. Therefore weld overlay can be applied to the region where cracking is likely to be. An overlay weld used in this manner is termed a Preemptive Weld OverLay(PWOL). In Pressurized Water Reactor(PWR) dissimilar metal weld is susceptible region for Primary Water Stress Corrosion Cracking(PWSCC). In order to examine the effect of PWOL on residual stress mitigation, PWOL was applied to a specific dissimilar metal weld of Kori nuclear power plant by finite element analysis method. As a result, strong compressive residual stress was made in PWSCC susceptible region and PWOL was proved effective preemptive repair method for weldment

Effect of preemptive weld overlay on residual stress mitigation for dissimilar metal weld of nuclear power plant pressurizer

Energy Technology Data Exchange (ETDEWEB)

Song, Tae Kwang; Bae, Hong Yeol; Chun, Yun Bae; Oh, Chang Young; Kim, Yun Jae [Korea University, Seoul (Korea, Republic of); Lee, Kyoung Soo; Park, Chi Yong [Korea Electric Power Research Institute, Daejeon (Korea, Republic of)

2008-10-15

Weld overlay is one of the residual stress mitigation methods which arrest crack initiation and crack growth. Therefore weld overlay can be applied to the region where cracking is likely to be. An overlay weld used in this manner is termed a Preemptive Weld OverLay(PWOL). In Pressurized Water Reactor(PWR) dissimilar metal weld is susceptible region for Primary Water Stress Corrosion Cracking(PWSCC). In order to examine the effect of PWOL on residual stress mitigation, PWOL was applied to a specific dissimilar metal weld of Kori nuclear power plant by finite element analysis method. As a result, strong compressive residual stress was made in PWSCC susceptible region and PWOL was proved effective preemptive repair method for weldment.

A Hybrid P2P Overlay Network for Non-strictly Hierarchically Categorized Content

Science.gov (United States)

Wan, Yi; Asaka, Takuya; Takahashi, Tatsuro

In P2P content distribution systems, there are many cases in which the content can be classified into hierarchically organized categories. In this paper, we propose a hybrid overlay network design suitable for such content called Pastry/NSHCC (Pastry for Non-Strictly Hierarchically Categorized Content). The semantic information of classification hierarchies of the content can be utilized regardless of whether they are in a strict tree structure or not. By doing so, the search scope can be restrained to any granularity, and the number of query messages also decreases while maintaining keyword searching availability. Through simulation, we showed that the proposed method provides better performance and lower overhead than unstructured overlays exploiting the same semantic information.

Cracking and debonding of a thin fiber reinforced concrete overlay : research brief.

Science.gov (United States)

2017-03-01

Experimental tests found that the tensile interfacial energy : increased with fiber-reinforcement. Also bond tests indicated : that interfacial fracture occurred through the overlay mixture and : was proportional to the number of fibers which interse...

C-arm Cone Beam Computed Tomographic Needle Path Overlay for Fluoroscopic-Guided Placement of Translumbar Central Venous Catheters

International Nuclear Information System (INIS)

Tam, Alda; Mohamed, Ashraf; Pfister, Marcus; Rohm, Esther; Wallace, Michael J.

2009-01-01

C-arm cone beam computed tomography is an advanced 3D imaging technology that is currently available on state-of-the-art flat-panel-based angiography systems. The overlay of cross-sectional imaging information can now be integrated with real-time fluoroscopy. This overlay technology was used to guide the placement of three percutaneous translumbar inferior vena cava catheters.

Feeder use predicts both acquisition and transmission of a contagious pathogen in a North American songbird.

Science.gov (United States)

Adelman, James S; Moyers, Sahnzi C; Farine, Damien R; Hawley, Dana M

2015-09-22

Individual heterogeneity can influence the dynamics of infectious diseases in wildlife and humans alike. Thus, recent work has sought to identify behavioural characteristics that contribute disproportionately to individual variation in pathogen acquisition (super-receiving) or transmission (super-spreading). However, it remains unknown whether the same behaviours enhance both acquisition and transmission, a scenario likely to result in explosive epidemics. Here, we examined this possibility in an ecologically relevant host-pathogen system: house finches and their bacterial pathogen, Mycoplasma gallisepticum, which causes severe conjunctivitis. We examined behaviours likely to influence disease acquisition (feeder use, aggression, social network affiliations) in an observational field study, finding that the time an individual spends on bird feeders best predicted the risk of conjunctivitis. To test whether this behaviour also influences the likelihood of transmitting M. gallisepticum, we experimentally inoculated individuals based on feeding behaviour and tracked epidemics within captive flocks. As predicted, transmission was fastest when birds that spent the most time on feeders initiated the epidemic. Our results suggest that the same behaviour underlies both pathogen acquisition and transmission in this system and potentially others. Identifying individuals that exhibit such behaviours is critical for disease management. © 2015 The Author(s).

Impact of organic overlayers on a-Si:H/c-Si surface potential

KAUST Repository

Seif, Johannes P.

2017-04-11

Bilayers of intrinsic and doped hydrogenated amorphous silicon, deposited on crystalline silicon (c-Si) surfaces, simultaneously provide contact passivation and carrier collection in silicon heterojunction solar cells. Recently, we have shown that the presence of overlaying transparent conductive oxides can significantly affect the c-Si surface potential induced by these amorphous silicon stacks. Specifically, deposition on the hole-collecting bilayers can result in an undesired weakening of contact passivation, thereby lowering the achievable fill factor in a finished device. We test here a variety of organic semiconductors of different doping levels, overlaying hydrogenated amorphous silicon layers and silicon-based hole collectors, to mitigate this effect. We find that these materials enhance the c-Si surface potential, leading to increased implied fill factors. This opens opportunities for improved device performance.

Impact of organic overlayers on a-Si:H/c-Si surface potential

KAUST Repository

Seif, Johannes P.; Niesen, Bjoern; Tomasi, Andrea; Ballif, Christophe; De Wolf, Stefaan

2017-01-01

Bilayers of intrinsic and doped hydrogenated amorphous silicon, deposited on crystalline silicon (c-Si) surfaces, simultaneously provide contact passivation and carrier collection in silicon heterojunction solar cells. Recently, we have shown that the presence of overlaying transparent conductive oxides can significantly affect the c-Si surface potential induced by these amorphous silicon stacks. Specifically, deposition on the hole-collecting bilayers can result in an undesired weakening of contact passivation, thereby lowering the achievable fill factor in a finished device. We test here a variety of organic semiconductors of different doping levels, overlaying hydrogenated amorphous silicon layers and silicon-based hole collectors, to mitigate this effect. We find that these materials enhance the c-Si surface potential, leading to increased implied fill factors. This opens opportunities for improved device performance.

Nitrogen translocation in wheat inoculated with Azospirillum and fertilized with nitrogen

Directory of Open Access Journals (Sweden)

RODRIGUES OSMAR

2000-01-01

Full Text Available The productivity and the translocation of assimilates and nitrogen (N were compared after inoculation of wheat (Triticum aestivum L., cv. BR-23 seeds with two strains of Azospirillum brasilense (strains 245 and JA 04 under field conditions. The inoculation of wheat seeds was done with a peat inoculant at sowing time. Plant material for evaluations were collected at anthesis and maturity. No differences in grain yield and in the translocation of assimilates resulting from inoculation were detected. Differences were observed in relation to N rates (0, 15, and 60 kg ha-1. N content in the grain increased significantly in the bacteria-inoculated treatments in which N was not added. This increase in N content in the grain with inoculation was probably due to higher N uptake after anthesis without any significant contribution on the grain yield. Such increment was of 8.4 kg ha-1 of N representing 66% more N than in no inoculated treatment. Regardless of the inoculation and the rate of N applied, it was observed that about 70% of the N accumulated at anthesis was translocated from vegetative parts to the grain.

Overlay improvement by exposure map based mask registration optimization

Science.gov (United States)

Shi, Irene; Guo, Eric; Chen, Ming; Lu, Max; Li, Gordon; Li, Rivan; Tian, Eric

2015-03-01

Along with the increased miniaturization of semiconductor electronic devices, the design rules of advanced semiconductor devices shrink dramatically. [1] One of the main challenges of lithography step is the layer-to-layer overlay control. Furthermore, DPT (Double Patterning Technology) has been adapted for the advanced technology node like 28nm and 14nm, corresponding overlay budget becomes even tighter. [2][3] After the in-die mask registration (pattern placement) measurement is introduced, with the model analysis of a KLA SOV (sources of variation) tool, it's observed that registration difference between masks is a significant error source of wafer layer-to-layer overlay at 28nm process. [4][5] Mask registration optimization would highly improve wafer overlay performance accordingly. It was reported that a laser based registration control (RegC) process could be applied after the pattern generation or after pellicle mounting and allowed fine tuning of the mask registration. [6] In this paper we propose a novel method of mask registration correction, which can be applied before mask writing based on mask exposure map, considering the factors of mask chip layout, writing sequence, and pattern density distribution. Our experiment data show if pattern density on the mask keeps at a low level, in-die mask registration residue error in 3sigma could be always under 5nm whatever blank type and related writer POSCOR (position correction) file was applied; it proves random error induced by material or equipment would occupy relatively fixed error budget as an error source of mask registration. On the real production, comparing the mask registration difference through critical production layers, it could be revealed that registration residue error of line space layers with higher pattern density is always much larger than the one of contact hole layers with lower pattern density. Additionally, the mask registration difference between layers with similar pattern density

Remediation of petroleum hydrocarbons by inoculation with laboratory-cultured microorganisms

International Nuclear Information System (INIS)

Maxwell, C.R.; Baqai, H.A.

1995-01-01

An unauthorized release of gasoline from an underground storage tank (UST) impacted the soil and groundwater beneath a maintenance and fueling capacity. The property owner attempted to remediate the site by inoculating wells screened within the unsaturated and saturated zones with laboratory-cultured microorganisms. The inoculation was a one-time event. No nutrients were added to the subsurface. Air was injected into all inoculation wells during the project to promote aerobic microbial activity. At the first groundwater sampling event after inoculation, concentrations of petroleum hydrocarbon constituents increased inoculation wells. Measurements of dissolved oxygen in the groundwater appeared to indicate that oxygen consumption, and thus hydrocarbon degradation, was not occurring. Visual and olfactory evidence of the groundwater indicated evidence of decaying organic matter. After approximately 1 year and a thorough purging of the inoculation wells, decaying matter disappeared and dissolved oxygen and hydrocarbon concentrations generally returned to preproject levels. Further contaminant reduction did not occur, indicating temporary degradation of water quality as a result of the project and unsuccessful remediation

In-die photomask registration and overlay metrology with PROVE using 2D correlation methods

Science.gov (United States)

Seidel, D.; Arnz, M.; Beyer, D.

2011-11-01

According to the ITRS roadmap, semiconductor industry drives the 193nm lithography to its limits, using techniques like double exposure, double patterning, mask-source optimization and inverse lithography. For photomask metrology this translates to full in-die measurement capability for registration and critical dimension together with challenging specifications for repeatability and accuracy. Especially, overlay becomes more and more critical and must be ensured on every die. For this, Carl Zeiss SMS has developed the next generation photomask registration and overlay metrology tool PROVE® which serves the 32nm node and below and which is already well established in the market. PROVE® features highly stable hardware components for the stage and environmental control. To ensure in-die measurement capability, sophisticated image analysis methods based on 2D correlations have been developed. In this paper we demonstrate the in-die capability of PROVE® and present corresponding measurement results for shortterm and long-term measurements as well as the attainable accuracy for feature sizes down to 85nm using different illumination modes and mask types. Standard measurement methods based on threshold criteria are compared with the new 2D correlation methods to demonstrate the performance gain of the latter. In addition, mask-to-mask overlay results of typical box-in-frame structures down to 200nm feature size are presented. It is shown, that from overlay measurements a reproducibility budget can be derived that takes into account stage, image analysis and global effects like mask loading and environmental control. The parts of the budget are quantified from measurement results to identify critical error contributions and to focus on the corresponding improvement strategies.

Inoculation Effects of Cast Iron

Directory of Open Access Journals (Sweden)

E. Fraś

2012-12-01

Full Text Available The paper presents a solidification sequence of graphite eutectic cells of A and D types, as well as globular and cementite eutectics. The morphology of eutectic cells in cast iron, the equations for their growth and the distances between the graphite precipitations in A and D eutectic types were analyzed. It is observed a critical eutectic growth rate at which one type of eutectic transformed into another. A mathematical formula was derived that combined the maximum degree of undercooling, the cooling rate of cast iron, eutectic cell count and the eutectic growth rate. One type of eutectic structure turned smoothly into the other at a particular transition rate, transformation temperature and transformational eutectic cell count. Inoculation of cast iron increased the number of eutectic cells with flake graphite and the graphite nodule count in ductile iron, while reducing the undercooling. An increase in intensity of inoculation caused a smooth transition from a cementite eutectic structure to a mixture of cementite and D type eutectic structure, then to a mixture of D and A types of eutectics up to the presence of only the A type of eutectic structure. Moreover, the mechanism of inoculation of cast iron was studied.

Three-dimensional magnetic resonance imaging overlay to assist with percutaneous transhepatic access at the time of cardiac catheterization

International Nuclear Information System (INIS)

Whiteside, Wendy; Christensen, Jason; Zampi, Jeffrey D

2005-01-01

Multimodality image overlay is increasingly used for complex interventional procedures in the cardiac catheterization lab. We report a case in which three-dimensional magnetic resonance imaging (3D MRI) overlay onto live fluoroscopic imaging was utilized to safely obtain transhepatic access in a 12-year-old patient with prune belly syndrome, complex and distorted abdominal anatomy, and a vascular mass within the liver

Improved Intelligent Underlay-Overlay Combined with Frequency Hopping in GSM

DEFF Research Database (Denmark)

Wigard, Jeroen; Nielsen, Thomas Toftegaard; Mogensen, Preben Elgaard

1997-01-01

IUO (intelligent underlay-overlay) in a combination with random frequency hopping in GSM is analysed. Several improvements to the original IUO concept analysed in Nielsen et al. (1997) are introduced. With the improved IUO concept it is possible to load a network configuration consisting of 4...

smallholder farmers' use and profitability of legume inoculants

African Journals Online (AJOL)

ACSS

Rhizobia inoculant, a product of Kenya, and its profitability in smallholder farms. Data were collected from ... of the inoculants use and gross margin analysis to examine profitability. The area under the .... the effects of various factors on the extent of. BIOFIX® use. ..... little information, resulting in reduced adoption of legume ...

Disordering kinetics in surface overlayers

International Nuclear Information System (INIS)

Jesina, A.; Tringides, M.C.

1993-01-01

The disordering kinetics of the O/W(110)-p(2x1)+p(2x2) overlayer, prepared initially in a well-ordered state, are studied with low-energy electron diffraction profile analysis. The decay of the peak intensity, used as a measure of the growing disorder, cannot be fitted to a power law as in the case of ordering processes. The full width at half maximum of the time-dependent structure factor S(q,t) is constant with time, which suggests that the average size remains constant. Diffusion activation energy extracted for the temperature dependence of the disordering is 1.0±0.05 eV, which is different from the value of 0.6 eV measured in ordering processes. The difference can be explained by the adsorbate-adsorbate interactions, which contribute differently to the diffusion barrier, in the two experiments

Evaluation of iron aluminide weld overlays for erosion - corrosion resistant boiler tube coatings in low NO{sub x} boilers

Energy Technology Data Exchange (ETDEWEB)

DuPont, J.N.; Banovic, S.W.; Marder, A.R. [Lehigh Univ., Bethlehem, PA (United States)

1996-08-01

Low NOx burners are being installed in many fossil fired power plants in order to comply with new Clean Air Regulations. Due to the operating characteristics of these burners, boiler tube sulfidation corrosion is often enhanced and premature tube failures can occur. Failures due to oxidation and solid particle erosion are also a concern. A program was initiated in early 1996 to evaluate the use of iron aluminide weld overlays for erosion/corrosion protection of boiler tubes in Low NOx boilers. Composite iron/aluminum wires will be used with the Gas Metal Arc Welding (GMAW) process to prepare overlays on boiler tubes steels with aluminum contents from 8 to 16wt%. The weldability of the composite wires will be evaluated as a function of chemical composition and welding parameters. The effect of overlay composition on corrosion (oxidation and sulfidation) and solid particle erosion will also be evaluated. The laboratory studies will be complemented by field exposures of both iron aluminide weld overlays and co-extruded tubing under actual boiler conditions.

Three-dimensional magnetic resonance imaging overlay to assist with percutaneous transhepatic access at the time of cardiac catheterization

Directory of Open Access Journals (Sweden)

Wendy Whiteside

2015-01-01

Full Text Available Multimodality image overlay is increasingly used for complex interventional procedures in the cardiac catheterization lab. We report a case in which three-dimensional magnetic resonance imaging (3D MRI overlay onto live fluoroscopic imaging was utilized to safely obtain transhepatic access in a 12-year-old patient with prune belly syndrome, complex and distorted abdominal anatomy, and a vascular mass within the liver.

Cross inoculation of anthracnose pathogens infecting various tropical fruits

Science.gov (United States)

Suparman; Rahmiyah, M.; Pujiastuti, Y.; Gunawan, B.; Arsi

2018-01-01

Anthracnose disease is very important disease of tropical fruits causing significant yield losses. The disease is caused by Colletotrichum spp. and infects almost all tropical fruit species, especially the succulent ones. Various species of Colletotrichum infect various tropical fruits and there are possibilities for cross inoculation to occur among tropical fruits which might cause severe infection. An experimental research was conducted to examine the effect of cross inoculation of anthracnose pathogen among papaya, eggplant, chili and common bean on the infection development and severity of the disease on each inoculated fruit species. Colletotrichum spp. were isolated from naturally infected papaya, eggplant, chili and common bean. Each fungal isolate was purified and identified to determine the species name. The spores of each isolate were then used to separately inoculate healthy and sterilized papaya, eggplant, chili and common bean. The results showed that cross infection developed on chili, eggplant and papaya but not on bean. Chili showed the highest susceptibility to all Colletotrichum isolates and significantly different from eggplant and papaya. The anthracnose pathogen isolated from common bean showed no pathogenicity to other hosts and might be used as cross protection inoculant to the disease in the other hosts.

Material development for waste to energy plants. Overlay welding and refractory linings. Final report

Energy Technology Data Exchange (ETDEWEB)

Noergaard Hansson, A.

2011-02-15

Waste is an extremely corrosive fuel. In order to recover a higher percentage of the energy in waste, waste incineration plants have developed from purely heat producing units to heat and power producing units. The change in concept results in higher material temperatures and thereby faster material degradation. As a result material failures have been observed in many waste incineration plants. The purpose of this project was to develop materials with higher resistance to the corrosive elements, in order to reduce the cost of maintenance, increase the availability, and increase the efficiency. The focus is on overlay welding and refractory linings. Inconel 625, alloy 50, alloy 686, and Super 625 offer equivalent corrosion protection at panel walls. 100% overlay performs better than 50% overlay. The corrosion morphology changes with increasing temperature from pitting and general corrosion to pitting and selective corrosion (dendritic core or grain boundaries). The previously observed detrimental effect of Fe on the corrosion resistance was not confirmed. It probably depends on factors such as microstructure of the alloy and local metal temperature. Ni-overlay also reduces the corrosion rates on superheater tubes. However, the superheater environment is less aggressive than the water wall environment. Failure of refractory linings is linked to excess porosity, detrimental reactions between raw materials and other mix constituents, volume growth reactions between base material and salt depositions, and thermal stress induced crack formation. Free water and not decomposition of hydrates causes spalling and cracking during the initial heating of refractory linings. Finite Element analysis confirms the stress levels between steel and refractory with the higher stress level at the top of the panel wall tube. A number of LCC mixes were formulated, adjusted and tested. Mixes with low open porosities ({approx} 10%) and state of the art resistance to KCl were achieved. (LN)

Effect of preemptive weld overlay sequence on residual stress distribution for dissimilar metal weld of Kori nuclear power plant pressurizer

Energy Technology Data Exchange (ETDEWEB)

Bae, Hong Yeol; Song, Tae Kwang; Chun, Yun Bae; Oh, Chang Young; Kim, Yun Jae [Korea Univ., Seoul (Korea, Republic of); Lee, Kyoung Soo; Park, Chi Yong [Korea Electric Power Research Institute, Daejeon (Korea, Republic of)

2008-07-01

Weld overlay is one of the residual stress mitigation method which arrest crack. An overlay weld sued in this manner is termed a Preemptive Weld OverLay(PWOL). PWOL was good for distribution of residual stress of Dissimilar Metal Weld(DMW) by previous research. Because range of overlay welding is wide relatively, residual stress distribution on PWR is affected by welding sequence. In order to examine the effect of welding sequence, PWOL was applied to a specific DMW of KORI nuclear power plant by finite element analysis method. As a result, the welding direction that from nozzle to pipe is better good for residual stress distribution on PWR.

Effect of preemptive weld overlay sequence on residual stress distribution for dissimilar metal weld of Kori nuclear power plant pressurizer

International Nuclear Information System (INIS)

Bae, Hong Yeol; Song, Tae Kwang; Chun, Yun Bae; Oh, Chang Young; Kim, Yun Jae; Lee, Kyoung Soo; Park, Chi Yong

2008-01-01

Weld overlay is one of the residual stress mitigation method which arrest crack. An overlay weld sued in this manner is termed a Preemptive Weld OverLay(PWOL). PWOL was good for distribution of residual stress of Dissimilar Metal Weld(DMW) by previous research. Because range of overlay welding is wide relatively, residual stress distribution on PWR is affected by welding sequence. In order to examine the effect of welding sequence, PWOL was applied to a specific DMW of KORI nuclear power plant by finite element analysis method. As a result, the welding direction that from nozzle to pipe is better good for residual stress distribution on PWR

More on Inoculating Against Reactance to Persuasive Health Messages: The Paradox of Threat.

Science.gov (United States)

Richards, Adam S; Banas, John A; Magid, Yoav

2017-07-01

This research examined the efficacy of inoculation as a strategy to mitigate psychological reactance based on the level of threat communicated in the forewarning and subsequent persuasive health appeal. Two 2 (inoculation) × 2 (freedom-threatening language) experiments were conducted. The first (N = 181) used elaborated inoculation designed to enhance the threat of impending reactance to a message advocating for responsible alcohol consumption. The second (N = 159) used limited inoculation designed to minimize the threat of impending reactance to a message advocating for responsible soft drink consumption. Results showed that elaborated inoculation increased reactance, whereas limited inoculation decreased reactance but only when the subsequent appeal used less freedom-threatening language. These findings suggest that inoculation has the potential to facilitate or buffer reactance depending on the level of threat communicated in inoculation forewarnings and in subsequent persuasive health appeals.

Atomistic simulation study of short pulse laser interactions with a metal target under conditions of spatial confinement by a transparent overlayer

Energy Technology Data Exchange (ETDEWEB)

Karim, Eaman T.; Shugaev, Maxim; Wu, Chengping; Zhigilei, Leonid V., E-mail: lz2n@virginia.edu [Department of Materials Science and Engineering, University of Virginia, 395 McCormick Road, Charlottesville, Virginia 22904-4745 (United States); Lin, Zhibin; Hainsey, Robert F. [Electro Scientific Industries, Inc., 13900 NW Science Park Drive, Portland, Oregon 97229 (United States)

2014-05-14

The distinct characteristics of short pulse laser interactions with a metal target under conditions of spatial confinement by a solid transparent overlayer are investigated in a series of atomistic simulations. The simulations are performed with a computational model combining classical molecular dynamics (MD) technique with a continuum description of the laser excitation, electron-phonon equilibration, and electronic heat transfer based on two-temperature model (TTM). Two methods for incorporation of the description of a transparent overlayer into the TTM-MD model are designed and parameterized for Ag-silica system. The material response to the laser energy deposition is studied for a range of laser fluences that, in the absence of the transparent overlayer, covers the regimes of melting and resolidification, photomechanical spallation, and phase explosion of the overheated surface region. In contrast to the irradiation in vacuum, the spatial confinement by the overlayer facilitates generation of sustained high-temperature and high-pressure conditions near the metal-overlayer interface, suppresses the generation of unloading tensile wave, decreases the maximum depth of melting, and prevents the spallation and explosive disintegration of the surface region of the metal target. At high laser fluences, when the laser excitation brings the surface region of the metal target to supercritical conditions, the confinement prevents the expansion and phase decomposition characteristic for the vacuum conditions leading to a gradual cooling of the hot compressed supercritical fluid down to the liquid phase and eventual solidification. The target modification in this case is limited to the generation of crystal defects and the detachment of the metal target from the overlayer.

GERMINATION OF GRASSES DUE TO INOCULATION DIAZOTROPHIC BACTERIA

Directory of Open Access Journals (Sweden)

C. D. A. Moreira

2014-07-01

Full Text Available The germination of forage grasses suffers from numbness and a natural tendency to low quality. The use of microorganisms inoculated in seeds with the purpose of increasing and meet the demand of some nutrient has been shown to be efficient, but the role of the microorganism in germination and rate of force is still unknown. Therefore the goal as study was to evaluate the germination rate of seeds of three cultivars of Brachiaria brizantha CV. Marandu, b., b. brizantha CV. Xaraés and b. humidícola cv Tupi and a cultivar of millet, P. hybrid cv Massai depending on the bacterium Azospirillum brasilense diazotrofic inoculation (nitrogen-fixing. Germination test was used in seed dispersal to assess the effect of first count (VPC in the treatments with and without inoculation. It was done also conducted further tests of electrical conductivity, weight of thousand seeds and water content. The delineation used was randomized entirely (DIC and the statistical analysis carried out through the analysis of variance and comparison of means using the Tukey test, the 5% probability. Massai grass seeds have the highest rate of force of first count in both treatments. Inoculation of bacterium Azospirillum brasilense did not affect the values of force of first count on seeds of the cultivars Marandu, Xaraés, Tupi and Massai. The seeds of the massai have higher germination speed relative the other cultivars evaluated when inoculated.

Heavy Vehicle Simulator aided evaluation of overlays on pavements with active cracks

CSIR Research Space (South Africa)

Viljoen, AW

1987-07-01

Full Text Available their effects by means of field data from actual pavements. The South African Heavy Simulator was also used to evaluate a variety of conventional and innovative asphaltic overlays on a severely cracked concrete pavement of which the mechanisms and extent...

Inoculation in Political Campaign Communication.

Science.gov (United States)

Pfau, Michael; Burgoon, Michael

1988-01-01

Posits a strategy of resistance to the influence of attack messages in political campaigns. Finds that political campaign messages can be designed to inoculate supporters of candidates against subsequent attack messages of opposing candidates. (MS)

Opportunistic transmitter selection for selfless overlay cognitive radios

KAUST Repository

Shaqfeh, Mohammad

2013-11-01

We propose an opportunistic strategy to grant channel access to the primary and secondary transmitters in causal selfless overlay cognitive radios over block-fading channels. The secondary transmitter helps the primary transmitter by relaying the primary messages opportunistically, aided by a buffer to store the primary messages temporarily. The optimal channel-aware transmitter- selection strategy is the solution of the maximization of the average secondary rate under the average primary rate requirement and the buffer stability constraints. Numerical results demonstrate the gains of the proposed opportunistic selection strategy. © 2013 IEEE.

Overlay accuracy on a flexible web with a roll printing process based on a roll-to-roll system.

Science.gov (United States)

Chang, Jaehyuk; Lee, Sunggun; Lee, Ki Beom; Lee, Seungjun; Cho, Young Tae; Seo, Jungwoo; Lee, Sukwon; Jo, Gugrae; Lee, Ki-yong; Kong, Hyang-Shik; Kwon, Sin

2015-05-01

For high-quality flexible devices from printing processes based on Roll-to-Roll (R2R) systems, overlay alignment during the patterning of each functional layer poses a major challenge. The reason is because flexible substrates have a relatively low stiffness compared with rigid substrates, and they are easily deformed during web handling in the R2R system. To achieve a high overlay accuracy for a flexible substrate, it is important not only to develop web handling modules (such as web guiding, tension control, winding, and unwinding) and a precise printing tool but also to control the synchronization of each unit in the total system. A R2R web handling system and reverse offset printing process were developed in this work, and an overlay between the 1st and 2nd layers of ±5μm on a 500 mm-wide film was achieved at a σ level of 2.4 and 2.8 (x and y directions, respectively) in a continuous R2R printing process. This paper presents the components and mechanisms used in reverse offset printing based on a R2R system and the printing results including positioning accuracy and overlay alignment accuracy.

Experimental inoculation of equine coronavirus into Japanese draft horses.

Science.gov (United States)

Nemoto, Manabu; Oue, Yasuhiro; Morita, Yoshinori; Kanno, Toru; Kinoshita, Yuta; Niwa, Hidekazu; Ueno, Takanori; Katayama, Yoshinari; Bannai, Hiroshi; Tsujimura, Koji; Yamanaka, Takashi; Kondo, Takashi

2014-12-01

Recently, outbreaks associated with equine coronavirus (ECoV) have occurred in Japan and the United States. While ECoV is likely to be pathogenic to horses, it has not been shown that experimental inoculation of horses with ECoV produces clinical signs of disease. In this study, we inoculated three Japanese draft horses with an ECoV-positive diarrheic fecal sample to confirm infection after inoculation and to investigate the clinical course and virus shedding patterns of ECoV. Virus neutralization tests showed that all three horses became infected with ECoV. Two of the three horses developed clinical signs similar to those observed during ECoV outbreaks, including fever, anorexia, and gastrointestinal dysfunction. All horses excreted a large amount of virus into their feces for more than 9 days after inoculation regardless of the presence or absence of clinical signs, which suggests that feces are an important source of ECoV infection. ECoV was also detected in nasal swabs from all horses, suggesting that respiratory transmission of ECoV may occur. Both symptomatic horses developed viremia, while the asymptomatic horse did not. White blood cell counts and serum amyloid A concentrations changed relative to the clinical condition of the inoculated horses; these may be useful markers for monitoring the clinical status of horses infected with ECoV. This is the first report of induction of clinical signs of ECoV infection in horses by experimental inoculation. These clinical and virological findings should aid further investigation of the pathogenesis of ECoV.

Iron aluminide weld overlay coatings for boiler tube protection in coal-fired low NOx boilers

Energy Technology Data Exchange (ETDEWEB)

Banovic, S.W.; DuPont, J.N.; Marder, A.R. [Lehigh Univ., Bethlehem, PA (United States). Energy Research Center

1997-12-01

Iron aluminide weld overlay coatings are currently being considered for enhanced sulfidation resistance in coal-fired low NO{sub x} boilers. The use of these materials is currently limited due to hydrogen cracking susceptibility, which generally increases with an increase in aluminum concentration of the deposit. The overall objective of this program is to attain an optimum aluminum content with good weldability and improved sulfidation resistance with respect to conventional materials presently in use. Research has been initiated using Gas Tungsten Arc Welding (GTAW) in order to achieve this end. Under different sets of GTAW parameters (wire feed speed, current), both single and multiple pass overlays were produced. Characterization of all weldments was conducted using light optical microscopy, scanning electron microscopy, and electron probe microanalysis. Resultant deposits exhibited a wide range of aluminum contents (5--43 wt%). It was found that the GTAW overlays with aluminum contents above {approximately}10 wt% resulted in cracked coatings. Preliminary corrosion experiments of 5 to 10 wt% Al cast alloys in relatively simple H{sub 2}/H{sub 2}S gas mixtures exhibited corrosion rates lower than 304 stainless steel.

effect of tillage, rhizobium inoculation in maize-soybean- based ...

African Journals Online (AJOL)

main plot, four rhizobium inoculation in soybean-maize-based cropping systems ... production systems, such as cropping systems, ... of commercial inoculants. Studies ... and distributed by IITA business incubation ... sowing, while the remaining part (2/3) was done as ...... biological nitrogen fixation potential and grain yield.

Improved antifouling properties and selective biofunctionalization of stainless steel by employing heterobifunctional silane-polyethylene glycol overlayers and avidin-biotin technology

Science.gov (United States)

Hynninen, Ville; Vuori, Leena; Hannula, Markku; Tapio, Kosti; Lahtonen, Kimmo; Isoniemi, Tommi; Lehtonen, Elina; Hirsimäki, Mika; Toppari, J. Jussi; Valden, Mika; Hytönen, Vesa P.

2016-01-01

A straightforward solution-based method to modify the biofunctionality of stainless steel (SS) using heterobifunctional silane-polyethylene glycol (silane-PEG) overlayers is reported. Reduced nonspecific biofouling of both proteins and bacteria onto SS and further selective biofunctionalization of the modified surface were achieved. According to photoelectron spectroscopy analyses, the silane-PEGs formed less than 10 Å thick overlayers with close to 90% surface coverage and reproducible chemical compositions. Consequently, the surfaces also became more hydrophilic, and the observed non-specific biofouling of proteins was reduced by approximately 70%. In addition, the attachment of E. coli was reduced by more than 65%. Moreover, the potential of the overlayer to be further modified was demonstrated by successfully coupling biotinylated alkaline phosphatase (bAP) to a silane-PEG-biotin overlayer via avidin-biotin bridges. The activity of the immobilized enzyme was shown to be well preserved without compromising the achieved antifouling properties. Overall, the simple solution-based approach enables the tailoring of SS to enhance its activity for biomedical and biotechnological applications. PMID:27381834

Improved antifouling properties and selective biofunctionalization of stainless steel by employing heterobifunctional silane-polyethylene glycol overlayers and avidin-biotin technology

Science.gov (United States)

Hynninen, Ville; Vuori, Leena; Hannula, Markku; Tapio, Kosti; Lahtonen, Kimmo; Isoniemi, Tommi; Lehtonen, Elina; Hirsimäki, Mika; Toppari, J. Jussi; Valden, Mika; Hytönen, Vesa P.

2016-07-01

A straightforward solution-based method to modify the biofunctionality of stainless steel (SS) using heterobifunctional silane-polyethylene glycol (silane-PEG) overlayers is reported. Reduced nonspecific biofouling of both proteins and bacteria onto SS and further selective biofunctionalization of the modified surface were achieved. According to photoelectron spectroscopy analyses, the silane-PEGs formed less than 10 Å thick overlayers with close to 90% surface coverage and reproducible chemical compositions. Consequently, the surfaces also became more hydrophilic, and the observed non-specific biofouling of proteins was reduced by approximately 70%. In addition, the attachment of E. coli was reduced by more than 65%. Moreover, the potential of the overlayer to be further modified was demonstrated by successfully coupling biotinylated alkaline phosphatase (bAP) to a silane-PEG-biotin overlayer via avidin-biotin bridges. The activity of the immobilized enzyme was shown to be well preserved without compromising the achieved antifouling properties. Overall, the simple solution-based approach enables the tailoring of SS to enhance its activity for biomedical and biotechnological applications.

Key factors to inoculate Botrytis cinerea in tomato plants

Directory of Open Access Journals (Sweden)

Álefe Vitorino Borges

2014-09-01

Full Text Available Studies addressing the biological control of Botrytis cinerea have been unsuccessful because of fails in inoculating tomato plants with the pathogen. With the aim of establishing a methodology for inoculation into stems, experiments were designed to assess: i. the aggressiveness of pathogen isolates; ii. the age at which tomato plants should be inoculated; iii. the susceptibility of tissues at different stem heights; iv. the need for a moist chamber after inoculation; and v. the effectiveness of gelatin regarding inoculum adhesion. Infection with an isolate from tomato plants that was previously inoculated into petioles and then re-isolated was successful. An isolate from strawberry plants was also aggressive, although less than that from tomato plants. Tomato plants close to flowering, at 65 days after sowing, and younger, middle and apical stem portions were more susceptible. There was positive correlation between lesion length and sporulation and between lesion length and broken stems. Lesion length and the percentage of sporulation sites were reduced by using a moist chamber and were not affected by adding gelatin to the inoculum suspension. This methodology has been adopted in studies of B. cinerea in tomato plants showing reproducible results. The obtained results may assist researchers who study the gray mold.

Complexity Leadership Theory: A United States Marine Corps Historical Overlay

Science.gov (United States)

2017-05-25

DD-MM-YYYY) 23-04-2017 2. REPORT TYPE Master’s Thesis 3. DATES COVERED (From - To) JUN 2016 – MAY 2017 4. TITLE AND SUBTITLE Complexity...Monograph Title : Complexity Leadership Theory : A United States Marine Corps Historical Overlay Approved by...General Ridgway’s Success in Korea.” Master’s thesis , United States Army Command and General Staff College, 2010. Diana, Gabriel. “Vision, Education

Experimental inoculation of North American opossums (Didelphis virginiana) with Mycobacterium bovis.

Science.gov (United States)

Diegel, Kelly L; Fitzgerald, Scott D; Berry, Dale E; Church, Steven V; Reed, Willie M; Sikarskie, James G; Kaneene, John B

2002-04-01

Eight North American opossums (Didelphis virginiana) were inoculated with 1 x 10(5) colony forming units of Mycobacterium bovis to investigate their potential as reservoir hosts for bovine tuberculosis in Michigan. Four animals received this dose orally and four were inoculated intramuscularly (i.m.). In each group, two animals were euthanized 1 mo postinoculation (PI) and two at 2 mo PI. Four control animals were housed separately and sacrificed in the same manner as those inoculated. One of four orally inoculated opossums and three of four i.m.-inoculated opossums were positive for M. bovis by culture of tissues obtained at necropsy. The oral recipient had positive cultures from intestine and pooled lymphoid samples. Pooled lymphoid samples were positive in three i.m.-inoculated animals and two of these also had positive liver and lung cultures. One animal with gross and histologic lesions compatible with tuberculosis had negative tissue cultures. The findings suggest that opossums are susceptible to M. bovis infection by multiple routes, although their relative susceptibility compared to true reservoir hosts appears to be low.

Passivating surface states on water splitting hematite photoanodes with alumina overlayers

KAUST Repository

Le Formal, Florian; Té treault, Nicolas; Cornuz, Maurin; Moehl, Thomas; Grä tzel, Michael; Sivula, Kevin

2011-01-01

Hematite is a promising material for inexpensive solar energy conversion via water splitting but has been limited by the large overpotential (0.5-0.6 V) that must be applied to afford high water oxidation photocurrent. This has conventionally been addressed by coating it with a catalyst to increase the kinetics of the oxygen evolution reaction. However, surface recombination at trapping states is also thought to be an important factor for the overpotential, and herein we investigate a strategy to passivate trapping states using conformal overlayers applied by atomic layer deposition. While TiO2 overlayers show no beneficial effect, we find that an ultra-thin coating of Al2O3 reduces the overpotential required with state-of-the-art nano-structured photo-anodes by as much as 100 mV and increases the photocurrent by a factor of 3.5 (from 0.24 mA cm-2 to 0.85 mA cm-2) at +1.0 V vs. the reversible hydrogen electrode (RHE) under standard illumination conditions. The subsequent addition of Co2+ ions as a catalyst further decreases the overpotential and leads to a record photocurrent density at 0.9 V vs. RHE (0.42 mA cm-2). A detailed investigation into the effect of the Al2O3 overlayer by electrochemical impedance and photoluminescence spectroscopy reveals a significant change in the surface capacitance and radiative recombination, respectively, which distinguishes the observed overpotential reduction from a catalytic effect and confirms the passivation of surface states. Importantly, this work clearly demonstrates that two distinct loss processes are occurring on the surface of high-performance hematite and suggests a viable route to individually address them. © The Royal Society of Chemistry 2011.

Passivating surface states on water splitting hematite photoanodes with alumina overlayers

KAUST Repository

Le Formal, Florian

2011-01-24

Hematite is a promising material for inexpensive solar energy conversion via water splitting but has been limited by the large overpotential (0.5-0.6 V) that must be applied to afford high water oxidation photocurrent. This has conventionally been addressed by coating it with a catalyst to increase the kinetics of the oxygen evolution reaction. However, surface recombination at trapping states is also thought to be an important factor for the overpotential, and herein we investigate a strategy to passivate trapping states using conformal overlayers applied by atomic layer deposition. While TiO2 overlayers show no beneficial effect, we find that an ultra-thin coating of Al2O3 reduces the overpotential required with state-of-the-art nano-structured photo-anodes by as much as 100 mV and increases the photocurrent by a factor of 3.5 (from 0.24 mA cm-2 to 0.85 mA cm-2) at +1.0 V vs. the reversible hydrogen electrode (RHE) under standard illumination conditions. The subsequent addition of Co2+ ions as a catalyst further decreases the overpotential and leads to a record photocurrent density at 0.9 V vs. RHE (0.42 mA cm-2). A detailed investigation into the effect of the Al2O3 overlayer by electrochemical impedance and photoluminescence spectroscopy reveals a significant change in the surface capacitance and radiative recombination, respectively, which distinguishes the observed overpotential reduction from a catalytic effect and confirms the passivation of surface states. Importantly, this work clearly demonstrates that two distinct loss processes are occurring on the surface of high-performance hematite and suggests a viable route to individually address them. © The Royal Society of Chemistry 2011.

Co-inoculation of Azospirillum brasilense and Herbaspirillum seropedicae in maize

Directory of Open Access Journals (Sweden)

Janaína Dartora

2016-06-01

Full Text Available ABSTRACT Bacteria from the genera Azospirillum and Herbaspirillum have been associated with increments in maize yield. The aim of this study was to evaluate the maize yield and nutritional content in response to inoculation with A. brasilense and H. seropediceae in association with nitrogen (N fertilization. The experimental design was randomized blocks in a 4 x 5 factorial scheme, with four replicates. The treatments consisted of seed inoculation (control without N and inoculation, A. brasilense strain - AbV5, H. seropediceae strain - SMR1 and co-inoculation AbV5 + SMR1 and N doses (0, 40, 80, 120 and 160 kg ha-1. The following variables were evaluated: ear insertion height, ear length, ear diameter, number of rows per ear, number of grains per row, ear weight, yield and NPK contents in leaves and grains. There was no interaction between the factors studied. Co-inoculation with the strains promoted increments of 12% in leaf P content, compared with control, and N fertilization promoted increase in yield and leaf P content up to the maximum dose studied.

Magnetism of CrO overlayers on Fe(001)bcc surface: first principles calculations

Science.gov (United States)

Félix-Medina, Raúl Enrique; Leyva-Lucero, Manuel Andrés; Meza-Aguilar, Salvador; Demangeat, Claude

2018-04-01

Riva et al. [Surf. Sci. 621, 55 (2014)] as well as Calloni et al. [J. Phys.: Condens. Matter 26, 445001 (2014)] have studied the oxydation of Cr films deposited on Fe(001)bcc through low-energy electron diffraction, Auger electron spectroscopy and scanning tunneling microscopy. In the present work we perform a density functional approach within Quantum Expresso code in order to study structural and magnetic properties of CrO overlayers on Fe(001)bcc. The calculations are performed using DFT+U. The investigated systems include O/Cr/Fe(001)bcc, Cr/O/Fe(001)bcc, Cr0.25O0.75/Fe(001)bcc, as well as the O coverage Ox/Cr/Fe(001)bcc (x = 0.25; 0.50). We have found that the ordered CrO overlayer presents an antiferromagnetic coupling between Cr and Fe atoms. The O atoms are located closer to the Fe atoms of the surface than the Cr atoms. The ground state of the systems O/Cr/Fe(001)bcc and Cr/O/Fe(001)bcc corresponds to the O/Cr/Fe(001)bcc system with a magnetic coupling c(2 × 2). The effect of the O monolayer on Cr/Fe(001)bcc changes the ground state from p(1 × 1) ↓ to c(2 × 2) and produces an enhancement of the magnetic moments. The Ox overlayer on Cr/Fe(001)bcc produces an enhancement of the Cr magnetic moments.

How a gold substrate can increase the reactivity of a Pt overlayer

DEFF Research Database (Denmark)

Pedersen, Morten Ø.; Helveg, Stig; Ruban, Andrei

1999-01-01

The growth and chemical reactivity of Pt on Au(111) have been studied using scanning tunneling microscopy (STM) and temperature programmed desorption (TPD). Deposition of Pt at coverages from 0.02 ML up to 2.5 ML on Au(111) at room temperature initially leads to the formation of a surface alloy......, in which 3% of the Au atoms are replaced by Pt. Subsequent Pt evaporation leads to island growth with a mixed Pt-Au island composition. The reactivity of the Pt/Au system is studied using CO as a probe molecule. We show that a stronger bonding of CO to the first layer of Pt on Au(111) exists compared...... with the binding of CO on clean Pt. The Au substrate therefore very surprisingly increases the Pt overlayer reactivity. The results can be understood in a simple model, in which the change in the CO binding energy is directly proportional to the shift of the d-band center of the metal overlayer. According...

Integration of the work management of a HVDC overlay grid into the line-frequency control of a three-phase current integrated nework; Integration der Betriebsfuehrung eines HGUe-Overlay-Netzes in die Leitungs-Frequenz-Regelung eines Drehstrom-Verbundnetzes

Energy Technology Data Exchange (ETDEWEB)

Marten, Anne-Katrin

2012-07-01

To reduce emission of carbon dioxide the proportion of renewable energies is rapidly growing in German and European grids in general. Additionally, the bulk of them are generated in only a few spots in European transmission grid, whereas conventional power plants will shut down and the load center distribution will still be decentralized. This results in the need of a new and powerful transmission grid, which is able to transport bulk power over long distances. To overcome this challenge one of the discussed solutions for Europe is an Overlay Network based on HVDC technology connecting spots of bulk renewable energy plants and important load centers. Because of different performance compared to an ac grid, it is necessary for an HVDC Overlay Network to actively sustain system services such as power frequency control to ensure system stability and power quality as well as the ac grid does. A novel method for realizing participation of a HVDC Overlay Network in power frequency control is presented. It hasn't only an advantage for load frequency power flows, but also for contracted balancing power flows which are also feed via the dc grid pro rata. Numerical case studies are made to show some benefits of this method in case of various disturbances. It is shown that a HVDC Overlay Network with the developed operating control releases the ac grid by an adjustable amount of power flows and improves the power frequency control for example in terms of promptness and lower frequency deviations.

Co-inoculation with diazotrophic bacteria in soybeans associated to urea topdressing

Directory of Open Access Journals (Sweden)

Glauber Monçon Fipke

Full Text Available ABSTRACT Increased grain yield can be obtained via an interaction between plants and growth-promoting microorganisms. The Bradyrhizobium spp. are capable of fixing atmospheric nitrogen in soybeans [Glycine max (L. Merril], and Azospirillum spp. induce the synthesis of phytohormones. The aim of this study was to evaluate inoculation with Bradyrhizobium and co-inoculation with Bradyrhizobium + Azospirillum brasilense in soybeans in combination with the application a topdressing of 0, 75 or 150 kg of N ha-1 of urea during the reproductive stage. Three soybean cultivars (BMX Ativa, TEC 6029 and BMX Potência, were tested in field experiments in Santa Maria, RS, Brazil, during two agricultural years (2013/2014 and 2014/2015 and two sowing times. Morphological, nodulation and yield components were evaluated. Co-inoculation increased the grain yield by 240 kg ha-1 compared with conventional inoculation. When co-inoculated, cultivars BMX Ativa, TEC 6029 and BMX Potência showed increased grain yields of 6, 4 and 12%, respectively. The application of 150 kg ha-1 of N as a topdressing increased the grain yield by 300 kg ha-1 in the co-inoculated cultivars TEC 6029 and BMX Potência, but without a financial return. When inoculated only with Bradyrhizobium, the cultivars did not respond positively to the application of urea.

NDT with the structural weld overlay program. Recent field experience and lessons learned

International Nuclear Information System (INIS)

Rishel, R.; Lenz, H.; Turley, G.; Newton, B.

2007-01-01

Structural weld overlay (SWOL) has become a predominant mitigation technique within the Alloy 600 program. For the pressurizer nozzles, MRP-139 requires volumetric examination by year end 2007. Many nozzles are un-inspectable due to geometry and material limitations that preclude interrogation of the required examination volume. SWOL therefore is the mitigation technique which overcomes these limitations. SWOL of the pressurizer nozzles has been a challenge for all the vendors. Alloy 52 has proven to be difficult to weld under field conditions. The NDT technique chosen to demonstrate the integrity of the overlay needs to be adapted to the specific repair process and nozzle geometry. The purpose of this paper will be to present Westinghouse's integrated approach for SWOL with the focus on the NDT aspects. Topics will include main repair process steps, NDT qualification, recent field experience and lessons learned. (author)

Legume bioactive compounds: influence of rhizobial inoculation

Directory of Open Access Journals (Sweden)

Luis R. Silva

2017-04-01

Full Text Available Legumes consumption has been recognized as beneficial for human health, due to their content in proteins, fiber, minerals and vitamins, and their cultivation as beneficial for sustainable agriculture due to their ability to fix atmospheric nitrogen in symbiosis with soil bacteria known as rhizobia. The inoculation with these baceria induces metabolic changes in the plant, from which the more studied to date are the increases in the nitrogen and protein contents, and has been exploited in agriculture to improve the crop yield of several legumes. Nevertheless, legumes also contain several bioactive compounds such as polysaccharides, bioactive peptides, isoflavones and other phenolic compounds, carotenoids, tocopherols and fatty acids, which makes them functional foods included into the nutraceutical products. Therefore, the study of the effect of the rhizobial inoculation in the legume bioactive compounds content is gaining interest in the last decade. Several works reported that the inoculation of different genera and species of rhizobia in several grain legumes, such as soybean, cowpea, chickpea, faba bean or peanut, produced increases in the antioxidant potential and in the content of some bioactive compounds, such as phenolics, flavonoids, organic acids, proteins and fatty acids. Therefore, the rhizobial inoculation is a good tool to enhance the yield and quality of legumes and further studies on this field will allow us to have plant probiotic bacteria that promote the plant growth of legumes improving their functionality.

Evaluating the mechanical performance of Very Thin Asphalt Overlay (VTAO as a sustainable rehabilitation strategy in urban pavements

Directory of Open Access Journals (Sweden)

M. Sol-Sánchez

2017-07-01

Full Text Available Very Thin Asphalt Overlay (VTAO has been introduced as an alternative to traditional thick overlays, seal coats, and micro-surfacings. Nonetheless, there are some challenges that still remain regarding the application of VTAOs (such as mixture type, cohesiveness, wear resistance, cracking and durability, particularly in heavy traffic urban areas. Therefore, this paper presents an extensive comparative evaluation of the mechanical performance, durability and safety issues (cohesiveness, adhesiveness, ageing, cracking, plastic deformation, permeability, macrotexture, skid and wear resistance, and fuel resistance of a VTAO (20 mm thick and a high performance BBTM 11B (35 mm thick, commonly used as an open-graded mixture for pavement overlays. The results demonstrated that VTAO is an appropriate material for urban pavements as it provides good durability and resistance to the propagation of defects. Nonetheless, further studies are required to improve its behavior under distresses related to plastic deformations and safety properties.

Evaluating the mechanical performance of Very Thin Asphalt Overlay (VTAO) as a sustainable rehabilitation strategy in urban pavements

International Nuclear Information System (INIS)

Sol-Sánchez, M.; García-Travé, G.; Ayar, P.; Moreno-Navarro, F.; Rubio-Gámez, M.C.

2017-01-01

Very Thin Asphalt Overlay (VTAO) has been introduced as an alternative to traditional thick overlays, seal coats, and micro-surfacings. Nonetheless, there are some challenges that still remain regarding the application of VTAOs (such as mixture type, cohesiveness, wear resistance, cracking and durability), particularly in heavy traffic urban areas. Therefore, this paper presents an extensive comparative evaluation of the mechanical performance, durability and safety issues (cohesiveness, adhesiveness, ageing, cracking, plastic deformation, permeability, macrotexture, skid and wear resistance, and fuel resistance) of a VTAO (20 mm thick) and a high performance BBTM 11B (35 mm thick), commonly used as an open-graded mixture for pavement overlays. The results demonstrated that VTAO is an appropriate material for urban pavements as it provides good durability and resistance to the propagation of defects. Nonetheless, further studies are required to improve its behavior under distresses related to plastic deformations and safety properties. [es

Science overlay maps: a new tool for research policy and library management

NARCIS (Netherlands)

Rafols, I.; Porter, A.L.; Leydesdorff, L.

2010-01-01

We present a novel approach to visually locate bodies of research within the sciences, both at each moment of time and dynamically. This article describes how this approach fits with other efforts to locally and globally map scientific outputs. We then show how these science overlay maps help

Experimental aerosol inoculation of Mycobacterium bovis in North American opossums (Didelphis virginiana).

Science.gov (United States)

Fitzgerald, Scott D; Zwick, Laura S; Diegel, Kelly L; Berry, Dale E; Church, Steven V; Sikarskie, James G; Kaneene, John B; Reed, Willie M

2003-04-01

The goal of this study was to evaluate the susceptibility of North American opossums (Didelphis virginiana) to aerosol inoculation of Mycobacterium bovis at two dose levels in order to gain information on disease pathogenesis, fecal shedding of the organism, and the potential role that opossums play in the spread of this disease in nature. Six opossums received high dose (1 x 10(7) colony forming units (cfu) by aerosol inoculation, six opossums received low dose (1 x 10(3) cfu inoculation, and six opossums were sham-inoculated with sterile water and served as controls. Lungs were the most frequently infected tissues, with nine of 12 inoculated opossums positive for M. bovis on culture. Gross lesions consisted of multifocal pneumonia and enlarged lymph nodes. Microscopically, granulomatous pneumonia and granulomatous lymphadenitis associated with acid-fast bacilli were present in eight of 12 inoculated opossums. Fecal shedding of M. bovis was uncommon at both inoculation doses. While opossums were highly susceptible to aerosol inoculation of M. bovis, they did not become emaciated or develop widely disseminated lesions. From this study, opossums may transmit tuberculosis by aerosol infection to other opossums in close contact and serve as a source of infection to carnivores that feed upon them, however, transmission of the disease to large herbivores by fecal shedding or direct contact may be less likely.

Thermal analysis control of in-mould and ladle inoculated grey cast irons

Directory of Open Access Journals (Sweden)

Mihai Chisamera

2009-05-01

Full Text Available The effect of addition of 0.05wt.% to 0.25 wt.% Ca, Zr, Al-FeSi alloy on in-ladle and in-mould inoculation of grey cast irons was investigated. In the present paper, the conclusions drawn are based on thermal analysis. For the solidification pattern, some specific cooling curves characteristics, such as the degree of undercooling at the beginning of eutectic solidifi cation and at the end of solidifi cation, as well as the recalescence level, are identifi ed to be more infl uenced by the inoculation technique. The degree of eutectic undercooling of the electrically melted base iron having 0.025% S, 0.003% Al and 3.5% Ce is excessively high (39–40℃, generating a relatively high need for inoculation. Under these conditions, the in-mould inoculation has a more signifi cant effect compared to ladle inoculation, especially at lower inoculant usage (less than 0.20 wt.%. Generally, the efficiency of 0.05wt.%–0.15wt.% of alloy for in-mould inoculation is comparable to, or better than, that of 0.15wt.%–0.25wt.% addition in ladle inoculation procedures. In order to secure stable and controlled processes, representative thermal analysis parameters could be used, especially in thin wall grey iron castings production.

Sunflower growth according to seed inoculation with endophytic bacteria

Directory of Open Access Journals (Sweden)

Juliana Fernandes dos Santos

2014-06-01

Full Text Available The sunflower crop has a great importance worldwide, due to the oil of excellent quality extracted from its seeds and in natura grains that are consumed in various ways. However, drought is one of the main environmental factors that limit its yield. An experiment was carried out under controlled greenhouse conditions, in a completely randomized experimental design, in order to determine the effect of endophytic bacteria inoculation (Bacillus sp. and Enterobacter cloacae on the growth and contents of nutrients and organic solutes, in sunflower leaves and roots under water deficit. Plant height, stem diameter, fresh and dry biomass of shoot and roots, as well as contents of N, P, K, soluble carbohydrates, free proline, free amino acids and soluble proteins, were determined at 35 days after the plant emergence. The water deficit reduced plant growth regardless inoculation. However, under optimum conditions of soil moisture, the combination of both endophytic bacteria increased the sunflower growth. The water deficit also increased the N and K contents in leaves, as well as the organic solutes content in shoots, especially in inoculated plants. These results suggest that the inoculation of endophytic bacteria may increase the capacity of drought stressed plants to perform the osmotic adjustment through a higher accumulation of organic solutes, when compared to plants not inoculated.

Visual supports for shared reading with young children: the effect of static overlay design.

Science.gov (United States)

Wood Jackson, Carla; Wahlquist, Jordan; Marquis, Cassandra

2011-06-01

This study examined the effects of two types of static overlay design (visual scene display and grid display) on 39 children's use of a speech-generating device during shared storybook reading with an adult. This pilot project included two groups: preschool children with typical communication skills (n = 26) and with complex communication needs (n = 13). All participants engaged in shared reading with two books using each visual layout on a speech-generating device (SGD). The children averaged a greater number of activations when presented with a grid display during introductory exploration and free play. There was a large effect of the static overlay design on the number of silent hits, evidencing more silent hits with visual scene displays. On average, the children demonstrated relatively few spontaneous activations of the speech-generating device while the adult was reading, regardless of overlay design. When responding to questions, children with communication needs appeared to perform better when using visual scene displays, but the effect of display condition on the accuracy of responses to wh-questions was not statistically significant. In response to an open ended question, children with communication disorders demonstrated more frequent activations of the SGD using a grid display than a visual scene. Suggestions for future research as well as potential implications for designing AAC systems for shared reading with young children are discussed.

New overlay measurement technique with an i-line stepper using embedded standard field image alignment marks for wafer bonding applications

Science.gov (United States)

Kulse, P.; Sasai, K.; Schulz, K.; Wietstruck, M.

2017-06-01

In the last decades the semiconductor technology has been driven by Moore's law leading to high performance CMOS technologies with feature sizes of less than 10 nm [1]. It has been pointed out that not only scaling but also the integration of novel components and technology modules into CMOS/BiCMOS technologies is becoming more attractive to realize smart and miniaturized systems [2]. Driven by new applications in the area of communication, health and automation, new components and technology modules such as BiCMOS embedded RF-MEMS, high-Q passives, Sibased microfluidics and InP-SiGe BiCMOS heterointegration have been demonstrated [3-6]. In contrast to standard VLSI processes fabricated on front side of the silicon wafer, these new technology modules require addition backside processing of the wafer; thus an accurate alignment between the front and backside of the wafer is mandatory. In previous work an advanced back to front side alignment technique and implementation into IHP's 0.25/0.13 μm high performance SiGe:C BiCMOS backside process module has been presented [7]. The developed technique enables a high resolution and accurate lithography on the backside of BiCMOS wafer for additional backside processing. In addition to the aforementioned back side process technologies, new applications like Through-Silicon Vias (TSV) for interposers and advanced substrate technologies for 3D heterogeneous integration demand not only single wafer fabrication but also processing of wafer stacks provided by temporary and permanent wafer bonding [8]. Therefore, the available overlay measurement techniques are not suitable if overlay and alignment marks are realized at the bonding interface of a wafer stack which consists of both a silicon device and a silicon carrier wafer. The former used EVG 40NT automated overlay measurement system, which use two opposite positioned microscopes inspecting simultaneous the wafer back and front side, is not capable measuring embedded overlay

Effects of single and combined inoculations of selected Trichoderma ...

African Journals Online (AJOL)

Effects of single and combined inoculations of selected Trichoderma and Bacillus isolates on growth of dry bean and biological control of Rhizoctonia solani damping-off. ... Greenhouse trials showed that combined inoculations of T. atroviride strain 6 and B. subtilis B69 gave the highest growth promotion of bean in terms of ...

Formate stability and carbonate hydrogenation on strained Cu overlayers on Pt(111)

DEFF Research Database (Denmark)

Schumacher, Nana Maria Pii; Andersson, Klas Jerker; Nerlov, Jesper

2008-01-01

Formate (HCOO) synthesis, decomposition and the hydrogenation of carbonate (CO3) on Cu overlayers deposited on a Pt(111) single crystal are investigated to examine the reactivity of a Cu surface under tensile strain with defects present. Formate is synthesized from a 0.5 bar mixture of 70% CO2...

Combined Conjunctival Autograft and Overlay Amniotic Membrane Transplantation; a Novel Surgical Treatment for Pterygium

Directory of Open Access Journals (Sweden)

Siamak Zarei Ghanavati

2014-01-01

Full Text Available The authors report the long-term results of combined conjunctival autograft and overlay amniotic membrane transplantation (AMT for treatment of pterygium as a new surgical technique. Nineteen patients including 12 male and 7 female subjects with pterygium (primary, 14 cases; recurrent, 5 cases underwent combined conjunctival autograft and overlay AMT and were followed from 10 to 26 months. Mean age was 44.21±12.49 (range, 29.0-73.0 years. In one patient with grade T3 primary pterygium, the lesion recurred (5.2%, recurrence rate. No intra-and postoperative complication developed. This procedure seems a safe and effective surgical technique for pterygium treatment. Protection of the ocular surface during the early postoperative period reduces the friction-induced inflammation and might be helpful to prevent the recurrence.

Growth and Yield Responses of Cowpea to Inoculation and Phosphorus Fertilization in Different Environments

Science.gov (United States)

Kyei-Boahen, Stephen; Savala, Canon E. N.; Chikoye, David; Abaidoo, Robert

2017-01-01

Cowpea (Vigna unguiculata) is a major source of dietary protein and essential component of the cropping systems in semi-arid regions of Sub-Saharan Africa. However, yields are very low due to lack of improved cultivars, poor management practices, and limited inputs use. The objectives of this study were to assess the effects of rhizobia inoculant and P on nodulation, N accumulation and yield of two cowpea cultivars in Mozambique. Field study was conducted in three contrasting environments during the 2013/2014 and 2014/2015 seasons using randomized complete block design with four replications and four treatments. Treatments consisted of seed inoculation, application of 40 kg P2O5 ha-1, inoculation + P, and a non-inoculated control. The most probable number (MPN) technique was used to estimate the indigenous bradyrhizobia populations at the experimental sites. The rhizobia numbers at the sites varied from 5.27 × 102 to 1.07 × 103 cells g-1 soil. Inoculation increased nodule number by 34–76% and doubled nodule dry weight (78 to 160 mg plant-1). P application improved nodulation and interacted positively with the inoculant. Inoculation, P, and inoculant + P increased shoot dry weight, and shoot and grain N content across locations but increases in number of pods plant-1, seeds pod-1, and 100-seed weight were not consistent among treatments across locations. Shoot N content was consistently high for the inoculated plants and also for the inoculated + P fertilized plants, whereas the non-inoculated control plants had the lowest tissue N content. P uptake in shoot ranged from 1.72 to 3.77 g kg-1 and was higher for plants that received P fertilizer alone. Inoculation and P either alone or in combination consistently increased cowpea grain yield across locations with yields ranging from 1097 kg ha-1 for the non-inoculated control to 1674 kg ha-1 for the inoculant + P treatment. Grain protein concentration followed a similar trend as grain yield and ranged from 223 to

Effect of actinobacteria agent inoculation methods on cellulose degradation during composting based on redundancy analysis.

Science.gov (United States)

Zhao, Yue; Lu, Qian; Wei, Yuquan; Cui, Hongyang; Zhang, Xu; Wang, Xueqin; Shan, Si; Wei, Zimin

2016-11-01

In this study, actinobacteria agent including Streptomyces sp. and Micromonospora sp. were inoculated during chicken manure composting by different inoculation methods. The effect of different treatments on cellulose degradation and the relationship between inoculants and indigenous actinobacteria were investigated during composting. The results showed that inoculation in different stages of composting all improved the actinobacteria community diversity particularly in the cooling stage of composting (M3). Moreover, inoculation could distinctly accelerate the degradation of organic matters (OM) especially celluloses. Redundancy analysis indicated that the correlation between indigenous actinobacteria and degradation of OM and cellulose were regulated by inoculants and there were significant differences between different inoculation methods. Furthermore, synergy between indigenous actinobacteria and inoculants for degradation of OM and cellulose in M3 was better than other treatments. Conclusively, we suggested an inoculation method to regulate the indigenous actinobacteria based on the relationship between inoculants and indigenous actinobacteria and degradation content. Copyright © 2016 Elsevier Ltd. All rights reserved.

Quality assessment of truffle-inoculated seedlings in Italy: proposing revised parameters for certification

Directory of Open Access Journals (Sweden)

Domizia Donnini

2014-08-01

Full Text Available Aim of study: the main aims of this study were to evaluate the quality of truffle-inoculated seedlings produced by commercial nurseries in Italy and to identify their minimum requisites in terms of plant age, health, homogeneity, and cut-off percentage of inoculated Tuber and non-Tuber ectomycorrhizae, based on the analysis of an extensive sample of seedlings subjected to quality control and certification.Area of study: truffle-inoculated seedlings produced by Italian commercial nurseries.Material and Methods: analysis of truffle-inoculated seedlings for health and quality standards; recording of presence of inoculated Tuber spp. and other concurrent fungi according to the official Italian method for certification; selective amplification of ectomycorrhizal DNA by PCR species-specific primers.Main results: We showed that mycorrhization levels in truffle-inoculated seedlings increased with time after truffle-spore inoculation. The highest mean percentage of the inoculated Tuber spp., but also the highest presence of contaminants, were recorded after three years. The mycorrhization level of Tuber melanosporum and T. aestivum was higher in Corylus and Ostrya seedlings than in Q. ilex and Q. pubescens, but the latter two host species showed the lowest presence of other ectomycorrhizal fungi. Mycorrhization level distribution in truffle-inoculated seedlings of suitable batches differed very little from the distribution in only all suitable seedlings. Truffle seedlings with other Tuber spp. were very few and even absent after three years. The general quality of Italian truffle-inoculated seedlings is high but can be improved even further by revising the parameters used for their certification.Research highlights: Mycorrhization assessment in truffle-inoculated seedlings produced by commercial nurseries and a revision of the parameters of quality standards following several years of certification in Italy.Keywords: Truffle cultivation; truffle

Impact of Improper Gaussian Signaling on the Achievable Rate of Overlay Cognitive Radio

KAUST Repository

Amin, Osama

2017-05-12

Improper Gaussian signaling (IGS) has been recently shown to provide performance improvements in underlay cognitive radio systems as opposed to the conventional proper Gaussian signaling (PGS) scheme. For the first time, this paper implements IGS scheme in overlay cognitive radio system, where the secondary transmitter broadcasts a mixture of two different signals. The first signal is selected from the PGS scheme to support the primary message transmission. On the other hand, the second signal is chosen to be from the IGS scheme in order to reduce the interference effect on the primary receiver. We then optimally design the overlay cognitive radio that employs IGS to maximize the secondary link achievable rate while satisfying the minimum rate requirement of the primary network. In particular, we derive closed form expressions for the circularity coefficient used in the IGS scheme and the power distribution parameters. Simulation results are provided to support our theoretical derivations.

Impact of Improper Gaussian Signaling on the Achievable Rate of Overlay Cognitive Radio

KAUST Repository

Amin, Osama; Abediseid, Walid; Alouini, Mohamed-Slim

2017-01-01

Improper Gaussian signaling (IGS) has been recently shown to provide performance improvements in underlay cognitive radio systems as opposed to the conventional proper Gaussian signaling (PGS) scheme. For the first time, this paper implements IGS scheme in overlay cognitive radio system, where the secondary transmitter broadcasts a mixture of two different signals. The first signal is selected from the PGS scheme to support the primary message transmission. On the other hand, the second signal is chosen to be from the IGS scheme in order to reduce the interference effect on the primary receiver. We then optimally design the overlay cognitive radio that employs IGS to maximize the secondary link achievable rate while satisfying the minimum rate requirement of the primary network. In particular, we derive closed form expressions for the circularity coefficient used in the IGS scheme and the power distribution parameters. Simulation results are provided to support our theoretical derivations.

Establishment and effectiveness of inoculated arbuscular mycorrhizal fungi in agricultural soils.

Science.gov (United States)

Köhl, Luise; Lukasiewicz, Catherine E; van der Heijden, Marcel G A

2016-01-01

Arbuscular mycorrhizal fungi (AMF) are promoted as biofertilizers for sustainable agriculture. So far, most researchers have investigated the effects of AMF on plant growth under highly controlled conditions with sterilized soil, soil substrates or soils with low available P or low inoculum potential. However, it is still poorly documented whether inoculated AMF can successfully establish in field soils with native AMF communities and enhance plant growth. We inoculated grassland microcosms planted with a grass-clover mixture (Lolium multiflorum and Trifolium pratense) with the arbuscular mycorrhizal fungus Rhizoglomus irregulare. The microcosms were filled with eight different unsterilized field soils that varied greatly in soil type and chemical characteristics and indigenous AMF communities. We tested whether inoculation with AMF enhanced plant biomass and R. irregulare abundance using a species specific qPCR. Inoculation increased the abundance of R. irregulare in all soils, irrespective of soil P availability, the initial abundance of R. irregulare or the abundance of native AM fungal communities. AMF inoculation had no effect on the grass but significantly enhanced clover yield in five out of eight field soils. The results demonstrate that AMF inoculation can be successful, even when soil P availability is high and native AMF communities are abundant. © 2015 John Wiley & Sons Ltd.

Seroprevalence of Mycoplasma gallisepticum antibody by ELISA and serum plate agglutination test of laying chicken

Directory of Open Access Journals (Sweden)

Md. Zulfekar Ali

2015-01-01

Full Text Available Aim: Mycoplasma gallisepticum (MG is important avian pathogen responsible for chronic respiratory disease of chicken and turkeys, which result in large economic loss for the poultry industry. The objectives of this study were determination of seroprevalence of MG antibody of commercial layer chicken at laying period in selected areas of Bangladesh. Materials and Methods: A total of 563 blood samples were collected randomly from selected commercial layer chickens at laying period during the period from July to December, 2013. Indirect enzyme linked immunosorbent assay (iELISA and serum plate agglutination (SPA test were performed to detect the presence of antibodies against MG. Results: Of 563 samples, 64.47% and 56.13% showed an overall prevalence of MG antibodies in iELISA and SPA test respectively. Prevalence of MG was recorded the highest (69.63% at 50-55 weeks of age compared with lowest (53.26% at 56-61 weeks of age (p<0.05. Significant (p<0.05 effect of breed were observed in the seroprevalence of MG infection in layer birds in the present study. The overall, 68.77%, 63.74% and 59.37% prevalence were found respectively in sonali, ISA Brown and White leg horn. The prevalence of MG antibodies was the highest (70.13% in December followed by November (68%, October (65.67%, August (63.46%, September (58.54% and July (51.78% month. The seroprevalence of MG antibodies was higher (69.63% in most of the large flocks and lower (56.82% in small flocks. Conclusion: Therefore, might be suggested that the commercial layer farms should be routinely checked to monitor MG infection and the reactor birds should be culled since MG organism has the potential to transmit vertically. The correlation between MG antibody in month and flock size was not significant (p=0.359 and p=0.868, respectively.

Lactating cow response to lucerne silage inoculated with Lactobacillus plantarum

Science.gov (United States)

It is unclear why bacterial silage inoculants improve milk production in lactating dairy cattle. However, recent in vitro results suggest that inoculated silage effects on milk production may be tied to greater production of rumen microorganisms. Our objective was to determine if alfalfa silage trea...

Inoculation stress hypothesis of environmental enrichment.

Science.gov (United States)

Crofton, Elizabeth J; Zhang, Yafang; Green, Thomas A

2015-02-01

One hallmark of psychiatric conditions is the vast continuum of individual differences in susceptibility vs. resilience resulting from the interaction of genetic and environmental factors. The environmental enrichment paradigm is an animal model that is useful for studying a range of psychiatric conditions, including protective phenotypes in addiction and depression models. The major question is how environmental enrichment, a non-drug and non-surgical manipulation, can produce such robust individual differences in such a wide range of behaviors. This paper draws from a variety of published sources to outline a coherent hypothesis of inoculation stress as a factor producing the protective enrichment phenotypes. The basic tenet suggests that chronic mild stress from living in a complex environment and interacting non-aggressively with conspecifics can inoculate enriched rats against subsequent stressors and/or drugs of abuse. This paper reviews the enrichment phenotypes, mulls the fundamental nature of environmental enrichment vs. isolation, discusses the most appropriate control for environmental enrichment, and challenges the idea that cortisol/corticosterone equals stress. The intent of the inoculation stress hypothesis of environmental enrichment is to provide a scaffold with which to build testable hypotheses for the elucidation of the molecular mechanisms underlying these protective phenotypes and thus provide new therapeutic targets to treat psychiatric/neurological conditions. Copyright © 2014 Elsevier Ltd. All rights reserved.

On-product overlay enhancement using advanced litho-cluster control based on integrated metrology, ultra-small DBO targets and novel corrections

Science.gov (United States)

Bhattacharyya, Kaustuve; Ke, Chih-Ming; Huang, Guo-Tsai; Chen, Kai-Hsiung; Smilde, Henk-Jan H.; Fuchs, Andreas; Jak, Martin; van Schijndel, Mark; Bozkurt, Murat; van der Schaar, Maurits; Meyer, Steffen; Un, Miranda; Morgan, Stephen; Wu, Jon; Tsai, Vincent; Liang, Frida; den Boef, Arie; ten Berge, Peter; Kubis, Michael; Wang, Cathy; Fouquet, Christophe; Terng, L. G.; Hwang, David; Cheng, Kevin; Gau, TS; Ku, Y. C.

2013-04-01

Aggressive on-product overlay requirements in advanced nodes are setting a superior challenge for the semiconductor industry. This forces the industry to look beyond the traditional way-of-working and invest in several new technologies. Integrated metrology2, in-chip overlay control, advanced sampling and process correction-mechanism (using the highest order of correction possible with scanner interface today), are a few of such technologies considered in this publication.

Shadow Segmentation and Augmentation Using á-overlay Models that Account for Penumbra

DEFF Research Database (Denmark)

Nielsen, Michael; Madsen, Claus B.

2006-01-01

that an augmented virtual object can cast an exact shadow. The penumbras (half-shadows) must be taken into account so that we can model the soft shadows.We hope to achieve this by modelling the shadow regions (umbra and penumbra alike) with a transparent overlay. This paper reviews the state-of-the-art shadow...

Ductile film delamination from compliant substrates using hard overlayers.

Science.gov (United States)

Cordill, M J; Marx, V M; Kirchlechner, C

2014-11-28

Flexible electronic devices call for copper and gold metal films to adhere well to polymer substrates. Measuring the interfacial adhesion of these material systems is often challenging, requiring the formulation of different techniques and models. Presented here is a strategy to induce well defined areas of delamination to measure the adhesion of copper films on polyimide substrates. The technique utilizes a stressed overlayer and tensile straining to cause buckle formation. The described method allows one to examine the effects of thin adhesion layers used to improve the adhesion of flexible systems.

The Effects of a Dynamic Spectrum Access Overlay in LTE-Advanced Networks

Energy Technology Data Exchange (ETDEWEB)

Juan D. Deaton; Ryan E. lrwin; Luiz A. DaSilva

2011-05-01

As early as 2014, wireless network operators spectral capacity will be overwhelmed by a data tsunami brought on by new devices and applications. To augment spectral capacity, operators could deploy a Dynamic Spectrum Access (DSA) overlay. In the light of the many planned Long Term Evolution (LTE) network deployments, the affects of a DSA overlay have not been fully considered into the existing LTE standards. Coalescing many different aspects of DSA, this paper develops the Spectrum Accountability (SA) framework. The SA framework defines specific network element functionality, protocol interfaces, and signaling flow diagrams for LTE to support service requests and enforce rights of responsibilities of primary and secondary users, respectively. We also include a network simulation to quantify the benefits of using DSA channels to augment capacity. Based on our simulation we show that, network operators can benefit up to %40 increase in operating capacity when sharing DSA bands to augment spectral capacity. With our framework, this paper could serve as an guide in developing future LTE network standards that include DSA.

Intrauterine inoculation of minipigs with Chlamydia trachomatis during diestrus establishes a longer lasting infection compared to vaginal inoculation during estrus

DEFF Research Database (Denmark)

Lorenzen, Emma; Follmann, Frank; Secher, Jan O

2017-01-01

Advanced animal models, such as minipigs, are needed for the development of a globally requested human Chlamydia vaccine. Previous studies have shown that vaginal inoculation of sexually mature Göttingen minipigs with Chlamydia trachomatis resulted in an infection lasting only 3-5 days. The aim...... resulted in a longer lasting infection (at least 10 days) compared to estrus (3-5 days). Furthermore, we found a significant C. trachomatis specific IFN-γ response in pigs inoculated during estrus correlating with the accelerated clearance of infection in these pigs. These findings suggest...

MeshTree: A Delay optimised Overlay Multicast Tree Building Protocol

OpenAIRE

Tan, Su-Wei; Waters, A. Gill; Crawford, John

2005-01-01

We study decentralised low delay degree-constrained overlay multicast tree construction for single source real-time applications. This optimisation problem is NP-hard even if computed centrally. We identify two problems in traditional distributed solutions, namely the greedy problem and delay-cost trade-off. By offering solutions to these problems, we propose a new self-organising distributed tree building protocol called MeshTree. The main idea is to embed the delivery tree in a degree-bound...

Potential of zero free charge of Pd overlayers on Pt(1 1 1)

International Nuclear Information System (INIS)

El-Aziz, A.M.; Hoyer, R.; Kibler, L.A.; Kolb, D.M.

2006-01-01

Differential capacitance measurements of Pd overlayers on a Pt(1 1 1) electrode in dilute aqueous NaF solutions have been performed as a function of film thickness in order to determine the potential of zero free charge (pzfc). The pzfc of the first, pseudomorphic Pd monolayer on Pt(1 1 1) is -0.21 V versus SCE. By increasing the amount of deposited Pd, a clear shift of the pzfc to more positive values is observed. After deposition of an equivalent of 10 monolayers, the value approaches that of a massive Pd(1 1 1) electrode (-0.12 V versus SCE). The pzfc's for the various Pd coverages are correlated with surface structure information, derived from STM images (R. Hoyer, L.A. Kibler, D.M. Kolb, Electrochim. Acta 49 (2003) 63). Variations in the pzfc are discussed in the context of an electronic modification by the underlying substrate and are compared with corresponding data for Pd overlayers on Au(1 1 1)

Texas flexible pavements and overlays : calibration plans for M-E models and related software.

Science.gov (United States)

2013-06-01

This five-year project was initiated to collect materials and pavement performance data on a minimum of 100 highway test sections around the State of Texas, incorporating flexible pavements and overlays. Besides being used to calibrate and validate m...

Response of chickpea ( Cicer arietinum L.) to inoculation with native ...

African Journals Online (AJOL)

The results from the field and pot experiments indicated that chickpea crop yield can be improved using proper Mesorhizobium inoculation. Inoculation had a pronounced effect on grain yield, yield component, total N uptake, grain protein content, percentage N derived from the atmosphere (%Ndfa) for the seed, and amount ...

Re-Thinking Anxiety: Using Inoculation Messages to Reduce and Reinterpret Public Speaking Fears.

Science.gov (United States)

Jackson, Ben; Compton, Josh; Thornton, Ashleigh L; Dimmock, James A

2017-01-01

Inoculation theory offers a framework for protecting individuals against challenges to an existing attitude, belief, or state. Despite the prevalence and damaging effects of public speaking anxiety, inoculation strategies have yet to be used to help individuals remain calm before and during public speaking. We aimed to test the effectiveness of an inoculation message for reducing the onset of public speaking anxiety, and helping presenters interpret their speech-related anxiety more positively. Participants (Mage = 20.14, SD = 2.72) received either an inoculation (n = 102) or control (n = 128) message prior to engaging a public speaking task and reported a range of anxiety-related perceptions. Accounting for personality characteristics and perceptions of task importance, and relative to control participants, those who received the inoculation message reported significantly lower pre-task anxiety, and following the task, reported that they had experienced lower somatic anxiety, and that the inoculation message had caused them to view their nerves in a less debilitating light. Inoculation messages may be an effective strategy for helping participants reframe and reduce their apprehension about public speaking, and investigating their efficacy in other stress-inducing contexts may be worthwhile.

Disruption, segregation, and passivation for Pd and noble-metal overlayers on YBa2Cu3O/sub 6.9/

International Nuclear Information System (INIS)

Wagener, T.J.; Gao, Y.; Vitomirov, I.M.; Aldao, C.M.; Joyce, J.J.; Capasso, C.; Weaver, J.H.; Capone II, D.W.

1988-01-01

We have investigated interfaces formed when Pd and the noble metals Cu, Ag, and Au are deposited onto polycrystalline samples of YBa 2 Cu 3 O/sub 6.9/ fractured in ultrahigh vacuum. Synchrotron-radiation photoemission results show that Cu and Pd overlayers leach oxygen from the underlying YBa 2 Cu 3 O/sub 6.9/ substrate, disrupt the superconductor, and destroy electronic states near the Fermi level. Interface reactions become kinetically limited at room temperature after the deposition of ∼4 A of Cu or Pd, significantly sooner than for the reactive metals Fe, Al, Ti, and In. The presence of Ba near the surface after the deposition of more than 100 A of Cu and Pd reflects substrate disruption and subsequent surface segregation. In contrast, overlayers of Ag and Au do not disrupt the superconductor substrate, no segregation is observed, but the overlayers are nonuniform and the quality of passivation is in question for coverages <100 A

Automated ultrasonic testing of nuclear reactor welds and overlays in pre-service and in-service inspections

International Nuclear Information System (INIS)

Sladky, J.

1988-01-01

Since 1982, automatic pre-service and in-service checks are being made of welded joints and overlays on pressure vessels of WWER-440 nuclear reactors in Czechoslovakia. This is being done using the SKODA REACTORTEST TRC facility which is used for checking peripheral welded joints on the pressure vessel, neck joints, overlays in other selected areas of the cylindrical section of the pressure vessel, on radius transitions of the pressure vessel and of necks, and on the cylindrical part of necks, and also for checking the base material in selected parts of the pressure vessel and the base material of the neck extension piece. The tests are of two types, namely tests of peripheral welds and overlays of the cylindrical parts of the pressure vessel, and tests of the necks. Different ultrasonic probe holders are used for the tests, with totally different design. Ultrasonic probes which were initially used were of foreign make while at present, those of Czechoslovak make are used. For each pressure vessel a set of ultrasonic probes is used which should suffice for the life of the vessel. Experience gained so far is being used in work on the project of a new device for testing nuclear reactor presure vessels from the inside. (Z.M.)

Effects of a dual-purpose bacterial inoculant on the fermentation ...

African Journals Online (AJOL)

Effects of a dual-purpose bacterial inoculant on the fermentation characteristics of high-moisture maize silage and dairy cattle performance. ... Inoculation did not affect the nutritive value or the aerobic stability of the maize silage, but increased the neutral detergent and acid detergent fibre fractions of the silage. However ...

Co-inoculation effects of Bradyrhizobium japonicum and ...

African Journals Online (AJOL)

Co-inoculation effects of Bradyrhizobium japonicum and Azospirillum sp. on competitive nodulation and rhizosphere eubacterial community structures of soybean under rhizobia-established soil conditions.

Effect of inoculum size, bacterial species, type of surfaces and contact time to the transfer of foodborne pathogens from inoculated to non-inoculated beef fillets via food processing surfaces.

Science.gov (United States)

Gkana, E; Chorianopoulos, N; Grounta, A; Koutsoumanis, K; Nychas, G-J E

2017-04-01

The objective of the present study was to determine the factors affecting the transfer of foodborne pathogens from inoculated beef fillets to non-inoculated ones, through food processing surfaces. Three different levels of inoculation of beef fillets surface were prepared: a high one of approximately 10 7  CFU/cm 2 , a medium one of 10 5  CFU/cm 2 and a low one of 10 3  CFU/cm 2 , using mixed-strains of Listeria monocytogenes, or Salmonella enterica Typhimurium, or Escherichia coli O157:H7. The inoculated fillets were then placed on 3 different types of surfaces (stainless steel-SS, polyethylene-PE and wood-WD), for 1 or 15 min. Subsequently, these fillets were removed from the cutting boards and six sequential non-inoculated fillets were placed on the same surfaces for the same period of time. All non-inoculated fillets were contaminated with a progressive reduction trend of each pathogen's population level from the inoculated fillets to the sixth non-inoculated ones that got in contact with the surfaces, and regardless the initial inoculum, a reduction of approximately 2 log CFU/g between inoculated and 1st non-inoculated fillet was observed. S. Typhimurium was transferred at lower mean population (2.39 log CFU/g) to contaminated fillets than E. coli O157:H7 (2.93 log CFU/g), followed by L. monocytogenes (3.12 log CFU/g; P < 0.05). Wooden surfaces (2.77 log CFU/g) enhanced the transfer of bacteria to subsequent fillets compared to other materials (2.66 log CFU/g for SS and PE; P < 0.05). Cross-contamination between meat and surfaces is a multifactorial process strongly depended on the species, initial contamination level, kind of surface, contact time and the number of subsequent fillet, according to analysis of variance. Thus, quantifying the cross-contamination risk associated with various steps of meat processing and food establishments or households can provide a scientific basis for risk management of such products. Copyright © 2016 Elsevier Ltd

First-principles study of nitric oxide oxidation on Pt(111) versus Pt overlayer on 3d transition metals

Energy Technology Data Exchange (ETDEWEB)

Arevalo, Ryan Lacdao [Department of Precision Science and Technology and Applied Physics, Osaka University, 2-1 Yamadaoka, Suita, Osaka 565-0871 (Japan); Escaño, Mary Clare Sison [Graduate School of Engineering, University of Fukui, 3-9-1 Bunkyo, Fukui 910-8507 (Japan); Kasai, Hideaki, E-mail: kasai@dyn.ap.eng.osaka-u.ac.jp [Department of Precision Science and Technology and Applied Physics, Center for Atomic and Molecular Technologies, and Center for Continuing Professional Development, Osaka University, 2-1 Yamadaoka, Suita, Osaka 565-0871 (Japan)

2015-03-15

Catalytic oxidation of NO to NO{sub 2} is a significant research interest for improving the quality of air through exhaust gas purification systems. In this paper, the authors studied this reaction on pure Pt and Pt overlayer on 3d transition metals using kinetic Monte Carlo simulations coupled with density functional theory based first principles calculations. The authors found that on the Pt(111) surface, NO oxidation proceeds via the Eley–Rideal mechanism, with O{sub 2} dissociative adsorption as the rate-determining step. The oxidation path via the Langmuir–Hinshelwood mechanism is very slow and does not significantly contribute to the overall reaction. However, in the Pt overlayer systems, the oxidation of NO on the surface is more thermodynamically and kinetically favorable compared to pure Pt. These findings are attributed to the weaker binding of O and NO on the Pt overlayer systems and the binding configuration of NO{sub 2} that promotes easier N-O bond formation. These results present insights for designing affordable and efficient catalysts for NO oxidation.

First principles analysis of hydrogen chemisorption on Pd-Re alloyed overlayers and alloyed surfaces

DEFF Research Database (Denmark)

Pallassana, Venkataraman; Neurock, Matthew; Hansen, Lars Bruno

2000-01-01

Gradient corrected periodic density functional theory (DFT-GGA) slab calculations were used to examine the chemisorption of atomic hydrogen on various Pd-Re alloyed overlayers and uniformly alloyed surfaces. Adsorption was examined at 33% surface coverage, where atomic hydrogen preferred the thre...

Influence of enrofloxacin traces in drinking water to doxycycline tissue pharmacokinetics in healthy and infected by Mycoplasma gallisepticum broiler chickens.

Science.gov (United States)

Gbylik-Sikorska, Malgorzata; Posyniak, Andrzej; Sniegocki, Tomasz; Sell, Bartosz; Gajda, Anna; Sawicka, Anna; Olszewska-Tomczyk, Monika; Bladek, Tomasz; Tomczyk, Grzegorz; Zmudzki, Jan

2016-04-01

Most of antibiotics, administrated in the treatment of poultry diseases are dissolved in drinking water, and it can lead to water supply systems contamination, especially when the regular cleaning is not using. This situation can lead to unconscious administration of low doses of antibiotics to untreated animals. The aim of this study was to clarify the impact of the exposure of enrofloxacin traces (500 μg l(-1)) to doxycycline pharmacokinetics in healthy and experimentally Mycoplasma gallisepticum infected broiler chickens., Two experimental groups, received of enrofloxacin in water and all groups, received 20 mg kg(-1) bw of doxycycline. The compounds concentrations in muscles and livers were determined by LC-MS/MS. The maximum drug tissue concentration (Cmax) of doxycycline was highest in liver obtained from infected chickens which, received enrofloxacin traces (ENR + DC/MG). It was about 40% higher than in healthy chickens from group I which received only doxycycline. It was found that the concentration-time curve AUC(0-t) values in group ENR + DC/MG were almost 75% higher than in the group (DC) and 35% higher than in group (ENR + DC) which also received enrofloxacin traces. The constant exposure of broiler chickens on enrofloxacin traces as well as infection, may significantly influenced on doxycycline tissue pharmacokinetic profile. Copyright © 2016 Elsevier Ltd. All rights reserved.

A Secure and Stable Multicast Overlay Network with Load Balancing for Scalable IPTV Services

Directory of Open Access Journals (Sweden)

Tsao-Ta Wei

2012-01-01

Full Text Available The emerging multimedia Internet application IPTV over P2P network preserves significant advantages in scalability. IPTV media content delivered in P2P networks over public Internet still preserves the issues of privacy and intellectual property rights. In this paper, we use SIP protocol to construct a secure application-layer multicast overlay network for IPTV, called SIPTVMON. SIPTVMON can secure all the IPTV media delivery paths against eavesdroppers via elliptic-curve Diffie-Hellman (ECDH key exchange on SIP signaling and AES encryption. Its load-balancing overlay tree is also optimized from peer heterogeneity and churn of peer joining and leaving to minimize both service degradation and latency. The performance results from large-scale simulations and experiments on different optimization criteria demonstrate SIPTVMON's cost effectiveness in quality of privacy protection, stability from user churn, and good perceptual quality of objective PSNR values for scalable IPTV services over Internet.

Striatal dopamine D2/3 receptor regulation by stress inoculation in squirrel monkeys

Directory of Open Access Journals (Sweden)

Alex G. Lee

2016-06-01

Full Text Available Intermittent mildly stressful situations provide opportunities to learn, practice, and improve coping in a process called stress inoculation. Stress inoculation also enhances cognitive control and response inhibition of impulsive motivated behavior. Cognitive control and motivation have been linked to striatal dopamine D2 and/or D3 receptors (DRD2/3 in rodents, monkeys, and humans. Here, we study squirrel monkeys randomized early in life to stress inoculation with or without maternal companionship and a no-stress control treatment condition. Striatal DRD2/3 availability in adulthood was measured in vivo by [11C]raclopride binding using positron emission tomography (PET. DRD2/3 availability was greater in caudate and putamen compared to ventral striatum as reported in PET studies of humans and other non-human primates. DRD2/3 availability in ventral striatum was also consistently greater in stress inoculated squirrel monkeys compared to no-stress controls. Squirrel monkeys exposed to stress inoculation in the presence of their mother did not differ from squirrel monkeys exposed to stress inoculation without maternal companionship. Similar effects in different social contexts extend the generality of our findings and together suggest that stress inoculation increases striatal DRD2/3 availability as a correlate of cognitive control in squirrel monkeys.

Rhizobial Inoculation, Alone or Coinoculated with Azospirillum brasilense, Promotes Growth of Wetland Rice

Directory of Open Access Journals (Sweden)

Leandro Hahn

Full Text Available ABSTRACT Rhizobia and associative bacteria promote growth in rice plants (Oryza sativa L. through a series of mechanisms, but most studies on inoculation have been performed based on inoculation with these bacteria in a separate or singular manner. The objective of this study was to assess the efficiency of single/isolated inoculation and inoculation combined with symbiotic rhizobia from forage legume and with Azospirillum brasilense on promoting growth and the root colonization process in wetland rice. Two rhizobia among four isolates from a greenhouse and a laboratory experiment were selected that efficiently promoted seed germination and rice plant growth in a sterilized substrate and in soil. The two most efficient isolates (UFRGS Vp16 and UFRGS Lc348 were inoculated alone or in combination with a commercial product containing A. brasilense in two field experiments using two wetland rice cultivars over two growing seasons. In the field experiments, these isolates coinoculated with A. brasilense promoted larger increases in the agronomic variables of wetland rice compared to the control without inoculation. Confocal laser microscopy confirmed the presence of inoculated bacteria tagged with gfp (UFRGS Vp16, UFRGS Lc348, and A. brasilense colonizing the root surface of the rice seedlings, mainly in the root hairs and lateral roots.

Comparative evaluation of concrete sealers and multiple layer polymer concrete overlays. Interim report no. 1.

Science.gov (United States)

1987-01-01

The report presents comparisons of initial evaluations of several concrete sealers and multiple layer polymer concrete overlays. The sealers evaluated included a solvent-dlspersed epoxy, a water-dlspersed epoxy, a silane, and a high molecular weight ...

Non-anthocyanin polyphenolic transformation by native yeast and bacteria co-inoculation strategy during vinification.

Science.gov (United States)

Devi, Apramita; Archana, Kodira Muthanna; Bhavya, Panikuttria Kuttappa; Anu-Appaiah, Konerira Aiyappaa

2018-02-01

Co-inoculation has been adapted by many wine-producing countries because it enhances the success of malolactic fermentation and reduces the fermentation cost, as well as time. However, wine phenolics have been sparsely highlighted during co-inoculation, even though polyphenols are an important parameter affecting wine colour, astringency and aroma. In the present study, we investigated the impact of co-inoculation on non-anthocyanin polyphenol profile for two different grape varieties. Co-inoculation of native yeast strain (AAV2) along with Oenococcus oeni was adapted for Cabernet Sauvignon and Shiraz wine. It was observed that the co-inoculation had minimal yet significant impact on the phenolic composition of wines for both the grape varieties. Color loss, as well as fruity aroma development, was observed in co-inoculated wines. The wines were on a par with the commercial wine, as well as wines without malolactic fermentation, in terms of phenolic compounds and overall organoleptic acceptance. Principal component analysis and hierarchical cluster analysis further suggested that the varietal influence on phenolic composition was dominating compared to inoculation strategies. Among the varieties, the inoculation strategies have significantly influenced the Cabernet wines compared to Shiraz wines. The results of the present study demonstrate that the phenolic compounds are not drastically affected by metabolic activities of malolactic bacteria during co-inoculation and, hence, are equally suitable for wine fermentation. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Effect of Titanium Inoculation on Tribological Properties of High Chromium Cast Iron

Directory of Open Access Journals (Sweden)

Siekaniec D.

2017-12-01

Full Text Available The present investigation focuses on the study of the influence of titanium inoculation on tribological properties of High Chromium Cast Iron. Studies of tribological properties of High Chromium Cast Iron, in particularly the wear resistance are important because of the special application of this material. High Chromium Cast Iron is widely used for parts that require high wear resistance for example the slurry pumps, brick dies, several pieces of mine drilling equipment, rock machining equipment, and similar ones. Presented research described the effects of various amounts of Fe-Ti as an inoculant for wear resistance. The results of wear resistance were collated with microstructural analysis. The melts were conducted in industrial conditions. The inoculation was carried out on the stream of liquid metal. The following amount of inoculants have been used; 0.17% Fe-Ti, 0.33% Fe-Ti and 0.66% Fe-Ti. The tests were performed on the machine type MAN. The assessment of wear resistance was made on the basis of the weight loss. The experimental results indicate that inoculation improve the wear resistance. In every sample after inoculation the wear resistance was at least 20% higher than the reference sample. The best result, thus the smallest wear loss was achieved for inoculation by 0.66% Fe-Ti. There is the correlation between the changing in microstructure and wear resistance. With greater amount of titanium the microstructure is finer. More fine carbides do not crumbling so quickly from the matrix, improving the wear resistance.

THE FUZZY OVERLAY STUDENT MODEL IN AN INTELLIGENT TUTORING SYSTEM

Directory of Open Access Journals (Sweden)

D. I. Popov

2015-01-01

Full Text Available The article is devoted to the development of the student model for use in an intelligent tutoring system (ITS designed for the evaluation of students’ competencies in different Higher Education Facilities. There are classification and examples of the various student models, the most suitable for the evaluation of competencies is selected and finalized. The dynamic overlay fuzzy student model builded on the domain model based on the concept of didactic units is described in this work. The formulas, chart and diagrams are provided.

Inoculation effects on root-colonizing arbuscular mycorrhizal fungal communities spread beyond directly inoculated plants

Czech Academy of Sciences Publication Activity Database

Janoušková, Martina; Krak, Karol; Vosátka, Miroslav; Püschel, David; Štorchová, Helena

2017-01-01

Roč. 12, č. 7 (2017), s. 1-21, č. článku e0181525. E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) LH14285 Institutional support: RVO:67985939 ; RVO:61389030 Keywords : inoculation * arbuscular mycorrhiza * community Subject RIV: EH - Ecology, Behaviour; EH - Ecology, Behaviour (UEB-Q) OBOR OECD: Plant sciences, botany; Plant sciences, botany (UEB-Q) Impact factor: 2.806, year: 2016

Dual-energy CT for detection of endoleaks after endovascular abdominal aneurysm repair: usefulness of colored iodine overlay.

Science.gov (United States)

Ascenti, Giorgio; Mazziotti, Silvio; Lamberto, Salvatore; Bottari, Antonio; Caloggero, Simona; Racchiusa, Sergio; Mileto, Achille; Scribano, Emanuele

2011-06-01

The purpose of our study was to evaluate the value of dual-source dual-energy CT with colored iodine overlay for detection of endoleaks after endovascular abdominal aortic aneurysm repair. We also calculated the potential dose reduction by using a dual-energy CT single-phase protocol. From November 2007 to November 2009, 74 patients underwent CT angiography 2-7 days after endovascular repair during single-energy unenhanced and dual-energy venous phases. By using dual-energy software, the iodine overlay was superimposed on venous phase images with different percentages ranging between 0 (virtual unenhanced images) and 50-75% to show the iodine in an orange color. Two blinded readers evaluated the data for diagnosis of endoleaks during standard unenhanced and venous phase images (session 1, standard of reference) and virtual unenhanced and venous phase images with colored iodine overlay images (session 2). We compared the effective dose radiation of a single-energy biphasic protocol with that of a single-phase dual-energy protocol. The diagnostic accuracy of session 2 was calculated. The mean dual-energy effective dose was 7.27 mSv. By using a dual-energy single-phase protocol, we obtained a mean dose reduction of 28% with respect to a single-energy biphasic protocol. The diagnostic accuracy of session 2 was: 100% sensitivity, 100% specificity, 100% negative predictive value, and 100% positive predictive value. Statistically significant differences in the level of confidence for endoleak detection between the two sessions were found by reviewers for scores 3-5. Dual-energy CT with colored iodine overlay is a useful diagnostic tool in endoleak detection. The use of a dual-energy single-phase study protocol will lower radiation exposure to patients.

Response of Sesbania grandiflora to Inoculation of Soil with Vesicular-Arbuscular Mycorrhizal Fungi.

Science.gov (United States)

Habte, M; Aziz, T

1985-09-01

A greenhouse experiment was conducted to determine the influence of two tropical isolates of Glomus fasciculatum and Glomus mosseae on the nutrient uptake and growth of Sesbania grandiflora. Inoculation of sterile soil with the fungi significantly improved growth and nutrient uptake by S. grandiflora, but the response of the legume was markedly better when the soil was inoculated with G. fasciculatum than when it was inoculated with G. mosseae. Nutrient uptake and growth of S. grandiflora in nonsterile soil was also significantly stimulated by inoculation, but the legume did not respond differently to the two endophytes under this condition.

Gas Selectivity Control in Co3O4 Sensor via Concurrent Tuning of Gas Reforming and Gas Filtering using Nanoscale Hetero-Overlayer of Catalytic Oxides.

Science.gov (United States)

Jeong, Hyun-Mook; Jeong, Seong-Yong; Kim, Jae-Hyeok; Kim, Bo-Young; Kim, Jun-Sik; Abdel-Hady, Faissal; Wazzan, Abdulaziz A; Al-Turaif, Hamad Ali; Jang, Ho Won; Lee, Jong-Heun

2017-11-29

Co 3 O 4 sensors with a nanoscale TiO 2 or SnO 2 catalytic overlayer were prepared by screen-printing of Co 3 O 4 yolk-shell spheres and subsequent e-beam evaporation of TiO 2 and SnO 2 . The Co 3 O 4 sensors with 5 nm thick TiO 2 and SnO 2 overlayers showed high responses (resistance ratios) to 5 ppm xylene (14.5 and 28.8) and toluene (11.7 and 16.2) at 250 °C with negligible responses to interference gases such as ethanol, HCHO, CO, and benzene. In contrast, the pure Co 3 O 4 sensor did not show remarkable selectivity toward any specific gas. The response and selectivity to methylbenzenes and ethanol could be systematically controlled by selecting the catalytic overlayer material, varying the overlayer thickness, and tuning the sensing temperature. The significant enhancement of the selectivity for xylene and toluene was attributed to the reforming of less reactive methylbenzenes into more reactive and smaller species and oxidative filtering of other interference gases, including ubiquitous ethanol. The concurrent control of the gas reforming and oxidative filtering processes using a nanoscale overlayer of catalytic oxides provides a new, general, and powerful tool for designing highly selective and sensitive oxide semiconductor gas sensors.

Milk production response to feeding alfalfa silage inoculated with Lactobacillus plantarum

Science.gov (United States)

In mini-silo trials, silages treated with a Lactobacillus plantarum silage inoculant (Ecosyl, Yorkshire, UK) had increased in vitro rumen microbial biomass production compared to untreated. Our objective was to determine if alfalfa silage treated with this inoculant could produce a milk production r...

Albendazole inhibits Pneumocystis carinii proliferation in inoculated immunosuppressed mice.

OpenAIRE

Bartlett, M S; Edlind, T D; Lee, C H; Dean, R; Queener, S F; Shaw, M M; Smith, J W

1994-01-01

Albendazole, a benzimidazole derivative widely used for treating helminth infections, was successfully used to treat and prevent development of Pneumocystis carinii pneumonia in transtracheally inoculated immunosuppressed mice. For treatment, 3 weeks postinoculation, albendazole at 300 and 600 mg/kg of body weight per day was administered in food for 3 weeks. For prophylaxis, albendazole was begun on the same day as inoculation at 300 mg/kg/day for 7 days, and then the dose was reduced to 150...

Microbial Inoculants and Their Impact on Soil Microbial Communities: A Review

Directory of Open Access Journals (Sweden)

Darine Trabelsi

2013-01-01

Full Text Available The knowledge of the survival of inoculated fungal and bacterial strains in field and the effects of their release on the indigenous microbial communities has been of great interest since the practical use of selected natural or genetically modified microorganisms has been developed. Soil inoculation or seed bacterization may lead to changes in the structure of the indigenous microbial communities, which is important with regard to the safety of introduction of microbes into the environment. Many reports indicate that application of microbial inoculants can influence, at least temporarily, the resident microbial communities. However, the major concern remains regarding how the impact on taxonomic groups can be related to effects on functional capabilities of the soil microbial communities. These changes could be the result of direct effects resulting from trophic competitions and antagonistic/synergic interactions with the resident microbial populations, or indirect effects mediated by enhanced root growth and exudation. Combination of inoculants will not necessarily produce an additive or synergic effect, but rather a competitive process. The extent of the inoculation impact on the subsequent crops in relation to the buffering capacity of the plant-soil-biota is still not well documented and should be the focus of future research.

Ultrafast evolution and loss of CRISPRs following a host shift in a novel wildlife pathogen, Mycoplasma gallisepticum.

Directory of Open Access Journals (Sweden)

Nigel F Delaney

2012-02-01

Full Text Available Measureable rates of genome evolution are well documented in human pathogens but are less well understood in bacterial pathogens in the wild, particularly during and after host switches. Mycoplasma gallisepticum (MG is a pathogenic bacterium that has evolved predominantly in poultry and recently jumped to wild house finches (Carpodacus mexicanus, a common North American songbird. For the first time we characterize the genome and measure rates of genome evolution in House Finch isolates of MG, as well as in poultry outgroups. Using whole-genome sequences of 12 House Finch isolates across a 13-year serial sample and an additional four newly sequenced poultry strains, we estimate a nucleotide diversity in House Finch isolates of only ∼2% of ancestral poultry strains and a nucleotide substitution rate of 0.8-1.2×10(-5 per site per year both in poultry and in House Finches, an exceptionally fast rate rivaling some of the highest estimates reported thus far for bacteria. We also found high diversity and complete turnover of CRISPR arrays in poultry MG strains prior to the switch to the House Finch host, but after the invasion of House Finches there is progressive loss of CRISPR repeat diversity, and recruitment of novel CRISPR repeats ceases. Recent (2007 House Finch MG strains retain only ∼50% of the CRISPR repertoire founding (1994-95 strains and have lost the CRISPR-associated genes required for CRISPR function. Our results suggest that genome evolution in bacterial pathogens of wild birds can be extremely rapid and in this case is accompanied by apparent functional loss of CRISPRs.

Nickel-base alloy overlay weld with improved ultrasonic flaw detection by magnetic stirring welding

International Nuclear Information System (INIS)

Takashi, Hirano; Kenji, Hirano; Masayuki, Watando; Takahiro, Arakawa; Minoru, Maeda

2001-01-01

Ultrasonic flaw detection is more difficult in Nickel-base alloy welds containing dendrites owing to the decrease ultrasonic transmissibility they cause. The present paper discusses application of magnetic stirring welding as a means for reducing dendrite growth with consequent improvement in ultrasonic transmissibility. Single pass and multi-pass welding tests were conducted to determine optimal welding conditions. By PT and macro observation subsequent to welding was carried out, optimal operation conditions were clarified. Overlay welding tests and UT clearly indicated ultrasonic beam transmissibility in overlay welds to be improved and detection capacity to be greater through application of magnetic stirring welding. Optimal operation conditions were determined based on examination of temper bead effects in the heat affected zone of low alloy steel by application of magnetic stirring welding to the butt welded joints between low alloy and stainless steel. Hardness in this zone of low alloy steel after the fourth layer was less than 350 HV. (author)

Azolla filiculoides Nitrogenase Activity Decrease Induced by Inoculation with Chlamydomonas sp. †

Science.gov (United States)

Habte, Mitiku

1986-01-01

Experiments were conducted to determine the influence of Chlamydomonas sp. on nitrogen fixation (C2H2 → C2H4) in Azolla filiculoides and on the nitrogen fixation and growth of free-living Anabaena azollae 2B organisms. Inoculation of azolla medium with Chlamydomonas sp. was associated with decreased nitrogenase activity in A. filiculoides and with increases in the density of a fungal population identified as Acremonium sp. Subsequent inoculation of azolla medium with this fungus was also accompanied by a significant decrease in nitrogenase activity of A. filiculoides. However, the extent of depression of nitrogenase activity was significantly higher when azolla medium was inoculated with Chlamydomonas sp. than when it was inoculated with Acremonium sp. Inoculation of nitrogen-free Stanier medium with either Acremonium sp. or Chlamydomonas sp. did not adversely affect the growth or nitrogenase activity of free-living A. azollae. Decreased nitrogenase activity in A. filiculoides is apparently related to the adverse influence of the green alga and the fungus on the macrosymbiont. The mechanisms that might be involved are discussed. PMID:16347211

Accelerated testing for studying pavement design and performance (FY 2000) : effectiveness of fiber reinforced and plain, ultra-thin concrete overlays on Portland Cement Concrete Pavement (PCCP).

Science.gov (United States)

2003-11-01

The objective of the research was to compare the performance of fiber reinforced and plain PCC concrete overlay when used as a thin non-dowelled overlay on top of a rubblized, distressed concrete pavement. The experiment was conducted at the Accelera...

Simple overlay device for determining radial head and neck height

Energy Technology Data Exchange (ETDEWEB)

Moon, Jun-Gyu; Southgate, Richard D.; Fitzsimmons, James S.; O' Driscoll, Shawn W. [Mayo Clinic, Department of Orthopaedic Surgery, Rochester, MN (United States)

2010-09-15

The purpose of this study was to test the hypothesis that a simple overlay device can be used on radiographs to measure radial head and neck height. Thirty anteroposterior elbow radiographs from 30 patients with a clinical diagnosis of lateral epicondylitis were examined to measure radial head and neck height. Three methods using different points along the bicipital tuberosity as a landmark were used. Method 1 used the proximal end of the bicipital tuberosity, method 2 used the most prominent point of the bicipital tuberosity, and method 3 used a simple overlay device (SOD) template that was aligned with anatomic reference points. All measurements were performed three times by three observers to determine interobserver and intraobserver reliability. Intraclass correlation coefficients revealed higher interobserver and intraobserver correlations for the SOD template method than for the other two methods. The 95% limits of agreement between observers were markedly better (-1.8 mm to +1.0 mm) for the SOD template method than for the proximal point method (-3.8 mm to +3.4 mm) or the prominent point method (-5.9 mm to +4.9 mm). We found that the SOD template method was reliable for assessing radial head and neck height. It had less variability than other methods, its 95% limit of agreement being less than 2 mm. This method could be helpful for assessing whether or not the insertion of a radial head prosthesis has resulted in over-lengthening of the radius. (orig.)

Simple overlay device for determining radial head and neck height

International Nuclear Information System (INIS)

Moon, Jun-Gyu; Southgate, Richard D.; Fitzsimmons, James S.; O'Driscoll, Shawn W.

2010-01-01

The purpose of this study was to test the hypothesis that a simple overlay device can be used on radiographs to measure radial head and neck height. Thirty anteroposterior elbow radiographs from 30 patients with a clinical diagnosis of lateral epicondylitis were examined to measure radial head and neck height. Three methods using different points along the bicipital tuberosity as a landmark were used. Method 1 used the proximal end of the bicipital tuberosity, method 2 used the most prominent point of the bicipital tuberosity, and method 3 used a simple overlay device (SOD) template that was aligned with anatomic reference points. All measurements were performed three times by three observers to determine interobserver and intraobserver reliability. Intraclass correlation coefficients revealed higher interobserver and intraobserver correlations for the SOD template method than for the other two methods. The 95% limits of agreement between observers were markedly better (-1.8 mm to +1.0 mm) for the SOD template method than for the proximal point method (-3.8 mm to +3.4 mm) or the prominent point method (-5.9 mm to +4.9 mm). We found that the SOD template method was reliable for assessing radial head and neck height. It had less variability than other methods, its 95% limit of agreement being less than 2 mm. This method could be helpful for assessing whether or not the insertion of a radial head prosthesis has resulted in over-lengthening of the radius. (orig.)

Inoculation with arbuscular mycorrhizal fungi improves the nutritional value of tomatoes.

Science.gov (United States)

Hart, Miranda; Ehret, David L; Krumbein, Angelika; Leung, Connie; Murch, Susan; Turi, Christina; Franken, Philipp

2015-07-01

Arbuscular mycorrhizal (AM) fungi can affect many different micronutrients and macronutrients in plants and also influence host volatile compound synthesis. Their effect on the edible portions of plants is less clear. Two separate studies were performed to investigate whether inoculation by AM fungi (Rhizophagus irregularis, Funneliformis mosseae, or both) can affect the food quality of tomato fruits, in particular common minerals, antioxidants, carotenoids, a suite of vitamins, and flavor compounds (sugars, titratable acids, volatile compounds). It was found that AM fungal inoculation increased the nutrient quality of tomato fruits for most nutrients except vitamins. Fruit mineral concentration increased with inoculation (particularly N, P, and Cu). Similarly, inoculated plants had fruit with higher antioxidant capacity and more carotenoids. Furthermore, five volatile compounds were significantly higher in AM plants compared with non-AM controls. Taken together, these results show that AM fungi represent a promising resource for improving both sustainable food production and human nutritional needs.

ORF Alignment: NC_004829 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ma gallisepticum R] ref|NP_853289.1| Hit-like ... [Mycoplasma gallisepticum R] ... Length = 131 ... Query: 15 ... NCVFCKIINNE...IQAHVVAQNDLAIAFLDAFPVSNGHTLVIPKKHHQDFSRTPKEEMHAVT 74 ... NCVFCKIINNEIQAHVVAQ...NDLAIAFLDAFPVSNGHTLVIPKKHHQDFSRTPKEEMHAVT Sbjct: 1 ... NCVFCKIINNEIQAHVVAQNDLAIAFLD

Enabling optical metrology on small 5×5μm2 in-cell targets to support flexible sampling and higher order overlay and CD control for advanced logic devices nodes

Science.gov (United States)

Salerno, Antonio; de la Fuente, Isabel; Hsu, Zack; Tai, Alan; Chang, Hammer; McNamara, Elliott; Cramer, Hugo; Li, Daoping

2018-03-01

In next generation Logic devices, overlay control requirements shrink to sub 2.5nm level on-product overlay. Historically on-product overlay has been defined by the overlay capability of after-develop in-scribe targets. However, due to design and dimension, the after development metrology targets are not completely representative for the final overlay of the device. In addition, they are confined to the scribe-lane area, which limits the sampling possibilities. To address these two issues, metrology on structures matching the device structure and which can be sampled with high density across the device is required. Conventional after-etch CDSEM techniques on logic devices present difficulties in discerning the layers of interest, potential destructive charging effects and finally, they are limited by the long measurement times[1] [2] [3] . All together, limit the sampling densities and making CDSEM less attractive for control applications. Optical metrology can overcome most of these limitations. Such measurement, however, does require repetitive structures. This requirement is not fulfilled by logic devices, as the features vary in pitch and CD over the exposure field. The solution is to use small targets, with a maximum pad size of 5x5um2 , which can easily be placed in the logic cell area. These targets share the process and architecture of the device features of interest, but with a modified design that replicates as close as possible the device layout, allowing for in-device metrology for both CD and Overlay. This solution enables measuring closer to the actual product feature location and, not being limited to scribe-lanes, it opens the possibility of higher-density sampling schemes across the field. In summary, these targets become the facilitator of in-device metrology (IDM), that is, enabling the measurements both in-device Overlay and the CD parameters of interest and can deliver accurate, high-throughput, dense and after-etch measurements for Logic

Interactive overlay maps for US Patent (USPTO) data based on International Patent Classifications (IPC)

NARCIS (Netherlands)

Leydesdorff, L.; Kushnir, D.; Rafols, I.

2014-01-01

We report on the development of an interface to the US Patent and Trademark Office (USPTO) that allows for the mapping of patent portfolios as overlays to basemaps constructed from citation relations among all patents contained in this database during the period 1976-2011. Both the interface and the

Co-inoculation of arbusculr mycorrhizae and nitrogen fixing bacteria enhance alfalfa yield under saline conditions

International Nuclear Information System (INIS)

Zhu, R.; Tang, F.; Liu, F.; Chen, J.

2016-01-01

The study was to investigate the effects of combined inoculation of Glomus mosseae (arbusculr mycorrhizae fungi, AMF) and Sinorhizobium meliloti (nitrogen-fixing bacteria, i.e., an Rhizobium meliloti, RM) on yield, nutrient contents, nodulation and mycorrhizal colonization of different alfalfa cultivars under saline conditions. An experiment was conducted to test the efficacy of AMF and RM inoculation in development of salt tolerance in alfalfa cultivars (Zhaodong, Nongjing and Longmu) under different salinity levels (0, 60, 120 and 180 mM NaCl). We found that under non stress condition, double inoculation of alfalfa with rhizobium and AM increased the alfalfa yield, nodule weight and number, as well as shoot proline contents, the most when plants were double inoculated followed by AM and rhizobium inoculation, respectively. Whereas under salinity condition, double inoculation of alfalfa with rhizobium and AM increased alfalfa yield, mycorrhizal infection, nodule weight and number as well as increased in shoot proline content, the most followed by AM and rhizobium inoculation, respectively. The Results suggest that growth of alfalfa may be improved by combined inoculation of alfalfa with AM and rhizobium under salt and non-stress conditions. Alleviation of alfalfa growth under saline condition was perhaps due to an increase in mycorrhizal infection and nodule weight and number as well as an increased in shoot proline content by dual inoculation. (author)

Co-inoculation effects of Bradyrhizobium japonicum and ...

African Journals Online (AJOL)

Corporate Edition

2013-05-15

. 2851. MATERIALS AND METHODS. Bacterial strains, media and growth conditions. Two B. japonicum strains of CB 1809 and USDA 110 those currently used in rhizobial inoculants production for soybean at the. Department ...

Bandwidth auction for SVC streaming in dynamic multi-overlay

Science.gov (United States)

Xiong, Yanting; Zou, Junni; Xiong, Hongkai

2010-07-01

In this paper, we study the optimal bandwidth allocation for scalable video coding (SVC) streaming in multiple overlays. We model the whole bandwidth request and distribution process as a set of decentralized auction games between the competing peers. For the upstream peer, a bandwidth allocation mechanism is introduced to maximize the aggregate revenue. For the downstream peer, a dynamic bidding strategy is proposed. It achieves maximum utility and efficient resource usage by collaborating with a content-aware layer dropping/adding strategy. Also, the convergence of the proposed auction games is theoretically proved. Experimental results show that the auction strategies can adapt to dynamic join of competing peers and video layers.

Leveraging Gaussian process approximations for rapid image overlay production

CSIR Research Space (South Africa)

Burke, Michael

2017-10-01

Full Text Available value, xs = argmax x∗ [ K (x∗, x∗) − K (x∗, x)K (x, x)−1K (x, x∗) ] . (10) Figure 2 illustrates this sampling strategy more clearly. This selec- tion process can be slow, but could be bootstrapped using Latin hypercube sampling [16]. 3 RESULTS Empirical... point - a 240 sample Gaussian process approximation takes roughly the same amount of time to compute as the full blanked overlay. GP 50 GP 100 GP 150 GP 200 GP 250 GP 300 GP 350 GP 400 Full Itti-Koch 0 2 4 6 8 10 Method R at in g Boxplot of storyboard...

Expressed sequence tags related to nitrogen metabolism in maize inoculated with Azospirillum brasilense.

Science.gov (United States)

Pereira-Defilippi, L; Pereira, E M; Silva, F M; Moro, G V

2017-05-31

The relative quantitative real-time expression of two expressed sequence tags (ESTs) codifying for key enzymes in nitrogen metabolism in maize, nitrate reductase (ZmNR), and glutamine synthetase (ZmGln1-3) was performed for genotypes inoculated with Azospirillum brasilense. Two commercial single-cross hybrids (AG7098 and 2B707) and two experimental synthetic varieties (V2 and V4) were raised under controlled greenhouse conditions, in six treatment groups corresponding to different forms of inoculation and different levels of nitrogen application by top-dressing. The genotypes presented distinct responses to inoculation with A. brasilense. Increases in the expression of ZmNR were observed for the hybrids, while V4 only displayed a greater level of expression when the plants received nitrogenous fertilization by top-dressing and there was no inoculation. The expression of the ZmGln1-3EST was induced by A. brasilense in the hybrids and the variety V4. In contrast, the variety V2 did not respond to inoculation.

Quantitative Simulation of Damage Roots on Inoculated Alfalfa by Arbuscular Mycorrhiza Fungi

Directory of Open Access Journals (Sweden)

Ying Liu

2017-12-01

Full Text Available Underground mining would cause ground subsidence damage and large amounts of cracks, which would result a loss of surface moisture and nutrient and intensifying drought. There are a few reports about damage to plant roots caused by coal mining. The irregular distribution of plant roots in soil and the different forces generated in process of surface subsidence are difficult to study comprehensively. The technologies to repair damaged plant roots have not been completely perfected yet. Based on quantitative simulation of alfalfa root cut-repair experiment, this paper discusses the influences of inoculated Arbuscular Mycorrhiza Fungi on alfalfa root and the mitigation effects of an inoculation on the growth of alfalfa. Root injured alfalfa were investigated by soil pot experiments. The result indicated that at the same cut degree, the growth situation of inoculated alfalfa is better than the contrast. Compared with the Olsen-P content, at cut level of 0 and 1/3, the sand of inoculated alfalfa has less Olsen-P than contrast, at cut degree of 1/2 and 2/3, the sand of inoculated alfalfa has more Olsen-P than contrast, at degree of 3/4, the sand of inoculated alfalfa has less Olsen-P than contrast, the change trend of Olsen-P content is concerned with the relative strength size of absorb Olsen-P by alfalfa root and dissolve Olsen-P by root exudates and hyphae interstate.

Equipment stainless steel entire versus steels bimetallics clad or overlay; Utilizacao de equipamentos de processo construidos em aco inoxidavel integral versus acos bimetalicos cladeado ou 'overlay'

Energy Technology Data Exchange (ETDEWEB)

Batista, Itamar da Silva; Lima, Jadival Carneiro de; Leal, Murilo Fonseca; Cardoso, Amauri dos Santos; Jorjan, Roberto [PETROBRAS S.A., Sao Francisco do Conde, BA (Brazil). Refinaria Landulfo Alves Mataripen (RLAM)

2008-07-01

This study does not recommend the use of a pressure vessel made of integral stainless steel, due to the failure mechanisms under stress corrosion assisted by chlorides or polythionic acid. Are presented case studies of literature and analysis of reports of proceedings of RLAM reactors, showing that the materials produced by bimetallic clad overlay or are more appropriate, in terms of integrity, for use in equipment that the internal environment requires austenitic stainless steel specification.

Effect of thermo-tolerant actinomycetes inoculation on cellulose degradation and the formation of humic substances during composting.

Science.gov (United States)

Zhao, Yi; Zhao, Yue; Zhang, Zhechao; Wei, Yuquan; Wang, Huan; Lu, Qian; Li, Yanjie; Wei, Zimin

2017-10-01

The inoculum containing four cellulolytic thermophilic actinomycetes was screened from compost samples, and was inoculated into co-composting during different inoculation phases. The effect of different inoculation phases on cellulose degradation, humic substances formation and the relationship between inoculation and physical-chemical parameters was determined. The results revealed that inoculation at different phases of composting improved cellulase activities, accelerated the degradation of cellulose, increased the content of humic substances and influenced the structure of actinomycetic community, but there were significant differences between different inoculation phases. Redundancy analysis showed that the different inoculation phases had different impacts on the relationship between exogenous actinobacteria and physical-chemical parameters. Therefore, based on the promoting effort of inoculation in thermophilic phase of composting for the formation of humic substances, we suggested an optimized inoculation strategy to increase the content of humic substances, alleviate CO 2 emission during composting. Copyright © 2017 Elsevier Ltd. All rights reserved.

Combination of inoculation methods of Azospirilum brasilense with broadcasting of nitrogen fertilizer increases corn yield

Directory of Open Access Journals (Sweden)

Tânia Maria Müller

2015-01-01

Full Text Available Nitrogen (N is the most limiting nutrient for corn production. Thereby, the goal of the paper was to evaluate inoculation methods of Azospirillum brasilense in order to partially supply N required by the crop. The experiment was carried out in Guarapuava, PR, Brasil, in 2011/2012 growing season. Randomized blocks with factorial 3 inoculation methods (seed treatment, planting furrow and non-inoculated control x 5 doses of nitrogen (0, 75, 150, 225 and 300kg ha-1 x 8 replications was used as the experimental design. Leaf are index, foliar nitrogen content, total chlorophyll, grains per ear and yield were evaluated. There was significant interaction between inoculation methods and nitrogen fertilization to leaf area index, but not for yield. Inoculation with the diazotrophic bacteria provided yield increase of 702kg ha-1 for inoculation in seeding furrow and 432kg ha-1 for inoculation in seed treatment compared to the control, but both treatments did not differ between each other. Furthermore, total chlorophyll, grains per ear and yield were positively affected, with quadratic response, by the nitrogen fertilization in broadcasting

Effect of water salinity on wheat inoculated with N fixing bacteria using 15N tracer technique

International Nuclear Information System (INIS)

Al-Sayed, M. A.; Soliman, S. M.; Galal, Y. G. M.; El-Hadidi, E. M.

2012-12-01

A pot experiment was carried out under greenhouse controlled conditions to investigate the effect of water salinity and bacterial inoculation on growth parameters and nutrient uptake by wheat ( Triticum aestivum, L. seda 6). Dry matter yield of shoots was gradually increased with increasing water salinity levels under dual inoculation (Rh + Az). This phenomenon was more pronounced with 6 ds m -1 rather than 3 ds m -1 water salinity level. This holds true with all inoculation treatments. Similar trend was noticed with root dry matter yield. N uptake by shoots was positively affected by water salinity levels under bacterial inoculation especially the dual treatments where N uptake tended to increase with increasing water salinity levels. N uptake by roots was severely affected by increasing water salinity levels as compared to fresh water treatment. N uptake by shoots was enhanced by inoculation under different water salinity levels as compared to the un inoculated treatment. Nitrogen uptake roots was dramatically affected by inoculation. It was only increased by inoculation when plants were irrigated with fresh water. Portions of Ndff were frequently affected by both water salinity levels and microbial inoculation. wheat plant as representative of cereal crops was more dependent on the portion of nitrogen up taken from fertilizer rather than those fixed from the air. Therefore, the plant-bacteria association was not efficient enough. Inoculated treatments compensated considerable amounts of its N demand from air beside those derived from fertilizer, therefore the remained N from fertilizer in soil was higher than those of un inoculated control which is more dependable on Ndff as well as Ndf s. 1 5N recovery by wheat plants was enhanced by bacterial inoculation as well as water salinity levels did. (Author)

Spatial Analysis for Potential Water Catchment Areas using GIS: Weighted Overlay Technique

Science.gov (United States)

Awanda, Disyacitta; Anugrah Nurul, H.; Musfiroh, Zahrotul; Dinda Dwi, N. P.

2017-12-01

The development of applied GIS is growing rapidly and has been widely applied in various fields. Preparation of a model to obtain information is one of the benefits of GIS. Obtaining information for water resources such as water catchment areas is one part of GIS modelling. Water catchment model can be utilized to see the distribution of potential and ability of a region in water absorbing. The use of overlay techniques with the weighting obtained from the literature from previous research is used to build the model. Model builder parameters are obtained through remote sensing interpretation techniques such as land use, landforms, and soil texture. Secondary data such as rock type maps are also used as water catchment model parameters. The location of this research is in the upstream part of the Opak river basin. The purpose of this research is to get information about potential distribution of water catchment area with overlay technique. The results of this study indicate the potential of water catchment areas with excellent category, good, medium, poor and very poor. These results may indicate that the Upper river basin is either good or in bad condition, so it can be used for better water resources management policy determination.

Differential response of kabuli and desi chickpea genotypes toward inoculation with PGPR in different soils

Science.gov (United States)

Imran, Asma; Mirza, Muhammad S.; Shah, Tariq M.; Malik, Kauser A.; Hafeez, Fauzia Y.

2015-01-01

Pakistan is among top three chickpea producing countries but the crop is usually grown on marginal lands without irrigation and fertilizer application which significantly hampers its yield. Soil fertility and inoculation with beneficial rhizobacteria play a key role in nodulation and yield of legumes. Four kabuli and six desi chickpea genotypes were, therefore, evaluated for inoculation response with IAA-producing Ochrobactrum ciceri Ca-34T and nitrogen fixing Mesorhizobium ciceri TAL-1148 in single and co-inoculation in two soils. The soil type 1 was previously unplanted marginal soil having low organic matter, P and N contents compared to soil type 2 which was a fertile routinely legume-cultivated soil. The effect of soil fertility status was pronounced and fertile soil on average, produced 31% more nodules, 62% more biomass and 111% grain yield than marginal soil. Inoculation either with O. ciceri alone or its co-inoculation with M. ciceri produced on average higher nodules (42%), biomass (31%), grains yield (64%) and harvest index (72%) in both chickpea genotypes over non-inoculated controls in both soils. Soil 1 showed maximum relative effectiveness of Ca-34T inoculation for kabuli genotypes while soil 2 showed for desi genotypes except B8/02. Desi genotype B8/02 in soil type 1 and Pb-2008 in soil type 2 showed significant yield increase as compared to respective un-inoculated controls. Across bacterial inoculation treatments, grain yield was positively correlated to growth and yield contributing parameters (r = 0.294* to 0.838*** for desi and r = 0.388* to 0.857** for kabuli). PCA and CAT-PCA analyses clearly showed a site-specific response of genotype x bacterial inoculation. Furthermore, the inoculated bacterial strains were able to persist in the rhizosphere showing colonization on root and within nodules. Present study shows that plant growth promoting rhizobacteria (PGPR) inoculation should be integrated with national chickpea breading program in

Structure determination of a multilayer with an island-like overlayer using hard x-ray photoelectron spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Isomura, N., E-mail: isomura@mosk.tytlabs.co.jp; Kataoka, K.; Horibuchi, K.; Dohmae, K.; Kitazumi, K.; Takahashi, N.; Kimoto, Y. [Toyota Central R& D Laboratories, Inc., 41-1 Yokomichi, Nagakute, Aichi 480-1192 (Japan); Oji, H.; Cui, Y.-T.; Son, J.-Y. [Japan Synchrotron Radiation Research Institute (JASRI), 1-1-1 Kouto, Sayo, Hyogo 679-5198 (Japan)

2016-07-27

We use hard X-ray photoelectron spectroscopy (HAXPES) to obtain the surface structure of a multilayer Au/SiO{sub 2}/Si substrate sample with an island-like overlayer. Photoelectron intensities are measured as a function of incident photon energy (PE) and take-off angle (TOA, measured from the sample surface). The Au layer coverage and Au and SiO{sub 2} layer thicknesses are obtained by the PE dependence, and are used for the following TOA analysis. The Au island lateral width in the cross section is obtained by the TOA dependence, including information about surface roughness, in consideration of the island shadowing at small TOAs. In both cases, curve-fitting analysis is conducted. The surface structure, which consists of layer thicknesses, overlayer coverage and island width, is determined nondestructively by a combination of PE and TOA dependent HAXPES measurements.

Self-Adapting Routing Overlay Network for Frequently Changing Application Traffic in Content-Based Publish/Subscribe System

Directory of Open Access Journals (Sweden)

Meng Chi

2014-01-01

Full Text Available In the large-scale distributed simulation area, the topology of the overlay network cannot always rapidly adapt to frequently changing application traffic to reduce the overall traffic cost. In this paper, we propose a self-adapting routing strategy for frequently changing application traffic in content-based publish/subscribe system. The strategy firstly trains the traffic information and then uses this training information to predict the application traffic in the future. Finally, the strategy reconfigures the topology of the overlay network based on this predicting information to reduce the overall traffic cost. A predicting path is also introduced in this paper to reduce the reconfiguration numbers in the process of the reconfigurations. Compared to other strategies, the experimental results show that the strategy proposed in this paper could reduce the overall traffic cost of the publish/subscribe system in less reconfigurations.

The Effect of Raffaelea quercus-mongolicae Inoculations on the Formation of Non-conductive Sapwood of Quercus mongolica.

Science.gov (United States)

Torii, Masato; Matsuda, Yosuke; Seo, Sang Tae; Kim, Kyung Hee; Ito, Shin-Ichiro; Moon, Myung Jin; Kim, Seong Hwan; Yamada, Toshihiro

2014-06-01

In Korea, mass mortality of Quercus mongolica trees has become obvious since 2004. Raffaelea quercus-mongolicae is believed to be a causal fungus contributing the mortality. To evaluate the pathogenicity of the fungus to the trees, the fungus was multiple- and single-inoculated to the seedlings and twigs of the mature trees, respectively. In both the inoculations, the fungus was reisolated from more than 50% of inoculated twigs and seedlings. In the single inoculations, proportions of the transverse area of non-conductive sapwood at inoculation points and vertical lengths of discoloration expanded from the points were significantly different between the inoculation treatment and the control. In the multiple inoculations, no mortality was confirmed among the seedlings examined. These results showed that R. quercus-mongolicae can colonize sapwood, contribute to sapwood discoloration and disrupt sap flows around inoculation sites of Q. mongolica, although the pathogenicity of the fungus was not proven.

( Rosa damascena Mill.) by microbial inoculation

African Journals Online (AJOL)

This study was carried out to determine the effects of microbial inoculation in breaking seed dormancy and on the germination of Rosa damascena Mill. Seeds of R. damascena Mill. are the most used scented rose species in rose oil production. The most important production centers around the world are Turkey and ...

Temperature stable LiNbO3 surface acoustic wave device with diode sputtered amorphous TeO2 over-layer

International Nuclear Information System (INIS)

Dewan, Namrata; Tomar, Monika; Gupta, Vinay; Sreenivas, K.

2005-01-01

Amorphous TeO 2 thin film, sputtered in the O 2 +Ar(25%+75%) gas environment using a metallic tellurium target, has been identified as an attractive negative temperature coefficient of delay (TCD) material that can yield a temperature stable device when combined with a surface acoustic wave (SAW) device based on positive TCD material such as LiNbO 3 . The influence of amorphous TeO 2 over-layer on the SAW propagation characteristics (velocity and temperature coefficient of delay) of the SAW filters (36 and 70 MHz) based on 128 deg. rotated Y-cut X-propagating lithium niobate (128 deg. Y-X LiNbO 3 ) single crystal has been studied. It is found that 0.042 λ thick TeO 2 over-layer on a prefabricated SAW device operating at 36 MHz centre frequency, reduces the TCD of the device from 76 ppm deg. C -1 to almost zero (∼1.4 ppm deg. C -1 ) without deteriorating its efficiency and could be considered as a suitable alternative for temperature stable devices in comparison to conventional SiO 2 over-layer

Bandwidth and power allocation for two-way relaying in overlay cognitive radio systems

KAUST Repository

Alsharoa, Ahmad M.

2014-12-01

In this paper, the problem of both bandwidth and power allocation for two-way multiple relay systems in overlay cognitive radio (CR) setup is investigated. In the CR overlay mode, primary users (PUs) cooperate with cognitive users (CUs) for mutual benefits. In our framework, we propose that the CUs are allowed to allocate a part of the PUs spectrum to perform their cognitive transmission. In return, acting as an amplify-and-forward two-way relays, they are used to support PUs to achieve their target data rates over the remaining bandwidth. More specifically, CUs acts as relays for the PUs and gain some spectrum as long as they respect a specific power budget and primary quality-of-service constraints. In this context, we first derive closed-form expressions for optimal transmit power allocated to PUs and CUs in order to maximize the cognitive objective. Then, we employ a strong optimization tool based on particle swarm optimization algorithm to find the optimal relay amplification gains and optimal cognitive released bandwidths as well. Our numerical results illustrate the performance of our proposed algorithm for different utility metrics and analyze the impact of some system parameters on the achieved performance.

Influence of bitumen type on cracking resistance of asphalt mixtures used in pavement overlays

Science.gov (United States)

Jaskula, P.; Szydlowski, C.; Stienss, M.

2018-05-01

Cracking is one of the predominant distresses occurring in flexible pavements, especially in old pavements that were rehabilitated with an asphalt overlay. In such cases asphalt mixtures should be designed to ensure high resistance to reflective cracking because new asphalt layers are exposed to existing cracks of the old pavement. The nature of these cracks can be various (transverse, longitudinal as well as crazy cracking). One factor that minimizes this type of distress is the proper mix design process, which should involve selection of specific bitumen binder and mineral mix gradation. However, still there is no universally adopted laboratory test method that would allow to clearly assess resistance of asphalt mixtures to reflective cracking. This paper describes the usage of one of the devices developed to test asphalt mixtures in terms of such distress – Texas Overlay Tester. For this test, samples prepared in laboratory conditions (i.e. compacted with the use of Superpave Gyratory Compactor) as well as obtained in the field (by core drilling) can be used. The results are obtained not only quickly and easily, but also with sufficient repeatability. The described method characterizes both crack initiation and crack propagation properties of asphalt mixtures. In this work one type of mineral mixture was tested with 4 different types of bitumen (one neat bitumen, two ordinary polymer-modified and one polymer-modified with high polymer content). For selected cases extra additives (rubber and loose fibres) were also tested. In total, six asphalt mixtures were tested. A ranking of the used binders was created on the basis of the results in order to conclude which bitumen would ensure the best performance characteristics in terms of reflective cracking. The results have clearly shown that deliberate choice of the binder used in the asphalt mixture for the overlay will significantly improve its reflective cracking resistance or even fatigue resistance.

Beauveria bassiana and Metarhizium anisopliae endophytically colonize cassava roots following soil drench inoculation

Science.gov (United States)

Greenfield, Melinda; Gómez-Jiménez, María I.; Ortiz, Viviana; Vega, Fernando E.; Kramer, Matthew; Parsa, Soroush

2016-01-01

We investigated the fungal entomopathogens Beauveria bassiana and Metarhizium anisopliae to determine if endophytic colonization could be achieved in cassava. An inoculation method based on drenching the soil around cassava stem cuttings using conidial suspensions resulted in endophytic colonization of cassava roots by both entomopathogens, though neither was found in the leaves or stems of the treated cassava plants. Both fungal entomopathogens were detected more often in the proximal end of the root than in the distal end. Colonization levels of B. bassiana were higher when plants were sampled at 7–9 days post-inoculation (84%) compared to 47–49 days post-inoculation (40%). In contrast, the colonization levels of M. anisopliae remained constant from 7–9 days post-inoculation (80%) to 47–49 days post-inoculation (80%), which suggests M. anisopliae is better able to persist in the soil, or as an endophyte in cassava roots over time. Differences in colonization success and plant growth were found among the fungal entomopathogen treatments. PMID:27103778

THE EFFECTS OF INOCULANT LACTIC ACID BACTERIA ON THE FERMENTATION AND AEROBIC STABILITY OF SUNFLOWER SILAGE

Directory of Open Access Journals (Sweden)

Fisun Koc

2009-12-01

Full Text Available This study was carried out to determine the effects of actic acid bacterial inoculant on the fermentation and aerobic stability of sunflower silages. Sunflower was harvested at the milk stage. Inoculant-1174 (Pioneer®,USA was used as homofermentative lactic acid bacterial inoculant. Inoculant was applied 6.00 log10 cfu/g silage levels. Silages with no additive served as controls. After treatment, the chopped sunflower was ensiled in the PVC type laboratory silos. Three silos for each group were sampled for chemical and microbiological analysis on days 2, 4, 7, 14, 21, 28 and 56 after ensiling. At the end of the ensiling period, all silages were subjected to an aerobic stability test for 14 days. Neither inoculant improved the fermentation parameters of sunflower silages. At the end of the ensiling period, inoculant increased lactic acid bacteria (LAB and decreased yeast and mould numbers of silages. Inoculant treatment did not affect aerobic stability of silages.

EFFECT OF MYCORRHIZAL INOCULANTS IN THE DEVELOPMENT OF MEXICAN LANDRACE AVOCADO ROOTSTOCKS

Directory of Open Access Journals (Sweden)

Edgar Castro Alvarado

2013-12-01

Full Text Available The aim of this work was to assess the effect of two arbuscular mycorrhizal fungi (AMF inoculants in the development of avocado rootstocks. Seeds of Mexican landrace avocado (Persea americana Mill. var. drymifolia were used, with two commercial inoculants: T1 containing Glomus fasciculatum, G. constrictum, G. tortuosum, G. geosporum,and Acaulospora scrobiculata, and T2, containing G. mosseae and G. cubense.  The plants inoculated with AMF showed more rapid growth than the no inoculant control as measured by plant height (50% and 54%, stem diameter (35% and 36%, leaf number (48% and 37% and length (31% and 40%, and root fresh weight (85% and 59%; however, no significant differences were observed between T1 and T2. The chlorophyll concentration in the leaves from T1 was 16.4% and T2 was 19% higher than the control suggesting a higher photosynthetic capacity in T1 and T2. Finally the shoot/root ratio, as indicator of the potential development of plantations, was 79% and 50% higher in mycorrhizal plants than in the control. In conclusion both T1 and T2 inoculants improved growth rate and vigor of avocado nursery rootstocks producing higher quality plants.

VUV light induced valence degeneration in Sm over-layer on HOPG

International Nuclear Information System (INIS)

Kutluk, G; Nakatake, M; Arita, M; Namatame, H; Taniguchi, M; Ishitobi, Y; Sumida, H

2013-01-01

Systematic investigation of the influence of vacuum ultraviolet (VUV) irradiation on the valence degeneration in a Sm over-layer on a HOPG substrate was performed using in-situ photoemission spectroscopy (XPS, UPS, and ARPES) for the Sm coverage regime of 0.05-3.6 Å. This investigation confirmed that VUV irradiation-induced degeneration of divalent Sm exerts a more profound effect than Sm contamination during photoemission spectroscopy even under UHV. We found that the charge transfer occurs mainly from divalent Sm to the HOPG surface.

Preempting Performance Challenges: The Effects of Inoculation Messaging on Attacks to Task Self-Efficacy

Science.gov (United States)

Jackson, Ben; Compton, Josh; Whiddett, Ryan; Anthony, David R.; Dimmock, James A.

2015-01-01

Although inoculation messages have been shown to be effective for inducing resistance to counter-attitudinal attacks, researchers have devoted relatively little attention toward studying the way in which inoculation theory principles might support challenges to psychological phenomena other than attitudes (e.g., self-efficacy). Prior to completing a physical (i.e., balance) task, undergraduates (N = 127, Mage = 19.20, SD = 2.16) were randomly assigned to receive either a control or inoculation message, and reported their confidence in their ability regarding the upcoming task. During the task, a confederate provided standardized negative feedback to all participants regarding their performance, and following the completion of the task, participants again reported their self-efficacy along with measures assessing in-task processes. Findings supported the viability of efficacy inoculation; controlling for pre-task self-efficacy, task performance, and relevant psycho-social variables (e.g., resilience, self-confidence robustness), participants in the inoculation condition reported greater confidence in their ability (i.e., task self-efficacy) than those in the control condition at post-task. Relative to those in the inoculation condition, participants in the control condition also experienced greater concentration disruption and self-presentation concerns during the task. PMID:25898287

Effects of Rhizobium inoculation on Trifolium resupinatum antioxidant system under sulfur dioxide pollution

Directory of Open Access Journals (Sweden)

Ladan Bayat

2014-01-01

Full Text Available Introduction: Plant growth stimulating rhizobacteria are beneficial bacteria that can cause resistance to various stresses in plants. One of these stresses is SO2 air pollution. SO2 is known as a strong damaging air pollutant that limits growth of plants. The aim of this study is evaluation of the effects of bacterial inoculation with native and standard Rhizobium on Persian clover root growth and antioxidants activity and capacity under air SO2 pollution. Materials and methods: In this study, 31 days plants (no-inoculated and inoculated with two strains of Rhizobium exposed to the different concentrations of SO2 (0 as a control, 0.5, 1, 1.5 and 2 ppm for 5 consecutive days and 2 hours per day. Results: Results showed different concentrations of SO2 had a significant effect on Persian clover root weight and antioxidant system. Increasing SO2 stress decreased root fresh and dry weight and antioxidant capacities (IC50 and increased antioxidant activities (I% of Persian clover leaves significantly in comparison to the control plants (under 0 ppm and increased SOD, CAT and GPX activity. Inoculation of Persian clover plants with native and standard Rhizobium increased root weight and did not show a significant effect on antioxidants activity and capacity, but interaction between Rhizobium inoculation and SO2 treatment reduced significantly the stress effects of high concentration of SO2 on root growth and antioxidants activity and capacity. In fact, level of this change of root growth and antioxidant system under SO2 pollution stress in inoculated plants was lower than in the non-inoculated plants. Discussion and conclusion: As a result, an increase in SO2 concentration caused a decrease in root weight, increase in antioxidants activity and capacity of Persian clover. Inoculation with Rhizobium strains could alleviate the effect of SO2 pollution on antioxidant system by effects on root growth.

Development and nitrate reductase activity of sugarcane inoculated with five diazotrophic strains.

Science.gov (United States)

Dos Santos, Silvana Gomes; da Silva Ribeiro, Flaviane; da Fonseca, Camila Sousa; Pereira, Willian; Santos, Leandro Azevedo; Reis, Veronica Massena

2017-08-01

Diazotrophs are able to stimulate plant growth. This study aimed at evaluating the effect of inoculation of five diazotrophic strains on growth promotion and nitrate reductase (NR, EC 1.7.1.1) activity in sugarcane. An experiment was carried out from three stages of cultivation: sprouting, tubes, and in hydroponics. On the first two stages, seven treatments were adopted: uninoculated control; mixed inoculation with five strains; and individual inoculation with Gluconacetobacter diazotrophicus (Gd), Herbaspirillum rubrisubalbicans (Hr), Herbaspirillum seropedicae (Hs), Nitrospirillum amazonense (Na), and Paraburkholderia tropica (Pt). The four treatments showing the best performance were transferred to the hydroponic system for analysis of NR activity. Hs, Pt, and the mixture of all strains led to the highest seedling biomass in tubes, followed by Hr. In hydroponics, the mixture and the strain Hr had the highest growth-promoting effect. NR activity was influenced by inoculation only under low N supply conditions, with positive effect of Hr, Pt, and the mixture.

Interactive overlays: a new method for generating global journal maps from Web-of-Science data

NARCIS (Netherlands)

Leydesdorff, L.; Rafols, I.

2012-01-01

Recent advances in methods and techniques enable us to develop interactive overlays to a global map of science based on aggregated citation relations among the 9162 journals contained in the Science Citation Index and Social Science Citation Index 2009. We first discuss the pros and cons of the

DETECCIÓN Y DIFERENCIACIÓN DE Mycoplasma gallisepticum Y Mycoplasma synoviae MEDIANTE LA TÉCNICA DE PCR A PARTIR DE HISOPOS TRAQUEALES DE AVES CON SÍNTOMAS RESPIRATORIOS

Directory of Open Access Journals (Sweden)

CESAR VENTURA

2012-09-01

Full Text Available Los micoplasmas son importantes patógenos en las aves por ser responsables de cuadros respiratorios que ocasionan grandes pérdidas económicas a la industria avícola a nivel mundial. Existen principalmente dos especies de micoplasmas como causantes de enfermedad en aves comerciales, el Mycoplasma gallisepticum (MG y el Mycoplasma synoviae (MS. Teniendo en cuenta su importancia y la necesidad de conocer y diferenciar la presencia de las diferentes especies de micoplasmas presentes en las explotaciones avícolas, se tomaron 91 muestras de hisopos traqueales de aves con síntomas respiratorios, provenientes de igual número de granjas de pollo de engorde, ponedoras comerciales y reproductoras pesadas ubicadas en los departamentos de Cundinamarca y Boyacá y se determinó la presencia de MG y MS por la técnica de PCR. La prevalencia determinada fue de 39,6% para MG y 47,3% para MS, encontrándose diferencias estadísticamente significativas cuando se comparó la positividad a MG y MS y el tipo de explotación (p

Enumeration of phenanthrene-degrading bacteria by an overlayer technique and its use in evaluation of petroleum-contaminated sites

International Nuclear Information System (INIS)

Bogardt, A.H.; Hemmingsen, B.B.

1992-01-01

Bacteria that are capable of degrading polycyclic aromatic hydrocarbons were enumerated by incorporating soil and water dilutions together with fine particles of phenanthrene, a polycyclic aromatic hydrocarbon, into an agarose overlayer and pouring the mixture over a mineral salts underlayer. The phenanthrene-degrading bacteria embedded in the overlayer were recognized by a halo of clearing in the opaque phenanthrene layer. Diesel fuel- or creosote-contaminated soil and water that were undergoing bioremediation contained 6 x 10 6 to 100 x 10 6 phenanthrene-degrading bacteria per g and ca. 5 x 10 5 phenanthrene-degrading bacteria per ml, respectively, whereas samples from untreated polluted sites contained substantially lower numbers. Unpolluted soil and water contained no detectable phenanthrene degraders or only very modest numbers of these organisms

assessment of injection of liquid rhizobial inoculum and traditional inoculation of soybean under furrow and drip irrigation

International Nuclear Information System (INIS)

Janat, M.; Kurdali, F.

2008-01-01

Soybean in naturally N 2 -fixing legume, but it needs artificial inoculation with appropriate strains of rhizobia when introduced to land not previously cultivated to the crop. As soybean is being introduced to Syria, inoculation with Bradyrhizobium japonicum is essential to ensure effective biological nitrogen fixation by the crop. The question is: what is the most effective mean of inoculation?. As Syria is a water-short country, we examined the possibility of applying the rhizobial inoculant in irrigation system (Biofertigation) in contrast with the conventional seed pelleting application. In a 2 year experiment at a research station near Damascus, we compared seed pelleting of the inoculant under furrow and drip irrigation, with repeated inoculation by injection of a liquid culture rhizobial inoculum through the drip system. Drip irrigation enhanced N 2 fixation by soybean regardless of inoculation technique ad repeated inoculation. Injection of the liquid rhizobial inoculum through drip irrigation system was shown to enhances the acquisition of atmospheric N 2 and improve N 2 fixation by soybean.(author)

DEVELOPMENT OF PIGEON PEA INOCULATED WITH RHIZOBIUM ISOLATED FROM COWPEA TRAP HOST PLANTS

Directory of Open Access Journals (Sweden)

SALOMÃO LIMA GUIMARÃES

2016-01-01

Full Text Available Pigeon pea is an important protein source grown in several tropical and sub - tropical countries, and is considered a multi - purpose plant that is resistant to the conditions of the Brazilian Cerrado. Among the possible uses for cowpea, its use as a green manure, increasing soil nitrogen content through the association with diazotrophic bacteria, generically known as rhizobia, is noteworthy. The present work aimed to evaluate the efficiency of Rhizobium strains isolated from cowpea plants in the development of pigeon peas cultured in Red Latosol. The experiment was conducted in a greenhouse, using a completely randomized design with seven treatments and four replications. Treatments consisted of inoculation with four Rhizobium strains (MT8, MT15, MT16, and MT23 and one commercial inoculant comprising Bradyrhizobium spp. strains BR 2801 and BR 2003. There were two controls, one absolute (without inoculation or nitrogen fertilization and the other with nitrogen fertilization. Each experimental plot consisted of an 8 - dm 3 vase containing three plants. Analyzed variables included plant height, SPAD index, number and dry weight of nodules, and shoot and root dry masses. Pigeon peas responded significantly to inoculation treatment, since all the plants inoculated with Rhizobium strains isolated from cowpea strains showed results similar to plants in the nitrogen control and commercial inoculant treatments. This demonstrates a favorable plant – bacteria interaction, which can be utilized as an alternative nitrogen source for pigeon peas.

Inoculating wheat (Triticum aestivum L.) with the endophytic bacterium Serratia sp. PW7 to reduce pyrene contamination.

Science.gov (United States)

Zhu, Xuezhu; Wang, Wanqing; Sun, Kai; Lin, Xianghao; Li, Shuang; Waigi, Michael Gatheru; Ling, Wanting

2017-08-03

This research was conducted to find an optimal inoculation way for a pyrene-degrading endophytic Serratia sp. PW7 to colonize wheat for reducing pyrene contamination. Three inoculation ways, which are soaking seeds in inocula (TS), dipping roots of seedlings in inocula (TR), and spraying inocula on leaves of seedlings (TL), were used in this study. Inoculated seedlings and noninoculated seedlings (CK) were, respectively, cultivated in Hoagland solutions supplemented with pyrene in a growth chamber. The results showed that strain PW7 successfully colonized the inoculated seedlings in high numbers, and significantly promoted the growth of seedlings (TS and TR). More importantly, strain PW7 reduced pyrene levels in the seedlings and the Hoagland solutions. Compared to the noninoculated seedlings, the pyrene contents of the inoculated seedlings were decreased by 35.7-86.3% in the shoots and by 26.8-60.1% in the roots after 8-day cultivation. By comparing the efficiencies of decreasing pyrene residues, it can be concluded that TR was an optimal inoculation way for endophytic strains to colonize the inoculated plants and to reduce the pyrene contamination. Our findings provide an optimized inoculation way to reduce organic contamination in crops by inoculating plants with functional endophytic bacteria.

Fluorogenic membrane overlays to enumerate total coliforms, Escherichia coli, and total Vibrionaceae in shellfish and seawater

Science.gov (United States)

Three assays were developed to enumerate total coliforms, Escherichia coli, and total Vibrionaceae in shellfish and other foods and in seawater and other environmental samples. Assays involve membrane overlays of overnight colonies on non-selective agar plates to detect ß-glucuronidase and lysyl am...

Posterior open occlusion management by registration of overlay removable partial denture: A clinical report

Science.gov (United States)

Nosouhian, Saeid; Davoudi, Amin; Derhami, Mohammad

2015-01-01

This clinical report describes prosthetic rehabilitation of posterior open bite relationship in a patient with several missing teeth and skeletal Class III malocclusion. Primary diagnostic esthetic evaluations were performed by mounting casts in centric relation and estimating lost vertical dimension of occlusion. Exclusive treatments were designated by applying overlay removable partial denture with external attachment systems for higher retentions. PMID:26929544

Impact of phosphate-solubilizing bacteria inoculation methods on phosphorus transformation and long-term utilization in composting.

Science.gov (United States)

Wei, Yuquan; Zhao, Yue; Fan, Yuying; Lu, Qian; Li, Mingxiao; Wei, Qingbin; Zhao, Yi; Cao, Zhenyu; Wei, Zimin

2017-10-01

This study aimed to assess the effect of phosphate-solubilizing bacteria (PSB) application and inoculation methods on rock phosphate (RP) solubilization and bacterial community during composting. The results showed that PSB inoculation in different stages of composting, especially both in the beginning and cooling stages, not only improved the diversity and abundance of PSB and bacterial community, but also distinctly increased the content of potential available phosphorus. Redundancy analysis indicated that the combined inoculation of PSB in the initial stage with higher inoculation amount and in the cooling stage with lower inoculation amount was the best way to improve the inoculation effect and increase the solubilization and utilization of RP during composting. Besides, we suggested three methods to improve phosphorus transformation and long-term utilization efficiency in composts based on biological fixation of phosphates by humic substance and phosphate-accumulating organisms. Copyright © 2017 Elsevier Ltd. All rights reserved.

The migration law of overlay rock and coal in deeply inclined coal seam with fully mechanized top coal caving.

Science.gov (United States)

Liu, Jian; Chen, Shan-Le; Wang, Hua-Jun; Li, Yu-Cheng; Geng, Xiaowei

2015-07-01

In a mine area, some environment geotechnics problems always occure, induced by mined-out region such as the subsidence and cracks at ground level, deformation and destruction of buildings, landslides destruction of water resources and the ecological environment. In order to research the migration of surrounding rock and coal in steeply inclined super high seams which used fully mechanized top coal caving, a working face of a certain mine was made as an example, analyzed the migration law of the overlay rock and coal under different caving ratio of fully mechanized top coal caving with numerical simulation analysis. The results suggest that the laws of overlay rock deformation caused by deeply inclined coal seam were different from horizontal coal seam. On the inclined direction, with an increase of dip angle and caving ratio, the vertical displacement of overlay rock and coal became greater, the asymmetric phenomenon of vertical displacement became obvious. On the trend direction, active region and transition region in goaf became smaller along with the increase of mining and caving ratio. On the contrary, the stable region area became greater. Therefore, there was an essential difference between the mechanism of surface movement deformation with deeply inclined coal seam and that with horizontal coal seam.

Texas flexible pavements and overlays : year 1 report, test sections, data collection, analyses, and data storage system.

Science.gov (United States)

2012-06-01

This five-year project was initiated to collect materials and pavement performance data on a minimum of 100 highway test sections around the State of Texas, incorporating both flexible pavements and overlays. Besides being used to calibrate and valid...

Overlay cognitive radio systems with adaptive two-way relaying

KAUST Repository

Hyadi, Amal

2013-12-01

In this paper, we propose a spectrum sharing mechanism with a two-phase two-way relaying protocol for an overlay cognitive network. The system comprises two primary users (PUs) and two secondary users (SUs). One of the SUs acts as a relay for the PUs and gains spectrum sharing as long as he respects outage probability constraints of the primary system. Moreover, we consider that the relaying node performs an optimal power allocation scheme that minimizes the outage performance of the secondary receiver. Closed form expressions for the outage probability are derived for the cases of Decode-and-Forward (DF), Amplify-and-Forward (AF), and adaptive relaying. Numerical simulations are presented to illustrate and compare the obtained results. © 2013 IEEE.

Weld overlay cladding with iron aluminides

Energy Technology Data Exchange (ETDEWEB)

Goodwin, G.M. [Oak Ridge National Lab., TN (United States)

1997-12-01

The author has established a range of compositions for these alloys within which hot cracking resistance is very good, and within which cold cracking can be avoided in many instances by careful control of welding conditions, particularly preheat and postweld heat treatment. For example, crack-free butt welds have been produced for the first time in 12-mm thick wrought Fe{sub 3}Al plate. Cold cracking, however, still remains an issue in many cases. The author has developed a commercial source for composite weld filler metals spanning a wide range of achievable aluminum levels, and are pursuing the application of these filler metals in a variety of industrial environments. Welding techniques have been developed for both the gas tungsten arc and gas metal arc processes, and preliminary work has been done to utilize the wire arc process for coating of boiler tubes. Clad specimens have been prepared for environmental testing in-house, and a number of components have been modified and placed in service in operating kraft recovery boilers. In collaboration with a commercial producer of spiral weld overlay tubing, the author is attempting to utilize the new filler metals for this novel application.

Improving Management Performance of P2PSIP for Mobile Sensing in Wireless Overlays

Directory of Open Access Journals (Sweden)

José María Pousada-Carballo

2013-11-01

Full Text Available Future wireless communications are heading towards an all-Internet Protocol (all-IP design, and will rely on the Session Initiation Protocol (SIP to manage services, such as voice over IP (VoIP. The centralized architecture of traditional SIP has numerous disadvantages for mobile ad hoc services that may be possibly overcome by advanced peer-to-peer (P2P technologies initially developed for the Internet. In the context of mobile sensing, P2PSIP protocols facilitate decentralized and fast communications with sensor-enabled terminals. Nevertheless, in order to make P2PSIP protocols feasible in mobile sensing networks, it is necessary to minimize overhead transmissions for signaling purposes, which reduces the battery lifetime. In this paper, we present a solution to improve the management of wireless overlay networks by defining an adaptive algorithm for the calculation of refresh time. The main advantage of the proposed algorithm is that it takes into account new parameters, such as the delay between nodes, and provides satisfactory performance and reliability levels at a much lower management overhead than previous approaches. The proposed solution can be applied to many structured P2P overlays or P2PSIP protocols. We evaluate it with Kademlia-based distributed hash tables (DHT and dSIP.

Improving management performance of P2PSIP for mobile sensing in wireless overlays.

Science.gov (United States)

Sendín-Raña, Pablo; González-Castaño, Francisco Javier; Gómez-Cuba, Felipe; Asorey-Cacheda, Rafael; Pousada-Carballo, José María

2013-11-08

Future wireless communications are heading towards an all-Internet Protocol (all-IP) design, and will rely on the Session Initiation Protocol (SIP) to manage services, such as voice over IP (VoIP). The centralized architecture of traditional SIP has numerous disadvantages for mobile ad hoc services that may be possibly overcome by advanced peer-to-peer (P2P) technologies initially developed for the Internet. In the context of mobile sensing, P2PSIP protocols facilitate decentralized and fast communications with sensor-enabled terminals. Nevertheless, in order to make P2PSIP protocols feasible in mobile sensing networks, it is necessary to minimize overhead transmissions for signaling purposes, which reduces the battery lifetime. In this paper, we present a solution to improve the management of wireless overlay networks by defining an adaptive algorithm for the calculation of refresh time. The main advantage of the proposed algorithm is that it takes into account new parameters, such as the delay between nodes, and provides satisfactory performance and reliability levels at a much lower management overhead than previous approaches. The proposed solution can be applied to many structured P2P overlays or P2PSIP protocols. We evaluate it with Kademlia-based distributed hash tables (DHT) and dSIP.

Hot Corrosion of Inconel 625 Overlay Weld Cladding in Smelting Off-Gas Environment

Science.gov (United States)

Mohammadi Zahrani, E.; Alfantazi, A. M.

2013-10-01

Degradation mechanisms and hot corrosion behavior of weld overlay alloy 625 were studied. Phase structure, morphology, thermal behavior, and chemical composition of deposited salt mixture on the weld overlay were characterized utilizing XRD, SEM/EDX, DTA, and ICP/OES, respectively. Dilution level of Fe in the weldment, dendritic structure, and degradation mechanisms of the weld were investigated. A molten phase formed on the weld layer at the operating temperature range of the boiler, which led to the hot corrosion attack in the water wall and the ultimate failure. Open circuit potential and weight-loss measurements and potentiodynamic polarization were carried out to study the hot corrosion behavior of the weld in the simulated molten salt medium at 873 K, 973 K, and 1073 K (600 °C, 700 °C, and 800 °C). Internal oxidation and sulfidation plus pitting corrosion were identified as the main hot corrosion mechanisms in the weld and boiler tubes. The presence of a significant amount of Fe made the dendritic structure of the weld susceptible to preferential corrosion. Preferentially corroded (Mo, Nb)-depleted dendrite cores acted as potential sites for crack initiation from the surface layer. The penetration of the molten phase into the cracks accelerated the cracks' propagation mainly through the dendrite cores and further crack branching/widening.

Variables affecting viral plaque formation in microculture plaque assays using homologous antibody in a liquid overlay.

Science.gov (United States)

Randhawa, A S; Stanton, G J; Green, J A; Baron, S

1977-05-01

A liquid antibody microculture plaque assay and the variables that govern its effectiveness are described. The assay is based on the principle that low concentrations of homologous antibody can inhibit secondary plaque formation without inhibiting formation of primary plaques. Thus, clear plaques that followed a linear dose response were produced. The assay was found to be more rapid, less cumbersome, and less expensive than assays using agar overlays and larger tissue culture plates. It was reproducible, quantitative, and had about the same sensitivity as the agar overlay technique in measuring infectious coxsackievirus type B-3. It was more sensitive in assaying adenovirus type 3 and Western equine encephalomyelitis, vesicular stomatitis, Semliki forest, Sendai, Sindbis, and Newcastle disease viruses than were liquid, carboxymethylcellulose, and methylcellulose microculture plaque assays. The variables influencing sensitivity and accuracy, as determined by using coxsackievirus type B-3, were: (i) the inoculum volume of virus; (ii) the incubation period of virus; and (iii) the incubation temperature.

Oral rehabilitation of a patient with amelogenesis imperfecta using removable overlay denture: a clinical report.

Science.gov (United States)

Ghodsi, S; Rasaeipour, S; Vojdani, M

2012-03-01

The aim of this study was oral rehabilitation of 17-year old patient with amelogenesis imperfecta using removable overlay denture in order to satisfy her esthetic and functional expectations and enhance her self-image. Amelogenesis imperfecta (AI) is a group of genetic disorders that primarily affect the quality and quantity of amelogenesis in both primary and permanent dentitions. The main clinical characteristics are severe attrition, tooth sensitivity and unesthetic appearance. This clinical report illustrates the oral rehabilitation of a 17-year-old girl with hypoplastic-hypomature type of AI with cobalt-chromium (Co-Cr) overlay removable partial denture (ORPD) that is one of the most economical and biocompatible replacements for noble metal and nickel-chromium (Ni-Cr) alloy. The presented case report suggests that Co-Cr ORPD can be a good temporary or even permanent treatment option for AI patients with limited budget, low esthetic concerns or medical limitations. There are major advantages in cast metal ORPDs; they are simpler, less traumatic and less expensive than fixed prosthetic options. This case report supports their use in patients with amelogenesis imperfecta.

Sputtering of thin benzene and polystyrene overlayers by keV Ga and C60 bombardment

International Nuclear Information System (INIS)

Czerwinski, B.; Delcorte, A.; Garrison, B.J.; Samson, R.; Winograd, N.; Postawa, Z.

2006-01-01

The mechanisms of ion-stimulated desorption of thin organic overlayers deposited on metal substrates by mono- and polyatomic projectiles are examined using molecular dynamics (MD) computer simulations. A monolayer of polystyrene tetramers (PS4) physisorbed on Ag{1 1 1} is irradiated by 15 keV Ga and C 60 projectiles at normal incidence. The results are compared with the data obtained for a benzene overlayer to investigate the differences in sputtering mechanisms of weakly and strongly bound organic molecules. The results indicate that the sputtering yield decreases with the increase of the binding energy and the average kinetic energy of parent molecules is shifted toward higher kinetic energy. Although the total sputtering yield of organic material is larger for 15 keV C 60 , the impact of this projectile leads to a significant fragmentation of ejected species. As a result, the yield of the intact molecules is comparable for C 60 and Ga projectiles. Our data indicate that chemical analysis of the very thin organic films performed by detection of sputtered neutrals will not benefit from the use of C 60 projectiles

Characterization of the fecal microbiota of pigs before and after inoculation with "Brachyspira hampsonii".

Directory of Open Access Journals (Sweden)

Matheus O Costa

Full Text Available "Brachyspira hampsonii" causes disease indistinguishable from swine dysentery, and the structure of the intestinal microbiome likely plays a role in determining susceptibility of individual pigs to infection and development of clinical disease. The objectives of the current study were to determine if the pre-inoculation fecal microbiota differed between inoculated pigs that did (INOC MH or did not (INOC non-MH develop mucohaemorrhagic diarrhea following challenge with "B. hampsonii", and to quantify changes in the structure of the microbiome following development of clinical disease. Fecal microbiota profiles were generated based on amplification and sequencing of the cpn60 universal target sequence from 89 samples from 18 pigs collected at -8, -5, -3 and 0 days post-inoculation, and at termination. No significant differences in richness, diversity or taxonomic composition distinguished the pre-inoculation microbiomes of INOC MH and INOC non-MH pigs. However, the development of bloody diarrhea in inoculated pigs was associated with perturbation of the microbiota relative to INOC non-MH or sham-inoculated control pigs. Specifically, the fecal microbiota of INOC MH pigs was less dense (fewer total 16S rRNA copies per gram of feces, and had a lower Bacteroidetes:Firmicutes ratio. Further investigation of the potential long-term effects of Brachyspira disease on intestinal health and performance is warranted.

SEED INOCULATION WITH Azospirillum brasilense, ASSOCIATED WITH THE USE OF BIOREGULATORS IN MAIZE

Directory of Open Access Journals (Sweden)

ALESSANDRO DE LUCCA E BRACCINI

2012-01-01

Full Text Available The inoculation of seeds with the bacterium Azospirillum has been carried out in maize culture and other grasses. The application of growth bio-regulators is another technology whose results in maize culture have yet to become more widespread. Current study evaluates the agronomic effectiveness of seed inoculation with Azospirillum brasilense in maize, associated with the use of the growth regulator Stimulate ®. Triple hybrid maize CD 304 underwent the following treatments: 1 - control without nitrogen and without Azospirillum brasilense; 2 - Treatment without nitrogen but with Azospirillum brasilense; 3 - Treatment without nitrogen but with Azospirillum brasilense + Stimulate ®; 4 - Treatment with 50% of nitrogen dose recommended for maize culture; 5 - Treatment with 50% of nitrogen dose and inoculation with Azospirillum brasilense; 6 - Same as 5 but with Stimulate ®; 7 - Total N recommended; 8 - Total N recommended + Azospirillum brasilense ; 9 - Total N recommended + Azospirillum brasilense + Stimulate ®. The inoculation of maize seeds with Azospirillum brasilense increases plant height and grain yield when compared with rates in control. The use of 50% of N dose in sowing, associated with the inoculation of maize seeds with Azospirillum brasilense at 200 mL ha-1 (mixed to the seeds and associated with Stimulate ® (in foliar application, is viable.

Plant yield and nitrogen content of a digitgrass in response to azospirillum inoculation

Energy Technology Data Exchange (ETDEWEB)

Schank, S.C.; Weier, K.L.; MacRae, I.C.

1981-02-01

Two Australian soils, a vertisol (pH 6.8, 0.299% N) and a sandy yellow podzol (pH 6.2, 0.042% N), were used with digitgrass, Digitaria sp. X46-2 (PI 421785), in a growth room experiment. Comparisons were made between plants inoculated with live and autoclaved bacterial suspensions of Australian and Brazilian isolates of Azospirillum brasilense. Seedlings were inoculated on days 10 and 35. Acetylene-reducing activity was measured five times during the experiment. Dry matter yields of the digitgrass on the podzol (low N) inoculated with liver bacteria were 23% higher than those of the controls. On the vertisol (high N), yield increases from inoculation with live bacteria were 8.5%. The higher-yielding plants had significantly lower precent nitrogen, but when total nitrogen of the tops was calculated, the inoculated plants had a higher total N than did the controls (P = 0.04). Acetylene-reducing activity was variable in the experiment, ranging from 0.5 to 11.9 mu mol of C2H2 core -1 day -1. Live bacterial treatment induced a proliferation of roots, possible earlier maturity, higher percent dry matter, and a higher total N in the tops. (Refs. 21).

Immunity to infection with porcine parvovirus in pigs inoculated with the attenuated HT- strain.

Science.gov (United States)

Fujisaki, Y; Murakami, Y

1982-01-01

Swine were inoculated once with the attenuated HT- strain of porcine parvovirus. Several months later they were challenged by oral inoculation with a field strain of the virus to examine an ability to prevent infection. After challenge inoculation unimmunized control swine exhibited an increase in antibody titer, viremia, and virus discharge. The virus was recovered from many organs. The swine preinoculated with the attenuated HT- strain, however, manifested none of these symptoms and were negative for virus recovery from any organ.

Inoculation of maize with Azospirillum brasilense in the seed furrow

Directory of Open Access Journals (Sweden)

Tâmara Prado de Morais

2016-06-01

Full Text Available ABSTRACT Several studies addressing the inoculation of cereals with diazotrophic microorganisms can be found in the literature. However, in many experiments, investigators have overlooked the feasibility of applying these microorganisms to the furrow together with the seed, and the effect of bacterial concentration on phytostimulation. The aim of this work was to evaluate the effect of doses of an inoculant based on Azospirillum brasilense, applied to the seed furrow when planting maize, combined with different doses of nitrogen fertiliser. The experiment was carried out in the field, in soil of the cerrado region of Brazil. An experimental design of randomised blocks in bands was adopted, comprising nitrogen (40, 100, 200 and 300 kg ha-1 and doses of an A. brasilense-based liquid inoculant applied to the seed furrow (0, 100, 200, 300 and 400 mL ha-1. The dose of 200 mL ha-1Azospirillum was noteworthy for grain production. This is the first report of the effective application of Azospirillum in the seed furrow when planting maize in the cerrado region of Brazil.

Effects of bacterial inoculation on the fermentation characteristics ...

African Journals Online (AJOL)

DNkosi

2016-05-11

May 11, 2016 ... The chopped forages were treated with or without the bacterial .... packed loosely in an open plastic jar, which was covered with two ..... be because LD inoculant contains enzymes that may be capable of degrading fibre.

METHODS FOR INOCULATION WITH Fusarium guttiforme AND GENETIC RESISTANCE OF PINEAPPLE ( Ananas comosus var. comosus )

OpenAIRE

WANDREILLA MOREIRA GARCIA; WILLIAN KRAUSE; DEJÂNIA VIEIRA DE ARAÚJO; ISANE VERA KARSBURG; RIVANILDO DALLACORT

2017-01-01

The objective of this work was to evaluate Fusarium guttiforme inoculation methods and genetic resistance of pineapple accessions. Thus, three experiments were conducted: pathogen inoculation of different leaf types ( B, D and F ) of pineapple (1), pathogen inoculation of pineapple cuttings and detached D leaves (2), and identification of resistance to fusariosis in 19 pineapple accessions (3) sampled in the State of Mato Grosso, Brazil. The cultivars Pérola (susceptible...

Zika virus preferentially replicates in the female reproductive tract after vaginal inoculation of rhesus macaques.

Science.gov (United States)

Carroll, Timothy; Lo, Ming; Lanteri, Marion; Dutra, Joseph; Zarbock, Katie; Silveira, Paola; Rourke, Tracy; Ma, Zhong-Min; Fritts, Linda; O'Connor, Shelby; Busch, Michael; Miller, Christopher J

2017-07-01

Zika virus (ZIKV) is a mosquito-transmitted virus that can cause severe defects in an infected fetus. ZIKV is also transmitted by sexual contact, although the relative importance of sexual transmission is unclear. To better understand the role of sexual transmission in ZIKV pathogenesis, a nonhuman primate (NHP) model of vaginal transmission was developed. ZIKV was readily transmitted to mature cycling female rhesus macaque (RM) by vaginal inoculation with 104-106 plaque-forming units (PFU). However, there was variability in susceptibility between the individual RM with 1->8 vaginal inoculations required to establish infection. After treatment with Depoprovera, a widely used contraceptive progestin, two RM that initially resisted 8 vaginal ZIKV inoculations became infected after one ZIKV inoculation. Thus, Depoprovera seemed to enhance susceptibility to vaginal ZIKV transmission. Unexpectedly, the kinetics of virus replication and dissemination after intravaginal ZIKV inoculation were markedly different from RM infected with ZIKV by subcutaneous (SQ) virus inoculation. Several groups have reported that after SQ ZIKV inoculation vRNA is rapidly detected in blood plasma with vRNA less common in urine and saliva and only rarely detected in female reproductive tract (FRT) secretions. In contrast, in vaginally inoculated RM, plasma vRNA is delayed for several days and ZIKV replication in, and vRNA shedding from, the FRT was found in all 6 animals. Further, after intravaginal transmission ZIKV RNA shedding from FRT secretions was detected before or simultaneously with plasma vRNA, and persisted for at least as long. Thus, ZIKV replication in the FRT was independent of, and often preceded virus replication in the tissues contributing to plasma vRNA. These results support the conclusion that ZIKV preferentially replicates in the FRT after vaginal transmission, but not after SQ transmission, and raise the possibility that there is enhanced fetal infection and pathology

Spatial reversal learning in preclinical scrapie-inoculated mice.

Science.gov (United States)

Lysons, A M; Woollard, S J

1996-04-10

Acquisition and reversal of a two-choice spatial discrimination were tested in scrapie-inoculated mice. Both acquisition and reversal were normal in mice tested 138 and 103 days prior to the onset of clinical symptoms. At 65 days before onset of clinical symptoms, scrapie-inoculated mice required more trails to criterion in reversal learning, but this effect was not significant in a second experiment (68 days preclinical) and was transient: no effect was seen 33 days before symptoms. However, the course of reversal learning was abnormal in all three late preclinical groups (68, 65 and 33 days before symptoms). Reversal learning in these three groups was characterized by a rapid extinction of the original discrimination, followed by a period, absent in controls, during which performance showed no further improvement. This effect corresponds in time of onset to the appearance of characteristic neuropathological features.

Enhancement of Cotton Stalks Composting with Certain Microbial Inoculations

Directory of Open Access Journals (Sweden)

Osama Abdel-Twab Seoudi

2013-01-01

Full Text Available Effect of inoculation with Phanerochaete chrysosporium and Azotobacter chrococcum microbes on cotton stalks composting was studied in an attempt to achieve rapid maturity and desirable characteristics of produced compost. Composting process was maintained for 16 weeks under aerobic conditions with proper moisture content and turning piles. The C/N ratio of the mixtures was adjusted to about 30:1 before composting using chicken manure. Temperature evolution and its profile were monitored throughout the composting period. Mineralization rates of organic matter and changes in nitrogen content during composting stages were evaluated. Total plate count of mesophilic and thermophilic bacteria, cellulose decomposers and Azotobacter were determined during composting periods. The treatment of cotton stalks inoculated with both P. chrysosporium and Azotobacter gave the most desirable characteristics of the final product with respect to the narrow C/N ratio, high nitrogen content and high numbers of Azotobacter. The phytotoxicity test of compost extracts was evaluated. The use of P. chrysosporium in composting accelerated markedly decomposition process, so that 16 weeks composting enough to produce a stable and mature compost suitable for use as fertilizer while the fertilizer obtained by composting cotton stalks mixed with chicken manure and inoculated with microorganisms is highest quality Compost.

Influence of arbuscular mycorrhizal fungi, rhizobium inoculation and rock phosphate on growth and quality of lentil

International Nuclear Information System (INIS)

Yaseen, T.; Ali, K.

2016-01-01

Effective inoculation of legumes has the ability not only to ensure nutrients availability to plants particularly in N and P-limiting (due to improvement in nutrients fixation) environments but also can manipulate the environmental hazards associated with over inorganic fertilization. To support this view, the current experiment was conducted to study the influence of rock phosphorus fertilization, Arbuscular Mycorrhizae (AM) and Rhizobium inoculation on growth and yield parameters of Lens culinaris (NARC.2008-4). In addition, the current experiments aimed to evaluate the effect of different inoculation practices on crop quality in comparison with control (no inoculation).The experiment was laid out in randomized complete block design with four replications during winter (2010-11 and 2012-13) at the Department of Botany University of Peshawar Pakistan. Overall, inoculated plant performed superior in terms of plant growth and quality over control. All plants measured parameters (Leaf chlorophyll content, seed protein, fiber and ash content, plant height, number of seed pod-1, leaves plant-1, flowers plant-1, pods plant-1, pod length and thousand seed weight) were highest in plant samples inoculated with VAM and Rhizobium in combination as compared to sole application of VAM or Rhizobium. Combined inoculation of VAM and Rhizobium caused 10, 24, 17, 21 and 14% increase in seed protein content, leaf chlorophyll content, seed fiber content, seed ash content and number of seed pod-1 over sole application of VAM and Rhizobium when averaged over two years. Combined application of Rhizobium + VAM enhanced seed yield plant-1 by 45% over control and 24% and 28% over sole inoculation of VAM and Rhizobium respectively. It is therefore concluded that dual inoculation of VAM + Rhizobium and rock phosphate may be of only limited consequence in high input agricultural systems. (author)

Sequential mesenteric arteriography in pony foals during repeated inoculations of Strongylus vulgaris and treatments with ivermectin.

Science.gov (United States)

Holmes, R A; Klei, T R; McClure, J R; Turk, M A; Watters, J W; Chapman, M R

1990-04-01

Semiselective mesenteric arteriography was performed at regular intervals (inoculation weeks [IW] 0, 11, 18, and 24) in 9 of 10 pony foals raised to be free of parasites. Fifty infective larvae (L3) of Strongylus vulgaris were administered weekly for 4 weeks, then every 2 weeks through the 20th week. Three ponies were given ivermectin (oral paste, 0.2 mg/kg of body weight) treatment at IW 8, 16 and 24. Four ponies were inoculated, but did not receive ivermectin, and a third group of 2 ponies acted as uninoculated controls. Control ponies did not have gross or arteriographic lesions, whereas the inoculated untreated ponies had gross and progressive arteriographic lesions typical of verminous arteritis. Arteriographic lesions in the ivermectin-treated inoculated ponies were not as severe those in the untreated inoculated group, and there was either a partial resolution or a lack of progression of arteriographic lesions in all treated ponies. One untreated inoculated pony did not have progressive arterial lesions as did the 3 others in the group, and may develop resistance to the parasite.

Adoption of Calliandra calothyrsus for fodder and it's Inoculation Potential on Farms in Kenya

International Nuclear Information System (INIS)

Kiptot, E; Wanjiku, J; Obonyo, E; Odee, D.W

2007-01-01

In Kenya, productivity of dairy animals is mostly limited by inadequate nutrition especially proteins. To improve feed quality, the use of fodder trees is a preferred option. One of the most widely used fodder tree is calliandra calothyrsus (calliandra) whose productivity can be improved through rhizobia inoculation. A study was initiated to assess farmers' management practices and utilization of calliandra as well as to elicit their knowledge on it's inoculation. Survey sites were identified were identified in areas where calliandra had been previously introduced in central and western regions of Kenya. Results indicated that, for the first establishment of calliandra trees (NGOs) 68.3% of the farmers acquired seedlings from research institutions as well as Non-Governmental Organizations (NGOs) working within the research area. During subsequent establishments, reported only in central region a reverse trend was observed with 73% of farmers acquiring seedlings from private and individual nurseries. A majority of farmers (56%) planted calliandra on contours and 78% used it for fodder, while 22% had no knowledge of food potential. About 41% of farmers from central region had planted inoculated seedlings and only 1.6% from the western region had inoculants. Though the inoculant had been provided free, 47% of the farmers were willing to purchase it if made available. In central region calliandra was highly utilized for dairy animals consequently motivating farmers to expand planting. Contour planting was preferred niche due to the perceived low competition with associate crops for space and growth parameters. The study concluded that though calliandra was accepted as a fodder tree, a knowledge gap existed on farms on the role of rhizobia inoculation in productivity. There is therefore an urgent need to sensitize on the benefits of inoculation

Decoupling of Solid 4He Layers under the Superfluid Overlayer

Science.gov (United States)

Ishibashi, Kenji; Hiraide, Jo; Taniguchi, Junko; Suzuki, Masaru

2018-03-01

It has been reported that in a large oscillation amplitude, the mass decoupling of multilayer 4He films adsorbed on graphite results from the depinning of the second solid atomic layer. This decoupling suddenly vanishes below a certain low temperature TD due to the cancellation of mass decoupling by the superfluid counterflow of the the overylayer. We studied the relaxation of the depinned state at various temperatures, after reduction of oscillation amplitude below TD . It was found that above the superfluid transition temperature the mass decoupling revives with a relaxation time of several 100 s. It strongly supports that the depinned state of the second solid atomic layer remains underneath the superfluid overlayer.

Critical temperatures of random iron–cobalt overlayers on the fcc-Cu(001) substrate

Czech Academy of Sciences Publication Activity Database

Mašín, Martin; Bergqvist, L.; Kudrnovský, Josef; Kotrla, Miroslav; Drchal, Václav

2013-01-01

Roč. 26, č. 4 (2013), s. 809-812 ISSN 1557-1939. [International Conference on Superconductivity and Magnetism (ICSM) /3./. Istanbul, 29.04.2012-04.05.2012] R&D Projects: GA ČR GA202/09/0775 Institutional support: RVO:68378271 Keywords : Curie temperature * random overlayer * Heisenberg Hamiltonian * first principles * Monte Carlo simulations Subject RIV: BE - Theoretical Physics Impact factor: 0.930, year: 2013 http://link.springer.com/article/10.1007/s10948-012-2084-1

Tiller density and tillering on Brachiaria brizantha cv. Marandu pastures inoculated with Azospirillum brasilense

Directory of Open Access Journals (Sweden)

B.C. Pedreira

Full Text Available ABSTRACT The objective of this study is to verify the population density and the dynamics of tillering in the Marandu palisade grass sward subjected to nitrogen (N fertilization strategies, characterized by the N supply via urea or bacterial inoculant (Azospirillum brasilense. The treatments comprised of four nitrogen fertilization strategies: (A Without fertilization, (B 80 kg N/ha, (C inoculant (A. brasilense, and (D 80 kg N/ha + inoculant, distributed in a randomized complete block design, with three replications. The nitrogen supply strategies were evaluated during six periods: October, November, and December (2012 as well as January, March, and April (2013. The nitrogen dose or inoculant had no effect on the tiller appearance rate (TAR, tiller mortality rate (TMR, tiller survival rate (TSR, or tiller population density (TPD. However, these variables were influenced by the season. The TAR and TSR were higher at the beginning of the experimental period (October and lower towards the end of the period (March-April, whereas, TMR and TPD exhibited the opposite behavior, with lower values in October and higher from January onward. Neither the nitrogen nor the inoculant influenced the population dynamics of the tillers in Marandu palisade grass.

Cropping systems sustainability: Inoculation and fertilisation effect on sulla performances in a new cultivation area

Directory of Open Access Journals (Sweden)

Leonardo Sulas

2017-12-01

Full Text Available To assess the feasibility of the sulla [Sulla coronaria (L. Medik] forage legume in a new agroecosystem, its host-specific symbiotic interaction needs to be taken into account. This study aimed to investigate the effects of inoculation and nitrogen (N fertiliser on productive performances and N-fixation ability of sulla established in a new habitat within a Mediterranean agropastoral area. Sulla plants, previously inoculated (with peat-based, liquid inoculants, and using soil from an existing sulla field and unfertilised or N fertilised were evaluated in Sardinia (Italy. During 2013-2014, sulla plants were sampled at four growing stages, from vegetative stage to seed set, and shoot length, shoot dry matter (DM yield and N content were monitored. Moreover, atom% 15N isotopic excess, proportion of N derived from the atmosphere and fixed N of sulla shoots were quantified. Inoculation and N fertilisation both affected growth, DM and N yields, and N-fixation of sulla. Compared to the best inoculated treatment, the DM yield and fixed N of the control only represented 10 to 22% and 2 to 11%, respectively. Nitrogen fertilisation caused temporary decreases in the N fixing ability of sulla. Results pointed out that rhizobial inoculation is essential for the exploitation of sulla outside its traditional cropping area.

METHODS FOR INOCULATION WITH Fusarium guttiforme AND GENETIC RESISTANCE OF PINEAPPLE ( Ananas comosus var. comosus

Directory of Open Access Journals (Sweden)

WANDREILLA MOREIRA GARCIA

2017-01-01

Full Text Available The objective of this work was to evaluate Fusarium guttiforme inoculation methods and genetic resistance of pineapple accessions. Thus, three experiments were conducted: pathogen inoculation of different leaf types ( B, D and F of pineapple (1, pathogen inoculation of pineapple cuttings and detached D leaves (2, and identification of resistance to fusariosis in 19 pineapple accessions (3 sampled in the State of Mato Grosso, Brazil. The cultivars Pérola (susceptible to fusariosis and BRS - Vitória (resistant to fusariosis were used as controls. The fusariosis severity was evaluated at 10, 15, 20, 25 and 30 days after inoculation with F. guttiforme . The lesion diameters (severity level were used in order to calculate the area under the disease progress curve (AUDPC. The inoculation of detached D leaves was the most efficient, fast and inexpensive method, and the one that most satisfactorily reproduced the disease symptoms. The period of 10 to 20 days after inoculation of the D detached leaves with the pathogen is the most suitable to evaluate the resistance of pineapple accessions to fusariosis. The lowest lesion area and AUDPC was found in the accession 1, in all evaluations. Thus, the accession 1 can be used in pineapple breeding programs for resistance to fusariosis.

Growth response and nutrient uptake of blue pine (Pinus wallichiana seedlings inoculated with rhizosphere microorganisms under temperate nursery conditions

Directory of Open Access Journals (Sweden)

M.A. Ahangar

2012-11-01

Full Text Available Microbial inoculants (Trichoderma harzianum, Pseudomonas fluorescens,Laccaria laccata inoculated either individually or in combinationsignificantly improved the growth and biomass of blue pine seedlings. The ECM fungus Laccaria laccata, when inoculated individually, showed significantly higher plant growth, followed by Pseudomonas fluorescens and Trichoderma harzianum. The combined inoculation of rhizosphere microorganisms showed synergistic growth promoting action and proved superior in enhancing the growth of blue pine than individual inoculation. Co-inoculation of L. laccata with P. fluorescens resulted in higher ectomycorrhizal root colonization. Uptake of nutrients (N, P, K was significantly improved by microbial inoculants, tested individually or in combination. Combined inoculation of L. laccata with T. harzianum and P. fluorescens significantly increased in N, P and K contents in blue pine seedlings as compared to control. Acid phosphatase activity in the rhizosphere of blue pine seedlings was also enhanced by these microorganisms. L. laccata exhibited higher acid phosphatase activity followed by P. fluorescens.

Clinical Applications of a CT Window Blending Algorithm: RADIO (Relative Attenuation-Dependent Image Overlay).

Science.gov (United States)

Mandell, Jacob C; Khurana, Bharti; Folio, Les R; Hyun, Hyewon; Smith, Stacy E; Dunne, Ruth M; Andriole, Katherine P

2017-06-01

A methodology is described using Adobe Photoshop and Adobe Extendscript to process DICOM images with a Relative Attenuation-Dependent Image Overlay (RADIO) algorithm to visualize the full dynamic range of CT in one view, without requiring a change in window and level settings. The potential clinical uses for such an algorithm are described in a pictorial overview, including applications in emergency radiology, oncologic imaging, and nuclear medicine and molecular imaging.

Technical and economic viability of co-inoculation with Azospirillum brasilense in soybean cultivars in the Cerrado

Directory of Open Access Journals (Sweden)

Fernando S. Galindo

Full Text Available ABSTRACT Biological nitrogen fixation (BNF efficiency can be increased by co-inoculation with bradyrhizobia and Azospirillum brasilense, allowing even greater uptake of water and nutrients, leading to higher yields. Thus, this study aimed to evaluate the technical and economic viability of soybean in the Cerrado, according to the cultivars and co-inoculation with Azospirillum brasilense. The experiment was conducted in Selvíria, MS, in no-tillage system, in Oxisol, arranged in a randomized block design in a 2 x 2 factorial scheme with two cultivars (‘Potência’ and ‘Valiosa’, with and without co-inoculation with Azospirillum brasilense in the seed. Co-inoculation with A. brasilense increases grain yield in the cultivars ‘Potência’ and ‘Valiosa’, being economically viable. However, using the cultivar ‘Potência’ co-inoculated led to the highest profitability.

Coping With Pain: Studies in Stress Inoculation.

Science.gov (United States)

Horan, John J.; And Others

The stress-inoculation paradigm for helping clients deal with pain consists of education about the psychological dimensions of pain, training in a number of coping skills relevant to each dimension, and practice in applying these skills to the noxious stimulus. Presented are two studies, the first of which represents a component analysis of stress…

Analysis of the effect of diluent for rehydration of PoulVac MycoF on vaccination seroconversion results

Science.gov (United States)

Direct eye drop vaccination of poultry using live Mycoplasma gallisepticum vaccines provides the most efficient route of vaccination. The research reported in this study examines the effect of diluent used to rehydrate lyophilized M. gallisepticum vaccines on its ability to induce a measurable humo...

Improvement of Faba Bean Yield Using Rhizobium/Agrobacterium Inoculant in Low-Fertility Sandy Soil

Directory of Open Access Journals (Sweden)

Sameh H. Youseif

2017-01-01

Full Text Available Soil fertility is one of the major limiting factors for crop’s productivity in Egypt and the world in general. Biological nitrogen fixation (BNF has a great importance as a non-polluting and a cost-effective way to improve soil fertility through supplying N to different agricultural systems. Faba bean (Vicia faba L. is one of the most efficient nitrogen-fixing legumes that can meet all of their N needs through BNF. Therefore, understanding the impact of rhizobial inoculation and contrasting soil rhizobia on nodulation and N2 fixation in faba bean is crucial to optimize the crop yield, particularly under low fertility soil conditions. This study investigated the symbiotic effectiveness of 17 Rhizobium/Agrobacterium strains previously isolated from different Egyptian governorates in improving the nodulation and N2 fixation in faba bean cv. Giza 843 under controlled greenhouse conditions. Five strains that had a high nitrogen-fixing capacity under greenhouse conditions were subsequently tested in field trials as faba bean inoculants at Ismaillia Governorate in northeast Egypt in comparison with the chemical N-fertilization treatment (96 kg N·ha−1. A starter N-dose (48 kg N·ha−1 was applied in combination with different Rhizobium inoculants. The field experiments were established at sites without a background of inoculation under low fertility sandy soil conditions over two successive winter growing seasons, 2012/2013 and 2013/2014. Under greenhouse conditions, inoculated plants produced significantly higher nodules dry weight, plant biomass, and shoot N-uptake than non-inoculated ones. In the first season (2012/2013, inoculation of field-grown faba bean showed significant improvements in seed yield (3.73–4.36 ton·ha−1 and seed N-yield (138–153 Kg N·ha−1, which were higher than the uninoculated control (48 kg N·ha−1 that produced 2.97 Kg·ha−1 and 95 kg N·ha−1, respectively. Similarly, in the second season (2013

Bacterial and fungal communities of wilted Italian ryegrass silage inoculated with and without Lactobacillus rhamnosus or Lactobacillus buchneri.

Science.gov (United States)

Li, Y; Nishino, N

2011-04-01

To understand the effects of lactic acid bacteria (LAB) inoculation on fermentation products, aerobic stability and microbial communities of silage. Wilted Italian ryegrass was stored in laboratory silos with and without inoculation of Lactobacillus rhamnosus and Lactobacillus buchneri. The silos were opened after 14, 56 and 120 days and then subjected to aerobic deterioration for 7 days. Intensive alcoholic fermentation was found in untreated silage; the sum of ethanol and 2,3-butanediol content at day 14 was about 7 times higher than that of lactic and volatile fatty acids. Alcoholic fermentation was suppressed by L. rhamnosus and L. buchneri inoculation and lactic acid and acetic acid became the dominant fermentation products, respectively. Silages were deteriorated in untreated and L. rhamnosus-inoculated silages, whereas no spoilage was found in L. buchneri-inoculated silage. Enterobacteria such as Erwinia persicina, Pantoea agglomerans and Rahnella aquatilis were detected in untreated silage, whereas some of these bacteria disappeared or became faint with L. rhamnosus treatment. When silage was deteriorated, Lactobacillus brevis and Bacillus pumilus were observed in untreated and L. rhamnosus-inoculated communities, respectively. The inoculated LAB species was detectable in addition to untreated bacterial communities. Saccharomyces cerevisiae and Pichia anomala were the main fungi in untreated and L. rhamnosus-inoculated silages; however, P. anomala was not visibly seen in L. buchneri-inoculated silage either at silo opening or after exposure to air. Inoculation with L. rhamnosus can suppress alcoholic fermentation of wilted grass silage with elimination of enterobacteria at the beginning of fermentation. Addition of L. buchneri may improve aerobic stability, with distinct inhibitory effect observed on P. anomala after silo opening. Bacterial and fungal community analyses help us to understand how inoculated LAB can function to improve the fermentation and

Effect of seed inoculation with Azospirillum brasilense and nitrogen fertilization rates on maize plant yield and silage quality

Directory of Open Access Journals (Sweden)

Fernando Reimann Skonieski

Full Text Available ABSTRACT The objective of this study was to determine the effect of Azospirillum brasilense inoculation and different nitrogen (N rates applied as topdressing on the productivity of a maize crop and the nutritional value of maize silage. Two experiments were conducted in the 2012/2013 and 2013/2014 harvests. Treatments were distributed in a randomized block design in a factorial arrangement, which consisted of two maize hybrids (AS 1572 and Defender coupled with nitrogen rates (0, 60, 120, 240, and 480 kg ha-1, inoculated or uninoculated with A. brasilense. Inoculated seeds were treated with the A. brasilense strains Ab-V5 and Ab-V6. Inoculation with A. brasilense showed interaction with the hybrids, agricultural years, and nitrogen rates for the maize plant yield. In the 2012/2013 agricultural year, inoculation increased the AS 1572 hybrid silage yield by 6.16% and, in the 2013/2014 harvest, A. brasilense inoculation produced an increase of 16.15% for the Defender hybrid. Nitrogen fertilization applied at 0, 60, and 120 kg ha-1 N benefited the plants inoculated with A. brasilense. The statistical equations revealed that N rates between 0 and 184 kg ha-1 in A. brasilense inoculated plants raised the plant productivity for silage when compared with the control plants. Regarding the nutritional value of the silage, inoculation with A. brasilense increased the ether extract levels and total digestible nutrients and reduced the amount of acid detergent fiber. For all this, positive results with inoculation for silage yield are dependent on nitrogen fertilization rate. Inoculation with A. brasilense can promote changes in the maize silage quality, but with obtained results it is not possible to definitely conclude upon nutritive value of maize silage.

Characterization of the Interface of an Alloy 625 Overlay on Steels Using Nanoindentation

Science.gov (United States)

Dai, Tao; Lippold, John

2018-06-01

Industry standards require postweld heat treatment (PWHT) to reduce the heat-affected zone hardness of steels such as F22 (2.25Cr-1Mo) and AISI 8630 overlaid (clad) with Alloy 625 weld metal. PWHT results in carbon diffusion and accumulation at the interface between the steel and overlay. The accumulation of carbon in a planar solidification growth zone adjacent to the fusion boundary results in high hardness and the potential for hydrogen-assisted cracking. The planar growth zone (PGZ) is so narrow that normal Vickers hardness testing cannot fully reveal the hardness distribution in this zone. This study focused on the application of nanoindentation to characterize the hardness in the narrow microstructural regions adjacent to the fusion boundary. The development of nanohardness maps revealed that the PGZ is not necessarily the region that exhibits peak hardness after PWHT. The highest hardness values were associated with clusters of M7C3 carbides in specific subregions in the PGZ and also in the partially-mixed zone adjacent to the fusion boundary or in steel "swirl" structures. It was also confirmed in this study that nanohardness has a linear correlation with Vickers hardness values. The results presented here provide new insight into the role of carbon diffusion during PWHT and its effect on interface embrittlement associated with Alloy 625 overlays on steel.

Evaluation of the Capacity of PCR and High-Resolution Melt Curve Analysis for Identification of Mixed Infection with Mycoplasma gallisepticum Strains.

Directory of Open Access Journals (Sweden)

Seyed A Ghorashi

Full Text Available Pathogenicity and presentation of Mycoplasma gallisepticum (MG infection may differ from one strain to another and this may have implications on control measures. Infection of individual birds with more than one MG strain has been reported. A PCR followed by high resolution melt (HRM curve analysis has been developed in our laboratory and routinely used for detection and differentiation of MG strains. However the potential of this test for identification of MG strains in a mixed specimen has not been evaluated. In the present study, the capability of PCR-HRM curve analysis technique, targeting vlhA and pvpA genes was assessed for identification of individual MG strains in a mixed population. Different DNA ratios of two MG strains from 1 to 10(-4 ng were tested with some generated conventional and normalized curves distinct from those of individual strains alone. Using genotype confidence percentages (GCP generated from HRM curve analysis, it was found that vlhA PCR-HRM was more consistent than pvpA PCR-HRM for the detection of MG ts-11 vaccine strain mixed with any of the MG strains 6/85, F, S6 or a field isolate. The potential of vlhA PCR-HRM to detect mixed MG strains in a specimen was found to be primarily dependent on quantity and proportion of the target DNAs in the mixture. This is the first study examining the capacity of PCR-HRM technique for identification of individual MG strains in a mixed strain population.

Inoculation, colonization and distribution of fungal endophytes in ...

African Journals Online (AJOL)

Mo

and for a part or whole of their life cycle live symptomlessly within the plant. ... inoculated in tissue culture banana plants, must occur at high frequencies in the plant and be able to persist in ... For instance, the influence of fungal endophytes.

Pavement structure mechanics response of flexible on semi-flexible overlay that based on the old cement concrete pavement damage

Directory of Open Access Journals (Sweden)

Jiang Ruinan

2015-01-01

Full Text Available The old cement pavement damage status directly affect the design of the paving renovation. Based on the state of the old road investigation, combined with the research data at home and abroad, use the control index that average deflection, deflection value and CBR value to determine the reasonable time to overlay. Draw up the typical pavement structure according to the principle of combination of old cement pavement overlay structure design, and calculated that the tensile stress and shear stress in asphalt layer ,semi-flexible layer and the tensile in the old cement pavement adopting BISA3.0 statics finite element analysis model when modulus in the old road was diminishing. Use the computed result to analyses the influence of old road damage condition the influence of pavement structure.

Evaluation of spray and point inoculation methods for the phenotyping of Puccinia striiformis on wheat

DEFF Research Database (Denmark)

Sørensen, Chris Khadgi; Thach, Tine; Hovmøller, Mogens Støvring

2016-01-01

flexible application procedure for spray inoculation and it gave highly reproducible results for virulence phenotyping. Six point inoculation methods were compared to find the most suitable for assessment of pathogen aggressiveness. The use of Novec 7100 and dry dilution with Lycopodium spores gave...... for the assessment of quantitative epidemiological parameters. New protocols for spray and point inoculation of P. striiformis on wheat are presented, along with the prospect for applying these in rust research and resistance breeding activities....

Arbuscular mycorrhizal inoculation of peanut in low-fertile tropical soil : I. Host-fungus compatibility

NARCIS (Netherlands)

Quilambo, OA; Weissenhorn, I.; Kuiper, P.J C; Stulen, I.

2005-01-01

The effects of inoculation with an indigenous Mozambican and a commercial arbuscular mycorrhizal (AM) inoculant on two peanut (Arachis hypogaea L.) cultivars, a traditional, low-yielding Mozambican landrace (Local) and a modern, high-yielding cultivar (Falcon), were tested in a non-sterile and

Hypothalamic-Pituitary-Adrenal Axis Physiology and Cognitive Control of Behavior in Stress Inoculated Monkeys

Science.gov (United States)

Parker, Karen J.; Buckmaster, Christine L.; Lindley, Steven E.; Schatzberg, Alan F.; Lyons, David M.

2012-01-01

Monkeys exposed to stress inoculation protocols early in life subsequently exhibit diminished neurobiological responses to moderate psychological stressors and enhanced cognitive control of behavior during juvenile development compared to non-inoculated monkeys. The present experiments extended these findings and revealed that stress inoculated…

Effect of different substrates on growth of Mimosa bimucronata seedlings inoculate with rhizobium

Directory of Open Access Journals (Sweden)

Juliana Müller Freire

2017-06-01

Full Text Available The objective of this study was to evaluate the growth response of Mimosa bimucronata (DC O. Kuntze seedlings in nursery conditions to inoculation with rhizobium strains previously selected using different substrates. An experimental design of randomized blocks with split plots was used, testing three substrates (pure organic-containing clay, sand and manure in 1: 1: 1 v: v: v ratio; organomineral mixed with 30% straw and sand with vermiculite in 1: 1 v: v and four N sources (inoculation with strains BR 3461 and BR 3470, control with N fertilization and control without fertilization, totalizing 12 treatments. Height and stem diameter were evaluate after 90 days and shoot, root and nodules dry mass were evaluate after 120 days. Organomineral substrates provided better seedling growth. However, only organic-substrate with straw and sand with vermiculite showed positive responses of plants inoculated with BR3470 strain. The performance of the inoculated seedlings was not higher than that of seedlings fertilized with N. The rate of N applied stimulated nodulation rather than inhibit it.

From Concept to Commerce: Developing a Successful Fungal Endophyte Inoculant for Agricultural Crops.

Science.gov (United States)

Murphy, Brian R; Doohan, Fiona M; Hodkinson, Trevor R

2018-02-11

The development of endophyte inoculants for agricultural crops has been bedevilled by the twin problems of a lack of reliability and consistency, with a consequent lack of belief among end users in the efficacy of such treatments. We have developed a successful research pipeline for the production of a reliable, consistent and environmentally targeted fungal endophyte seed-delivered inoculant for barley cultivars. Our approach was developed de novo from an initial concept to source candidate endophyte inoculants from a wild relative of barley, Hordeum murinum (wall barley). A careful screening and selection procedure and extensive controlled environment testing of fungal endophyte strains, followed by multi-year field trials has resulted in the validation of an endophyte consortium suitable for barley crops grown on relatively dry sites. Our approach can be adapted for any crop or environment, provided that the set of first principles we have developed is followed. Here, we report how we developed the successful pipeline for the production of an economically viable fungal endophyte inoculant for barley cultivars.

Baby bottle steam sterilizers for disinfecting home nebulizers inoculated with non-tuberculous mycobacteria.

Science.gov (United States)

Towle, D; Callan, D A; Lamprea, C; Murray, T S

2016-03-01

Non-tuberculous mycobacteria (NTMb), present in environmental water sources, can contribute to respiratory infection in patients with chronic pulmonary disease. Contaminated nebulizers are a potential source of respiratory infection. Treatment with baby bottle steam sterilizers disinfects home nebulizers inoculated with bacterial pathogens but whether this method works for disinfection of NTMb is unclear. Baby bottle steam sterilization was compared with vigorous water washing for disinfecting home nebulizers inoculated with NTMb mixed with cystic fibrosis sputum. No NTMb was recovered from any nebulizers after steam treatment whereas viable NTMb grew after water washing, demonstrating that steam sterilization effectively disinfects NTMb-inoculated nebulizers. Copyright © 2015 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

AMF Inoculation Enhances Growth and Improves the Nutrient Uptake Rates of Transplanted, Salt-Stressed Tomato Seedlings

Directory of Open Access Journals (Sweden)

Astrit Balliu

2015-12-01

Full Text Available The study aimed to investigate the effects of commercially available AMF inoculate (Glomus sp. mixture on the growth and the nutrient acquisition in tomato (Solanumlycopersicum L. plants directly after transplanting and under different levels of salinity. Inoculated (AMF+ and non-inoculated (AMF− tomato plants were subjected to three levels of NaCl salinity (0, 50, and 100 mM·NaCl. Seven days after transplanting, plants were analyzed for dry matter and RGR of whole plants and root systems. Leaf tissue was analyzed for mineral concentration before and after transplanting; leaf nutrient content and relative uptake rates (RUR were calculated. AMF inoculation did not affect plant dry matter or RGR under fresh water-irrigation. The growth rate of AMF−plants did significantly decline under both moderate (77% and severe (61% salt stress compared to the fresh water-irrigated controls, while the decline was much less (88% and 75%,respectivelyand statistically non-significant in salt-stressed AMF+ plants. Interestingly, root system dry matter of AMF+ plants (0.098 g plant–1 remained significantly greater under severe soil salinity compared to non-inoculated seedlings (0.082 g plant–1. The relative uptake rates of N, P, Mg, Ca, Mn, and Fe were enhanced in inoculated tomato seedlings and remained higher under (moderate salt stress compared to AMF− plants This study suggests that inoculation with commercial AMF during nursery establishment contributes to alleviation of salt stress by maintaining a favorable nutrient profile. Therefore, nursery inoculation seems to be a viable solution to attenuate the effects of increasing soil salinity levels, especially in greenhouses with low natural abundance of AMF spores.

Effect of arbuscular mycorrhizal fungal inoculation on growth, and ...

African Journals Online (AJOL)

FAMA

2015-09-30

Sep 30, 2015 ... AMF on root colonization, biomass production, mycorrhizal dependency (MD) and shoot mineral ... four months of growth in a sterilized soil and greenhouse conditions, grasses inoculated with AMF ..... Quetta, Pakistan.

effects of rhizobuim leguminosarum inoculation on the growth and ...

African Journals Online (AJOL)

user

beneficial symbiotic microorganisms into the plant. Rhizosphere ... Rhizobium strains in the yeast manitol broth were ... inoculants contained sixteen (16) colonies of Rhizobium leguminosarum bacterial cells per milliliter (ml) of the yeast ...

INOCULATION OF DIAZOTROPHIC BACTERIA AND NITROGEN FERTILIZATION IN TOPDRESSING IN IRRIGATED CORN

Directory of Open Access Journals (Sweden)

VANESSA ZIRONDI LONGHINI

2016-01-01

Full Text Available Corn is a nitrogen-intensive crop, and the use of management practices such as inoculation of the seed with diazotrophic bacteria, which can maximize crop productivity and reduce the need of nitrogen fertilizers, may result in lower production costs. The present study aimed to evaluate the effect of inoculation of corn seed with Azospirillum brasilense and controlled addition of nitrogen to topdressing on the nutrition, production components, and productivity of crop grain. The experimental design was a randomized block design, with four replications in a 2 × 5 factorial scheme. The treatments consisted of inoculation or not of corn seed with A. brasilense (at 100 mL per 25 kg of seed and five nitrogen (N levels in topdressing (0, 30, 60, 90, and 120 kg N ha-1 from urea [45% N] were applied when the corn was in the phenological growth stage V6. Foliar macronutrients, foliar chlorophyll index (FCI, production components, and yield of corn grain were valuated. Inoculation of corn seeds with A. brasilense increased plant height and grain yield. Fertilization in topdressing, with N levels up to 120 kg ha-1, linearly increased the foliar nutrients and productivity of corn cultivated in the spring/summer in the low-altitude Cerrado region of Brazil.

Interactive overlays of journals and the measurement of interdisciplinarity on the basis of aggregated journal-journal citations

NARCIS (Netherlands)

Leydesdorff, L.; Rafols, I.; Chen, C.

2013-01-01

Using the option Analyze Results with the Web of Science, one can directly generate overlays onto global journal maps of science. The maps are based on the 10,000+ journals contained in the Journal Citation Reports (JCR) of the Science and Social Sciences Citation Indices (2011). The disciplinary

Inoculation of HMA and phosphoric fertilizer requirements Ipomea batata (L. Lam

Directory of Open Access Journals (Sweden)

Alberto Espinosa Cuéllar

2016-07-01

Full Text Available As well as sweet potato is a micotrófico crop, litle results where P fertilizer requirements associated with inoculation of strains of arbuscular mycorrhizal fungi (HMA are reported. For these purposes two experiments were performed, evaluating the response of the clones ‘INIVIT B2-2005’ or ‘CEMSA 78-354’ to application of five doses of phosphoric fertilizer with or without the application of the species Rhizoglomus intraradices (INCAM-11 in Phaeozems haplic calcari, in a randomized block design, factorial arrangement and four replications. Tuber yield, percentage of mycorrhizal colonization of mycorrhizal spores contained 50 g of soil and phosphorus content in the leaf, stem and root tuberous were evaluated. A significant response mineral fertilization in performance with an optimal dose of 75 kg ha-1, which decreased to 50 kg ha -1 when soil was inoculated with R. intraradices was found, while maintaining equivalent yields . This effect was similar in both clones and in both years. Inoculation significantly increased the percentage of colonization and spores and the highest values ever obtained in the treatment of 50 kg ha-1 of P2O5 , lower and upper fertilizations showed lower values. The contents of phosphorus in different organs also showed a similar response. It is concluded that efficient inoculating strain originates adequate mycorrhizal HMA performance in the presence of medium doses of fertilizer, ensuring high yields with lower doses of these.

Development and evaluation of novel recombinant adenovirus-based vaccine candidates for infectious bronchitis virus and Mycoplasma gallisepticum in chickens.

Science.gov (United States)

Zhang, Dongchao; Long, Yuqing; Li, Meng; Gong, Jianfang; Li, Xiaohui; Lin, Jing; Meng, Jiali; Gao, Keke; Zhao, Ruili; Jin, Tianming

2018-04-01

Avian infectious bronchitis caused by the infectious bronchitis virus (IBV), and mycoplasmosis caused by Mycoplasma gallisepticum (MG) are two major respiratory diseases in chickens that have resulted in severe economic losses in the poultry industry. We constructed a recombinant adenovirus that simultaneously expresses the S1 spike glycoprotein of IBV and the TM-1 protein of MG (pBH-S1-TM-1-EGFP). For comparison, we constructed two recombinant adenoviruses (pBH-S1-EGFP and pBH-TM-1-EGFP) that express either the S1 spike glycoprotein or the TM-1 protein alone. The protective efficacy of these three vaccine constructs against challenge with IBV and/or MG was evaluated in specific pathogen free chickens. Groups of seven-day-old specific pathogen free chicks were immunized twice, two weeks apart, via the oculonasal route with the pBH-S1-TM-1-EGFP, pBH-S1-EGFP, or pBH-TM-1-EGFP vaccine candidates or the commercial attenuated infectious bronchitis vaccine strain H52 and MG vaccine strain F-36 (positive controls), and challenged with virulent IBV or MG two weeks later. Interestingly, by days 7 and 14 after the booster immunization, pBH-S1-TM-1-EGFP-induced antibody titre was significantly higher (P attenuated commercial IBV vaccine; however, there was no significant difference between the pBH-S1-TM-1-EGFP and attenuated commercial MG vaccine groups (P > 0.05). The clinical signs, the gross, and histopathological lesions scores of the adenovirus vaccine constructs were not significantly different from that of the attenuated commercial IBV or MG vaccines (positive controls) (P > 0.05). These results demonstrate the potential of the bivalent pBH-S1-TM-1-EGFP adenovirus construct as a combination vaccine against IB and mycoplasmosis.

Zika virus preferentially replicates in the female reproductive tract after vaginal inoculation of rhesus macaques.

Directory of Open Access Journals (Sweden)

Timothy Carroll

2017-07-01

Full Text Available Zika virus (ZIKV is a mosquito-transmitted virus that can cause severe defects in an infected fetus. ZIKV is also transmitted by sexual contact, although the relative importance of sexual transmission is unclear. To better understand the role of sexual transmission in ZIKV pathogenesis, a nonhuman primate (NHP model of vaginal transmission was developed. ZIKV was readily transmitted to mature cycling female rhesus macaque (RM by vaginal inoculation with 104-106 plaque-forming units (PFU. However, there was variability in susceptibility between the individual RM with 1->8 vaginal inoculations required to establish infection. After treatment with Depoprovera, a widely used contraceptive progestin, two RM that initially resisted 8 vaginal ZIKV inoculations became infected after one ZIKV inoculation. Thus, Depoprovera seemed to enhance susceptibility to vaginal ZIKV transmission. Unexpectedly, the kinetics of virus replication and dissemination after intravaginal ZIKV inoculation were markedly different from RM infected with ZIKV by subcutaneous (SQ virus inoculation. Several groups have reported that after SQ ZIKV inoculation vRNA is rapidly detected in blood plasma with vRNA less common in urine and saliva and only rarely detected in female reproductive tract (FRT secretions. In contrast, in vaginally inoculated RM, plasma vRNA is delayed for several days and ZIKV replication in, and vRNA shedding from, the FRT was found in all 6 animals. Further, after intravaginal transmission ZIKV RNA shedding from FRT secretions was detected before or simultaneously with plasma vRNA, and persisted for at least as long. Thus, ZIKV replication in the FRT was independent of, and often preceded virus replication in the tissues contributing to plasma vRNA. These results support the conclusion that ZIKV preferentially replicates in the FRT after vaginal transmission, but not after SQ transmission, and raise the possibility that there is enhanced fetal infection and

Comparative pathology of chickens experimentally inoculated with avian influenza viruses of low and high pathogenicity.

Science.gov (United States)

Mo, I P; Brugh, M; Fletcher, O J; Rowland, G N; Swayne, D E

1997-01-01

Pathologic changes and distribution of viral antigen as determined by immunohistochemistry were compared among 4-wk-old specific-pathogen-free chickens inoculated intratracheally with avian influenza virus (AIV) isolates of either low or high pathogenicity. Viruses of low pathogenicity, previously characterized as mildly pathogenic (MP), included A/chicken/Pennsylvania/21525/83 (H5N2) (MP-Penn) and A/chicken/Alabama/7395/75 (H4N8) (MP-Alab). Viruses of high pathogenicity included A/chicken/Pennsylvania/1370/83 (H5N2), A/chicken/Victoria/A185/85 (H7N7), and A/turkey/Ontario/7732/66 (H5N9). Extremely variable clinical signs ranging from mild respiratory distress to high mortality were present among chickens inoculated with these viruses. Chickens inoculated with highly pathogenic (HP) virus had histologic lesions of necrosis and inflammation in cloacal bursa, thymus, spleen, heart, pancreas, kidney, brain, trachea, lung, and skeletal muscle, whereas chickens inoculated with MP virus had histologic lesions most frequently in lung and trachea or lacked histologic lesions. Immunospecific staining for avian influenza viral proteins was most common in cells within heart, lung, kidney, brain, and pancreas of chicken inoculated with HP viruses, but immunospecific staining was present only and infrequently in trachea and lung of chickens inoculated with MP-Penn AIV. MP-Alab did not produce lesions nor have viral antigen in inoculated chickens but did produce serologic evidence of infection. The pattern of organ involvement and viral antigen distribution in chickens intratracheally inoculated with HP AIV isolates indicates a common capability to spread beyond the respiratory tract and confirms the pantrophic replicative, pathobiologic, and lethal nature of the viruses. However, variability in severity and lesion distribution exists between different HP AIVs. By contrast, MP viruses had the ability to replicate in respiratory or enteric tracts or both and produce lesions

Ectomycorrhizal inoculation with Pisolithus tinctorius reduces stress induced by drought in cork oak.

Science.gov (United States)

Sebastiana, Mónica; da Silva, Anabela Bernardes; Matos, Ana Rita; Alcântara, André; Silvestre, Susana; Malhó, Rui

2018-04-01

We investigated whether the performance of cork oak under drought could be improved by colonization with the ectomycorrhizal fungus Pisolithus tinctorius. Results show that inoculation alone had a positive effect on plant height, shoot biomass, shoot basal diameter, and root growth. Under drought, root growth of mycorrhizal plants was significantly increased showing that inoculation was effective in increasing tolerance to drought. In accordance, mycorrhizal plants subjected to drought showed less symptoms of stress when compared to non-mycorrhizal plants, such as lower concentration of soluble sugars and starch, increased ability to maintain fatty acid content and composition, and increased unsaturation level of membrane lipids. After testing some of the mechanisms suggested to contribute to the enhanced tolerance of mycorrhizal plants to drought, we could not find any by which Pisolithus tinctorius could benefit cork oak, at least under the drought conditions imposed in our experiment. Inoculation did not increase photosynthesis under drought, suggesting no effect in sustaining stomatal opening at low soil water content. Similarly, plant water status was not affected by inoculation suggesting that P. tinctorius does not contribute to an increased plant water uptake during drought. Inoculation did increase nitrogen concentration in plants but it was independent of the water status. Furthermore, no significant mycorrhizal effect on drought-induced ROS production or osmotic adjustment was detected, suggesting that these factors are not important for the improved drought tolerance triggered by P. tinctorius.

Response of five lentil (lens culinaris) genotypes to artificial inoculation using /sup 15/N as a tracer

International Nuclear Information System (INIS)

Khan, H.; Mahmood, N.H.; Iqbal, M.

1997-01-01

Five lentil (lens culinaris) genotypes, viz NARC-3, 20-8, 88522, 89511 and Mansehra-89, were evaluated in the field and pot experiments for natural nodulation and to study the effect of artificial inoculation on their nodulation, yield and grain protein content. Natural nodulation was almost absent in all the tested genotypes. Artificial rhizobial inoculation significantly increased the biological and grain yields in all the genotypes. Maximum increase in yield and nodulation due to inoculation was recorded in case of Mansehra-89. Grain protein was also increased by inoculation but not significantly. (author)

Experimental Aerosol Inoculation and Investigation of Potential Lateral Transmission of Mycobacterium bovis in Virginia Opossum (Didelphis virginiana).

Science.gov (United States)

Fenton, Karla A; Fitzgerald, Scott D; Bolin, Steve; Kaneene, John; Sikarskie, James; Greenwald, Rena; Lyashchenko, Konstantin

2012-01-01

An endemic focus of Mycobacterium bovis (M. bovis) infection in the state of Michigan has contributed to a regional persistence in the animal population. The objective of this study was to determine if Virginia opossums (Didelphis virginiana) contribute to disease persistence by experimentally assessing intraspecies lateral transmission. One wild caught pregnant female opossum bearing 11 joeys (young opossum) and one age-matched joey were obtained for the study. Four joeys were aerosol inoculated with M. bovis (inoculated), four joeys were noninoculated (exposed), and four joeys plus the dam were controls. Four replicate groups of one inoculated and one exposed joey were housed together for 45 days commencing 7 days after experimental inoculation. At day 84 opossums were sacrificed. All four inoculated opossums had a positive test band via rapid test, culture positive, and gross/histologic lesions consistent with caseogranulomatous pneumonia. The exposed and control groups were unremarkable on gross, histology, rapid test, and culture. In conclusion, M. bovis infection within the inoculated opossums was confirmed by gross pathology, histopathology, bacterial culture, and antibody tests. However, M. bovis was not detected in the control and exposed opossums. There was no appreciable lateral transmission of M. bovis after aerosol inoculation and 45 days of cohabitation between infected and uninfected opossums.

Experimental Aerosol Inoculation and Investigation of Potential Lateral Transmission of Mycobacterium bovis in Virginia Opossum (Didelphis virginiana

Directory of Open Access Journals (Sweden)

Karla A. Fenton

2012-01-01

Full Text Available An endemic focus of Mycobacterium bovis (M. bovis infection in the state of Michigan has contributed to a regional persistence in the animal population. The objective of this study was to determine if Virginia opossums (Didelphis virginiana contribute to disease persistence by experimentally assessing intraspecies lateral transmission. One wild caught pregnant female opossum bearing 11 joeys (young opossum and one age-matched joey were obtained for the study. Four joeys were aerosol inoculated with M. bovis (inoculated, four joeys were noninoculated (exposed, and four joeys plus the dam were controls. Four replicate groups of one inoculated and one exposed joey were housed together for 45 days commencing 7 days after experimental inoculation. At day 84 opossums were sacrificed. All four inoculated opossums had a positive test band via rapid test, culture positive, and gross/histologic lesions consistent with caseogranulomatous pneumonia. The exposed and control groups were unremarkable on gross, histology, rapid test, and culture. In conclusion, M. bovis infection within the inoculated opossums was confirmed by gross pathology, histopathology, bacterial culture, and antibody tests. However, M. bovis was not detected in the control and exposed opossums. There was no appreciable lateral transmission of M. bovis after aerosol inoculation and 45 days of cohabitation between infected and uninfected opossums.

Experimental inoculation of beagle dogs with Ehrlichia species detected from Ixodes ovatus

OpenAIRE

Watanabe, Malaika; Oikawa, T; Hiraoka, Hiroko; Kaneko, N; Itamoto, Kazuhito; Mizuno, Tohru; Okuda, Masaru; Inokuma, Hisashi

2006-01-01

Three beagle dogs were inoculated with mice spleen/liver homogenate infected with Ehrlichia species detected from Ixodes ovatus (EIO) and one dog was used as a control. All three infected dogs did not show clinical signs of disease except for mild pyrexia throughout the 41-day study period. Splenomegaly was observed from Day 7 post-inoculation (p.i.) in two of the dogs. Hematological and biochemical abnormalities included mild thrombocytopenia, hypoproteinaemia, hypoalbuminaemia and increased...

Inoculation methods and aggressiveness of five Fusarium species against peach palm

Directory of Open Access Journals (Sweden)

Tiago Miguel Jarek

2018-04-01

Full Text Available ABSTRACT: Fusarium wilt is a major disease which affects peach palm (Bactris gasipaes Kunth.var gasipaes Henderson. This study aimed to evaluate inoculation methods and aggressiveness of isolates of five Fusarium species on peach palm. Fusarium proliferatum can infect the leaves, stem, and roots of peach palm. F. proliferatum, F. oxysporum species complex (FOSC, F. verticillioides, F. solani species complex (FSSC, and Gibberella fujikuroi species complex (GFSC are pathogenic to peach palm. The use of Fusarium-colonized ground corn for root inoculation was effective and reduced the level of damage to plants.

The Effects of Letter Spacing and Coloured Overlays on Reading Speed and Accuracy in Adult Dyslexia

Science.gov (United States)

Sjoblom, Amanda M.; Eaton, Elizabeth; Stagg, Steven D.

2016-01-01

Background: Zorzi et al. (2012, Proc. Natl. Acad. Sci. U.S.A., 109, 11455) found evidence that extra-large letter spacing aids children with dyslexia, but the evidence for the coloured overlays is contradictory (e.g., Henderson et al., 2013, "J. Res. Special Educ. Needs," 13, 57; Wilkins, 2002, "Ophthalmic Physiol. Opt.," 22,…

Silage extracts used to study the mode of action of silage inoculants in ruminants

Science.gov (United States)

Silage microbial inoculants can enhance animal performance, but the mechanisms involved in these effects are not clear. Our hypothesis was that an extractable factor from inoculated silage enhances rumen microbial activity. One alfalfa haylage (58% DM) and two corn silages (30% and 50% DM) were made...

Using Gamma Radiation for the Improvement of Silage Inoculant

International Nuclear Information System (INIS)

Wongwicharn, Aporn; Ljinakakr, Nongpanga; Piadang, Patharakorn

2006-09-01

A total of 117 acid producing baceria were isolated from grass and silage samples. Almost all isolates, 115 isolates posses homfermentative fermentation. All isolates produced lactic acid in a range of 0.36-2.05%. From their growth and their ability in producing lactic acid, two isolates, a coccus (T3-2-02) and a rod (T3-0-01) were selected for a mixed wild type strains for silage inoculant. After irradiation the wild type strains with gama ray, 51 and 58 isolates of high acid producer were selected from T3-2-02 and T3-0-01 strains, respectively. After testing the growht characteristics and the acid productivity, a coccus strain, MC08 and a rod stain, MR4 were choosen as a mixed irradiated starter culture strains for grass silage fermentation using a 50 dats old Pangola grass (Digitaria eriantha). The experiment was divided into 6 treatments. Treatmet I was the control. Treatmment 2, 4% molasses was added ro the grass. Treatment 3, a mixed wild type strains (T3-2-02+ T3-0-01) was inoculated into the grass. Treatment 4, a mixed irradiated strains (MC08+ MR04) was used. Treatment 5, A mixed wild tpye strains was used and supplemented with 4% molasses. Treatnebt 6, A mixed irradiated strain was assed and supplemented with 4% molasses. The results showed that a qualified silage can be obtained within a week from either the treatment inoculated with starter culture together with4% molasses (T5 and T6) or the treatment supplemented with 4% molasses alone (T2). further more, Silage of the treatments that using starter culture supplemented with 4% molasses gave volatile acid in a requred quantity. Silage of the treatments that inoculated either with a wild type pr a mixed irradiated starter culture posses bether quality than the control treatment. Further more silage that used irradiated starter culture showed a faster ffermentation and higher lactic acid production tha silage that uses wild type starter culture.

First-principles study of thermodynamical properties of random magnetic overlayers on fcc-Cu(001) substrate

Czech Academy of Sciences Publication Activity Database

Mašín, Martin; Bergqvist, L.; Kudrnovský, Josef; Kotrla, Miroslav; Drchal, Václav

2013-01-01

Roč. 87, č. 7 (2013), "075452-1"-"075452-7" ISSN 1098-0121 R&D Projects: GA ČR GA202/09/0775 Institutional support: RVO:68378271 Keywords : Curie temperature * random overlayer * Heisenberg Hamiltonian * first principles * Monte Carlo simulations * magnon spectra Subject RIV: BE - Theoretical Physics Impact factor: 3.664, year: 2013 http://prb.aps.org/abstract/PRB/v87/i7/e075452

Inoculation of weaned pigs with E. coli reduces depots of vitamin E

DEFF Research Database (Denmark)

Lauridsen, Charlotte; Vestergaard, Ellen-Margrethe; Højsgaard, Søren

2011-01-01

This study was designed to investigate the effect of vitamin E supplementation on vitamin E depots and immune responses in weaned pigs after an E. coli inoculation. The design was a 2 × 2 factorial with vitamin E supplementation (150 mg/kg RRR-α-tocopheryl acetate versus a control diet containing...... 60 mg all-rac-α-tocopheryl acetate) and E. coli 0 149 inoculation (inoculation of 1 × 108 CFU on day 2 and 3 after weaning versus inoculation of vehicle). The pigs were housed individually during the experiment which lasted for 10 days from weaning at 7 weeks of age. Blood was sampled on day 1 (day...... of weaning) and 9 of the experiment, and serum was analyzed for α-tocopherol concentration. On day 10 of the experiment, pigs were killed and samples of liver, heart, muscle, adipose tissue and intestinal epithelium were obtained, and immune cells (alveolar macrophages) were harvested, and analyzed for α...

Inoculation of Ceratonia siliqua L. with native arbuscular mycorrhizal ...

African Journals Online (AJOL)

Inoculation of Ceratonia siliqua L. with native arbuscular mycorrhizal fungi mixture improves seedling establishment under greenhouse conditions. Ouahmane Lahcen, Ndoye Ibrahima, Morino Abdessadek, Ferradous Abderrahim, Sfairi Youssef, Al Faddy Mohamed Najib, Abourouh Mohamed ...

Effect of salinity and inoculation with Azosprillium on carbohydrate ...

African Journals Online (AJOL)

Jane

2011-08-17

Aug 17, 2011 ... Inoculation reduced harmful effects of salinity especially on mean kernel weight and grain ... considered to play a key role in stress induced metabolic processes and membrane ..... osmoregulation. Conclusion. Increase in ...

Arbuscular mycorrhizal wheat inoculation promotes alkane and polycyclic aromatic hydrocarbon biodegradation: Microcosm experiment on aged-contaminated soil

International Nuclear Information System (INIS)

Ingrid, Lenoir; Lounès-Hadj Sahraoui, Anissa; Frédéric, Laruelle; Yolande, Dalpé; Joël, Fontaine

2016-01-01

Very few studies reported the potential of arbuscular mycorrhizal symbiosis to dissipate hydrocarbons in aged polluted soils. The present work aims to study the efficiency of arbuscular mycorrhizal colonized wheat plants in the dissipation of alkanes and polycyclic aromatic hydrocarbons (PAHs). Our results demonstrated that the inoculation of wheat with Rhizophagus irregularis allowed a better dissipation of PAHs and alkanes after 16 weeks of culture by comparison to non-inoculated condition. These dissipations observed in the inoculated soil resulted from several processes: (i) a light adsorption on roots (0.5% for PAHs), (ii) a bioaccumulation in roots (5.7% for PAHs and 6.6% for alkanes), (iii) a transfer in shoots (0.4 for PAHs and 0.5% for alkanes) and mainly a biodegradation. Whereas PAHs and alkanes degradation rates were respectively estimated to 12 and 47% with non-inoculated wheat, their degradation rates reached 18 and 48% with inoculated wheat. The mycorrhizal inoculation induced an increase of Gram-positive and Gram-negative bacteria by 56 and 37% compared to the non-inoculated wheat. Moreover, an increase of peroxidase activity was assessed in mycorrhizal roots. Taken together, our findings suggested that mycorrhization led to a better hydrocarbon biodegradation in the aged-contaminated soil thanks to a stimulation of telluric bacteria and hydrocarbon metabolization in mycorrhizal roots. - Highlights: • Phytoremediation of aged-hydrocarbon polluted soils may be improved using arbuscular mycorrhizal fungi. • Inoculation of wheat with R. irregularis improved dissipation of PAH and alkanes. • Dissipation resulted from adsorption and bioaccumulation in wheat and mainly from biodegradation in soil. • Biodegradation was due to a stimulation of rhizosphere bacteria and an induction of root peroxidase. - Inoculation of wheat by an arbuscular mycorrhizal fungus improves biodegradation of alkanes and polycyclic aromatic hydrocarbons in an aged

Optimización multiobjetivo para enrutamiento multicast en overlay networks utilizando algoritmos evolutivos Multiobjective Optimization for Multicast Routing in Overlay Networks using Evolutionary Algorithms

Directory of Open Access Journals (Sweden)

Juan Carlos Montoya M.

2008-06-01

Full Text Available Multicast juega un papel muy importante para soportar una nueva generación de aplicaciones. En la actualidad y por diferentes razones, técnicas y no técnicas, multicast IP no ha sido totalmente adoptado en Internet. Durante los últimos a˜nos, un área de investigación activa es la de implementar este tipo de tráfico desde la perspectiva del nivel de aplicación, donde la funcionalidad de multicast no es responsabilidad de los enrutadores sino de los hosts, a lo que se le conoce como Multicast Overlay Network (MON. En este artículo se plantea el enrutamiento en MON como un problema de Optimización Multiobjetivo (MOP donde se optimizan dos funciones: 1 el retardo total extremo a extremo del árbol multicast, y 2 la máxima utilización de los enlaces. La optimización simultánea de estas dos funciones es un problema NP completo y para resolverlo se propone utilizar Algoritmos Evolutivos Multiobjetivos (MOEA, específicamente NSGAIMulticast plays an important role in supporting a new generation of applications. At present and for different reasons, technical and non–technical, multicast IP hasn’t yet been totally adopted for Internet. During recent years, an active area of research is that of implementing this kind of traffic in the application layer where the multicast functionality isn´t a responsibility of the routers but that of the hosts, which we know as Multicast Overlay Networks (MON. In this article, routing in an MON is put forward as a multiobjective optimization problem (MOP where two functions are optimized: 1 the total end to end delay of the multicast tree and 2 the maximum link utilization. The simultaneous optimization of these two functions is an NP–Complete problem and to solve this we suggest using Multiobjective Evolutionary Algorithms (MOEA, specifically NSGA–II.

Inoculation method could impact the outcome of microbiological experiments

DEFF Research Database (Denmark)

Kragh, Kasper Nørskov; Alhede, Maria; Rybtke, Morten

2018-01-01

For the last 150 years, bacteria have primarily been investigated in liquid bacth cultures (LBC). Contrary to most expectations, these cultures are not a homogeneous mixture of single-celled bacteria as free-floating bacterial aggregates eventually develop in most LBC. These aggregates share...... coli and Staphylococcus aureus also produce aggregates in LBC. Our results stress the importance of inoculation consistency throughout experiments and the substantial impact aggregate development in LBC has on the output of microbiological experiments.IMPORTANCE Liquid pure cultures are fundamental...... to the field of microbiological research. These cultures are normally thought of as a homogeneous mix of single cell bacteria. The present study shows how this is not always true. Bacteria may aggregate in these liquid cultures. The aggregation can be induced by the method chosen for inoculation. The presence...

Journal maps, interactive overlays, and the measurement of interdisciplinarity on the basis of Scopus data (1996-2012)

NARCIS (Netherlands)

Leydesdorff, L.; de Moya-Anegón, F.; Guerrero-Bote, V.P.

2015-01-01

Using Scopus data, we construct a global map of science based on aggregated journal-journal citations from 1996-2012 (N of journals = 20,554). This base map enables users to overlay downloads from Scopus interactively. Using a single year (e.g., 2012), results can be compared with mappings based on

Effect of arbuscular mycorrhizal fungal inoculation in combination with different organic fertilizers on maize crop in eroded soils

International Nuclear Information System (INIS)

Sharif, M.; Saud, S.; Khan, F.

2012-01-01

A pot experiment was conducted to study the effect of inoculating maize (Zea mays L. Azam) with Arbuscular mycorrhizal (AM) fungi in 2 different series of North West Pakistan during the year 2007. Data showed significant increase in shoots and roots yield of maize with the inoculation of AM fungi alone and in combination with farm yard manure (FYM), poultry manure (PM) and humic acid (HA) over control and N-P-K treatments. Accumulation of N by maize shoots increased significantly by the addition of HA, PM and FYM plus N-P-K with or without inoculation of AM fungi over the treatments of N-P-K and control. Plants P accumulation increased significantly over control and N-P-K treatments with the inoculation of AM fungi alone and in combination with FYM, PM and HA in missa soil series. In missa gullied soil series, significantly increased plants P accumulation was noted by the treatments of AM inoculation with PM followed by HA. Accumulation of Mn by maize shoots increased significantly with AM inoculation with HA and PM over all other treatments, Fe increased with PM, HA and FYM. Plants Cu accumulation in missa series increased significantly over control and N-P-K treatments by AM alone and in combination with PM, FYM and HA and by AM fungi with PM, FYM and HA in missa gullied series. Maximum Mycorrhizal root infection rate of 51 % was recorded in the treatment of AM fungal inoculation with HA followed by the treatment inoculated with AM fungi with FYM. In missa gullied soil series, Maximum (59 %) and significantly increased roots infection rates over all treatments were observed in the treatment of AM fungal inoculation with HA followed by PM. Spores concentrations of AM fungi increased significantly with AM inoculation alone and with FYM, PM and HA. Maximum spores numbers of 50 in 20 g soil were recorded by the inoculation of AM fungi alone and with HA. (author)

Magnetism of a Co monolayer on Pt(111) capped by overlayers of 5 d elements: A spin-model study

Science.gov (United States)

Simon, E.; Rózsa, L.; Palotás, K.; Szunyogh, L.

2018-04-01

Using first-principles calculations, we study the magnetic properties of a Co monolayer on a Pt(111) surface with a capping monolayer of selected 5 d elements (Re, Os, Ir, Pt, and Au). First we determine the tensorial exchange interactions and magnetic anisotropies characterizing the Co monolayer for all considered systems. We find a close relationship between the magnetic moment of the Co atoms and the nearest-neighbor isotropic exchange interaction, which is attributed to the electronic hybridization between the Co and the capping layers, in the spirit of the Stoner picture of ferromagnetism. The Dzyaloshinskii-Moriya interaction is decreased for all overlayers compared to the uncapped Co/Pt(111) system, while even the sign of the Dzyaloshinskii-Moriya interaction changes in the case of the Ir overlayer. We conclude that the variation of the Dzyaloshinskii-Moriya interaction is well correlated with the change of the magnetic anisotropy energy and of the orbital moment anisotropy. The unique influence of the Ir overlayer on the Dzyaloshinskii-Moriya interaction is traced by scaling the strength of the spin-orbit coupling of the Ir atoms in Ir/Co/Pt(111) and by changing the Ir concentration in the Au1 -xIrx /Co/Pt(111) system. Our spin dynamics simulations indicate that the magnetic ground state of Re/Co/Pt(111) thin film is a spin spiral with a tilted normal vector, while the other systems are ferromagnetic.

Novel WLL Architecture Based on Color Pixel Multiple Access Implemented on a Terrestrial Video Network as the Overlay

DEFF Research Database (Denmark)

Sanyal, Rajarshi; Cianca, Ernestina; Prasad, Ramjee

2013-01-01

Wireless Local Loop deployments are based on the traditional cellular technologies. However there are limitations in terms of intricacy, cost and time to deploy .In this paper, the authors introduce a Wireless Local Loop architecture employing the proposed CPMA technique on existing overlay video...

Liquid culture mass production of biocontrol nematodes, Heterorhabditis bacteriophora (Nematoda: Rhabditida): improved timing of dauer juvenile inoculation.

Science.gov (United States)

Johnigk, S-A; Ecke, F; Poehling, M; Ehlers, R-U

2004-06-01

Heterorhabditis bacteriophora is used in biological control of soil-borne insect pests in horticulture and turf. Mass production is carried out in monoxenic liquid cultures pre-incubated with the symbiont of the nematodes, the bacterium Photorhabdus luminescens, before nematode dauer juveniles (DJ) are inoculated. As a response to bacterial food signals, the DJ recover from the developmentally arrested dauer stage, grow to adults and produce DJ offspring. Variable DJ recovery after inoculation into cultures of P. luminescens often causes process failure due to low numbers of adult nematodes in the medium. In order to enhance DJ recovery, improve nematode population management and increase yields, the optimal timing for DJ inoculation was sought. The process parameter pH and respiration quotient (RQ) were recorded in order to test whether changes can be used to identify the best moment for DJ inoculation. When DJ were inoculated during the lag and early logarithmic growth phases of P. luminescens cultures, DJ recovery was low and almost no nematode reproduction was obtained. High populations of P. luminescens phase variants were recorded. Recovery and yields increased when DJ were inoculated during the latter log phase during which the RQ dropped to values <0.8 and the pH reached a maximum. The highest DJ recovery and yields were observed in cultures that were inoculated during the late stationary growth phase. This period started with the increase of the pH after its distinct minimum at pH <8.0. Thus optimal timing for DJ inoculation can be defined through monitoring of the pH in the P. luminescens culture.

Comparative Metagenomic Analysis of Electrogenic Microbial Communities in Differentially Inoculated Swine Wastewater-Fed Microbial Fuel Cells

Directory of Open Access Journals (Sweden)

Irina V. Khilyas

2017-01-01

Full Text Available Bioelectrochemical systems such as microbial fuel cells (MFCs are promising new technologies for efficient removal of organic compounds from industrial wastewaters, including that generated from swine farming. We inoculated two pairs of laboratory-scale MFCs with sludge granules from a beer wastewater-treating anaerobic digester (IGBS or from sludge taken from the bottom of a tank receiving swine wastewater (SS. The SS-inoculated MFC outperformed the IGBS-inoculated MFC with regard to COD and VFA removal and electricity production. Using a metagenomic approach, we describe the microbial diversity of the MFC planktonic and anodic communities derived from the different inocula. Proteobacteria (mostly Deltaproteobacteria became the predominant phylum in both MFC anodic communities with amplification of the electrogenic genus Geobacter being the most pronounced. Eight dominant and three minor species of Geobacter were found in both MFC anodic communities. The anodic communities of the SS-inoculated MFCs had a higher proportion of Clostridium and Bacteroides relative to those of the IGBS-inoculated MFCs, which were enriched with Pelobacter. The archaeal populations of the SS- and IGBS-inoculated MFCs were dominated by Methanosarcina barkeri and Methanothermobacter thermautotrophicus, respectively. Our results show a long-term influence of inoculum type on the performance and microbial community composition of swine wastewater-treating MFCs.

Effectivenes of inoculation in alfalfa breeding in ecological conditions of the Bjelovar and Bilogora county

Directory of Open Access Journals (Sweden)

Darko Uher

2012-09-01

Full Text Available Development and basic existence of animal production as well as production of high quality milk depends upon possibility of sufficient production of quality and protein sufficient forage. Forage crop that satisfies these demands is alfalfa which is one of the most important perennial forage crop legumes. The aim of this study was to enhance alfalfa production on acid soil by liming and alfalfa seed inoculation with efficient Sinorhizobium meliloti strains in order to reduce the use of mineral nitrogen fertilization and enable qualitative and cost effective production of forage on the dairy farms. Field trial was established at family farm in the area of Bjelovar and Bilogora county. During two years experimental period statistically significant influence of inoculation and liming on forage and dry matteryield was determined. Significantly the lowest yields were determined on untreated plots without liming material. In all untreated plots, significantly lower yields were determined, but significant differences in yields were also obtained by inoculation with different S. meliloti strains, emphasizing the importance of strains selection used for alfalfa inoculation. In both experimental years total forage yield were ranging from 34 t/ha (untreated plots without liming up to 60 t/ha on plots inoculated with strain 2011 and without liming. Values of total dry matter yield for both experimental years ranged from 6.5 t/ha (untreated plots without liming up to 15,7 t/ha on plots inoculated with strain 2011 without liming. Results of this study showed that application of liming materials for acidity removal had positive effect on alfalfa yields in both experimental years and significantly improved alfalfa production on acid soils. The results of this study clearly showed that inoculation with selected S. meliloti strains may improve alfalfa production on acid soils and may contribute to more efficient forage production for dairy farms under particular

Microsegregation and Precipitates in Inconel 625 Arc Weld Overlay Coatings on Boiler Pipes / Mikrosegregacja I Wydzielenia W Powłokach Ze Stopu Inconel 625 Napawanych Łukowo Na Rury Kotłowe

Directory of Open Access Journals (Sweden)

Rozmus-Górnikowska M.

2015-12-01

Full Text Available The aim of this work was to investigate the microsegregation and precipitates formed due to segregation in Inconel 625 arc weld overlay coatings on boiler pipes. Examination of microsegregation and precipitates were carried out by means of a scanning electron microscope (SEM equipped with an EDS detector as well as a transmission electron microscope (TEM equipped with a HAADF (STEM and an EDS detectors. The presence of precipitations in the weld overlay was also confirmed with X-ray diffraction analysis (XRD of residue in the form of powder that remained after the electrolytic dissolution of weld overlay matrix.

Effect of inoculating blue-green algae and Azolla on rice yield

International Nuclear Information System (INIS)

Kulasooriya, S.A.

1985-01-01

Nitrogen fixing blue-green algae (BGA) and the Azolla-Anaebaena symbiosis are potential alternative sources of nitrogen for lowland rice production. A survey of the literature shows that on the average, when BGA inoculation is effective, a rice yield increase of 14% (450 kg grain ha -1 ) has been observed. However, in Sri Lanka no significant increases in grain yield have been observed due to BGA inoculation. Azolla inoculation in broadcast, transplanted, and avenue transplanted rice gave yield increases of 12, 22 and 48%, and was equivalent to 55 to 80 kg N ha -1 as urea. Azolla was observed to reduce weed growth by 53%. Azolla is easier to establish in rice fields since it can be easily recognized with the naked eye, however, BGA are better able to withstand periods of desiccation which occur in rain-fed rice production. Most algalization experiments have been performed on a ''black box'' basis where only the final grain yield has been measured. Isotope experiments can play a vital role in understanding the processes by which BGA and Azolla increase rice yields. (author)

Treatment of dairy wastewater in UASB reactors inoculated with ...

African Journals Online (AJOL)

Treatment of dairy wastewater in UASB reactors inoculated with flocculent biomass. ... AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search · USING ... of using flocculent sludge in UASB reactors applied to the treatment of dairy ...

Maize response to inoculation with strains of plant growth-promoting bactéria

Directory of Open Access Journals (Sweden)

Janaína Dartora

Full Text Available ABSTRACT The aim of this study was to evaluate the response of maize to inoculation with strains of plant growth-promoting bacteria (PGPB in two cultivation years. The experiment was set in a randomized block design with four replicates in two cultivation years (2012/13 and 2013/14. The treatments consisted of PGPB inoculation: control (without N and without inoculation; 30 kg of N ha-1 at sowing (N1; 160 kg of N ha-1 (N1 + 130 kg of N ha-1 as top-dressing; N1 + A. brasilense, Ab-V5; N1 + A. brasilense, HM053; N1 + Azospirillum sp. L26; N1 + Azospirillum sp. L27; N1 + Enhydrobacter sp. 4331; N1 + Rhizobium sp. 8121. Basal stem diameter, plant height, leaf area, shoot dry matter and yield were evaluated. The strain of Rhizobium sp. 8121and the isolate Azospirillum sp. L26 associated with 30 kg of N ha-1 at sowing promoted yields equivalent to that of the N fertilization of 160 kg ha-1, demonstrating the potential to be used in the inoculation of maize seeds.

Effect of Inoculating Bradyrhizobium on Phosphorus Use Efficiency ...

African Journals Online (AJOL)

3 School of Natural Resources Management and Environmental Sciences, ..... was produced per unit of P applied by un-inoculated, SB6B1 and Legumefix ... meet the high energy costs for adenosine triphosphate (ATP) synthesis .... Kumar and Kairon (1980) also determined an apparent P .... Prentice Hall, New Jersey.

Inoculation with Azospirillum sp. and Herbaspirillum sp. Bacteria Increases the Tolerance of Maize to Drought Stress.

Science.gov (United States)

Curá, José Alfredo; Franz, Diego Reinaldo; Filosofía, Julián Ezequiel; Balestrasse, Karina Beatríz; Burgueño, Lautaro Exequiel

2017-07-26

Stress drought is an important abiotic factor that leads to immense losses in crop yields around the world. Strategies are urgently needed to help plants adapt to drought in order to mitigate crop losses. Here we investigated the bioprotective effects of inoculating corn grown under drought conditions with two types of plant growth-promoting rhizobacteria (PGPR), A. brasilense , strain SP-7, and H. seropedicae , strain Z-152. Plants inoculated with the bacteria were grown in a greenhouse with perlite as a substrate. Two hydric conditions were tested: normal well-watered conditions and drought conditions. Compared to control non-inoculated plants, those that were inoculated with PGPR bacteria showed a higher tolerance to the negative effects of water stress in drought conditions, with higher biomass production; higher carbon, nitrogen, and chlorophyll levels; and lower levels of abscisic acid and ethylene, which are plant hormones that affect the stress response. The oxidative stress levels of these plants were similar to those of non-inoculated plants grown in well-watered conditions, showing fewer injuries to the cell membrane. We also noted higher relative water content in the vegetal tissue and better osmoregulation in drought conditions in inoculated plants, as reflected by significantly lower proline content. Finally, we observed lower gene expression of ZmVP14 in the inoculated plants; notably, ZmVP14 is involved in the biosynthesis of abscisic acid. Taken together, these results demonstrate that these bacteria could be used to help plants cope with the negative effects of drought stress conditions.

Arbuscular mycorrhizal wheat inoculation promotes alkane and polycyclic aromatic hydrocarbon biodegradation: Microcosm experiment on aged-contaminated soil.

Science.gov (United States)

Ingrid, Lenoir; Lounès-Hadj Sahraoui, Anissa; Frédéric, Laruelle; Yolande, Dalpé; Joël, Fontaine

2016-06-01

Very few studies reported the potential of arbuscular mycorrhizal symbiosis to dissipate hydrocarbons in aged polluted soils. The present work aims to study the efficiency of arbuscular mycorrhizal colonized wheat plants in the dissipation of alkanes and polycyclic aromatic hydrocarbons (PAHs). Our results demonstrated that the inoculation of wheat with Rhizophagus irregularis allowed a better dissipation of PAHs and alkanes after 16 weeks of culture by comparison to non-inoculated condition. These dissipations observed in the inoculated soil resulted from several processes: (i) a light adsorption on roots (0.5% for PAHs), (ii) a bioaccumulation in roots (5.7% for PAHs and 6.6% for alkanes), (iii) a transfer in shoots (0.4 for PAHs and 0.5% for alkanes) and mainly a biodegradation. Whereas PAHs and alkanes degradation rates were respectively estimated to 12 and 47% with non-inoculated wheat, their degradation rates reached 18 and 48% with inoculated wheat. The mycorrhizal inoculation induced an increase of Gram-positive and Gram-negative bacteria by 56 and 37% compared to the non-inoculated wheat. Moreover, an increase of peroxidase activity was assessed in mycorrhizal roots. Taken together, our findings suggested that mycorrhization led to a better hydrocarbon biodegradation in the aged-contaminated soil thanks to a stimulation of telluric bacteria and hydrocarbon metabolization in mycorrhizal roots. Copyright © 2016 Elsevier Ltd. All rights reserved.

Effect of Azospirillum brasilense inoculation on urease activity in soil and gamma-sterilized soil

International Nuclear Information System (INIS)

Perotti, E.B.R.; Pidello, A.

1999-01-01

Azospirillum spp. is considered a PGPR (plant growth promoting rhyzobacteria) bacterium, besides this interest, there is little information about its effects on other functional microbial groups or on soil enzymes. In this paper, the impact that Azospirillum brasilense 7001 inoculation has on urease activity expression in a Typic Argiudoll was studied. Evolution of urease activity of soil and of gamma irradiation (25 KGy) sterilized soil, and the inoculated strain survival were tested. The relation between soil urease activity and soil NH 4 +-N was also determined. In γ-sterilized soil, urease activity of inoculated soil increased with time, showing significant differences with regard to the control soil without inoculum at day 15. In non-sterile soil, urease activity decreased during the studied period in all treatments; in inoculated soil, it showed higher or lower values than the control depending on sampling time. Azospirillum survival was important and different according to soil condition conditions. The negative relation between NH 4 +-N concentration and soil urease activity (r 2 = 0.62) was observed in inoculated soil. The role of the addition of autoclaved inoculum in the urease activity expression is discussed. The research proves that in both studied situations Azospirillum modified soil urease activity, and that the competition with native microorganisms and soil NH 4 +-N may affect this bacterium capacity. (author)

Characteristics of respiratory tract disease in horses inoculated with equine rhinitis A virus.

Science.gov (United States)

Diaz-Méndez, Andrés; Hewson, Joanne; Shewen, Patricia; Nagy, Eva; Viel, Laurent

2014-02-01

To develop a method for experimental induction of equine rhinitis A virus (ERAV) infection in equids and to determine the clinical characteristics of such infection. 8 ponies (age, 8 to 12 months) seronegative for antibodies against ERAV. PROCEDURES-Nebulization was used to administer ERAV (strain ERAV/ON/05; n = 4 ponies) or cell culture medium (control ponies; 4) into airways of ponies; 4 previously ERAV-inoculated ponies were reinoculated 1 year later. Physical examinations and pulmonary function testing were performed at various times for 21 days after ERAV or mock inoculation. Various types of samples were obtained for virus isolation, blood samples were obtained for serologic testing, and clinical scores were determined for various variables. ERAV-inoculated ponies developed respiratory tract disease characterized by pyrexia, nasal discharge, adventitious lung sounds, and enlarged mandibular lymph nodes. Additionally, these animals had purulent mucus in lower airways up to the last evaluation time 21 days after inoculation (detected endoscopically). The virus was isolated from various samples obtained from lower and upper airways of ERAV-inoculated ponies up to 7 days after exposure; this time corresponded with an increase in serum titers of neutralizing antibodies against ERAV. None of the ponies developed clinical signs of disease after reinoculation 1 year later. Results of this study indicated ERAV induced respiratory tract disease in seronegative ponies. However, ponies with neutralizing antibodies against ERAV did not develop clinical signs of disease when reinoculated with the virus. Therefore, immunization of ponies against ERAV could prevent respiratory tract disease attributable to that virus in such animals.

Effects of Rhizobuim leguminosarum inoculation on the growth and ...

African Journals Online (AJOL)

g per plant in 2008 and 2009 seasons, respectively. The findings suggested that inoculation of Mucuna flagellipies with Rhizobium is beneficial and produced high seed yield and could be use as biofertilizer an alternative to nitrogen fertilizer.

Yeast Population Dynamics in Spontaneous and Inoculated Alcoholic Fermentations of Zametovka Must

Directory of Open Access Journals (Sweden)

Franc Cus

2002-01-01

Full Text Available Inoculated fermentations, which are more rapid and more reliable than spontaneous fermentations, and assure predictable wine quality, are nowadays prevalent in Slovenia’s large-scale wine production. However, spontaneous fermentation strengthens local characteristics of wine and offers opportunities for technological innovation. In the 1999 vintage, spontaneous and inoculated fermentations of Zametovka (Vitis vinifera grape must were studied. Zametovka is the main red variety in production of traditional Slovene red blend wine, Cvicek. The diversity of yeast species and strains in both of the investigated fermentations was determined by molecular and traditional identification methods. The outset of alcoholic fermentation, yeast growth kinetics, and yeast population dynamics presents the main differences between the examined fermentations. Yeast population diversity was higher in the spontaneous process. Dominant yeast isolates from spontaneous fermentation were identified as Candida stellata, Hanseniaspora uvarum and Saccharomyces cerevisiae; whereas Saccharomyces bayanus, Pichia kluyveri, Pichia membranifaciens and Torulaspora delbrueckiim were found less frequently. Dominant species in the inoculated fermentation was Saccharomyces cerevisiae; other species found in smaller numbers were Candida stellata, Hanseniaspora uvarum and Debaryomyces hansenii var. hansenii. Using PFGE, we were able to distinguish among 15 different Saccharomyces cerevisiae strains and three different Saccharomyces bayanus strains isolated from spontaneous fermentation, whereas, in the case of inoculated fermentation, only two Saccharomyces cerevisiae strains were found. Their chromosomal patterns coincide with the chromosomal patterns of the starter culture strains.

21 CFR 558.625 - Tylosin.

Science.gov (United States)

2010-04-01

... for use. To aid in the control of chronic respiratory disease caused by Mycoplasma gallisepticum. (c...) Indications for use. To aid in the control of chronic respiratory disease caused by Mycoplasma gallisepticum...) Chickens—(a) Amount per ton. Tylosin, 4-50 grams. (1) Indications for use. For increased rate of weight...

Successful treatment of direct carotid-cavernous fistula in a patient with Ehlers-Danlos syndrome type IV without arterial puncture: the transvenous triple-overlay embolization (TAILOREd) technique.

Science.gov (United States)

Huynh, Thien J; Morton, Ryan P; Levitt, Michael R; Ghodke, Basavaraj V; Wink, Onno; Hallam, Danial K

2017-08-18

We report successful transvenous treatment of direct carotid-cavernous fistula in a patient with Ehlers-Danlos syndrome type IV using a novel triple-overlay embolization (TAILOREd) technique without the need for arterial puncture, which is known to be highly risky in this patient group. The TAILOREd technique allowed for successful treatment using preoperative MR angiography as a three-dimensional overlay roadmap combined with cone beam CT and live fluoroscopy, precluding the need for an arterial puncture. 2017 BMJ Publishing Group Ltd.

Response of rice to inoculation with plant growth promoting rhizobacteria in control lab environment and field experiment

International Nuclear Information System (INIS)

Ahmed, B.

2014-01-01

The present study was conducted to evaluate the effects of bacterial inoculation on different growth parameters of rice variety JP-5. Three bacterial strains (Azospirillum brasilense R1, Azospirillum lipoferum RSWT1 and Pseudomonas Ky1) were used to inoculate rice varietyJP-5 at control lab environment and field. Plant growth promotion was observed in all inoculated treatments over non-inoculated, which was evident from increase in root area, root length, number of tillers, straw and grain yields and total weight of plant. Azospirillum brasilense R1 was more effective in plant growth promotion than other strains and showed 19% increase in the straw weight and 39.5% increase in grain weight. Inoculation with Azospirillum lipoferum RSWT1 and Pseudomonas Ky1 increased grain weight by 18.5% and 13.8% respectively. The study revealed that beneficial strains of PGPR can be used as biofertilizer for rice. (author)

Plant Growth Promotion and Suppression of Bacterial Leaf Blight in Rice by Inoculated Bacteria.

Directory of Open Access Journals (Sweden)

Sumera Yasmin

Full Text Available The present study was conducted to evaluate the potential of rice rhizosphere associated antagonistic bacteria for growth promotion and disease suppression of bacterial leaf blight (BLB. A total of 811 rhizospheric bacteria were isolated and screened against 3 prevalent strains of BLB pathogen Xanthomonas oryzae pv. oryzae (Xoo of which five antagonistic bacteria, i.e., Pseudomonas spp. E227, E233, Rh323, Serratia sp. Rh269 and Bacillus sp. Rh219 showed antagonistic potential (zone of inhibition 1-19 mm. Production of siderophores was found to be the common biocontrol determinant and all the strains solubilized inorganic phosphate (82-116 μg mL-1 and produced indole acetic acid (0.48-1.85 mg L-1 in vitro. All antagonistic bacteria were non-pathogenic to rice, and their co-inoculation significantly improved plant health in terms of reduced diseased leaf area (80%, improved shoot length (31%, root length (41% and plant dry weight (60% as compared to infected control plants. Furthermore, under pathogen pressure, bacterial inoculation resulted in increased activity of defense related enzymes including phenylalanine ammonia-lyase and polyphenol oxidase, along with 86% increase in peroxidase and 53% increase in catalase enzyme activities in plants inoculated with Pseudomonas sp. Rh323 as well as co-inoculated plants. Bacterial strains showed good colonization potential in the rice rhizosphere up to 21 days after seed inoculation. Application of bacterial consortia in the field resulted in an increase of 31% in grain yield and 10% in straw yield over non-inoculated plots. Although, yield increase was statistically non-significant but was accomplished with overall saving of 20% chemical fertilizers. The study showed that Pseudomonas sp. Rh323 can be used to develop dual-purpose inoculum which can serve not only to suppress BLB but also to promote plant growth in rice.

Detection of wood discoloration in a canker fungus-inoculated Japanese cedar by neutron radiography

International Nuclear Information System (INIS)

Yamada, T.; Aoki, Y.; Yamato, M.; Komatsu, M.; Kusumoto, D.; Suzuki, K.; Nakanishi, T.M.

2005-01-01

Neutron radiography (NRG) was applied to trace the development of discolored tissue in the wood of Japanese cedar (Cryptomeria japonica) after being infected with a canker fungus. Japanese cedar seedlings were wound inoculated with a virulent and avirulent isolate of a canker fungus, Guignardia cryptomeriae. Three, 7, 13 and 22 days after the inoculation, the seedlings were irradiated with thermal neutrons. The image on the X-ray film showed that the whiteness in the image corresponded to the water content in the sample. Discolored tissue and surrounding dry zones induced by the fungal inoculation were detected as dark areas, indicating water deficiency with a high resolution. Through image analysis, the dry zones were detected as early as 3 days after inoculation. Neutron images also showed the difference in the size of water deficient parts due to the tissue damage among the treatments. The neutron beam dose used in this experiment had no effect on the growth rate of the fungus on a medium, showing that NRG is an effective method for pathological research of trees. (author)

Structural and ultrastructural studies of the urinary tract of mice inoculated with Lactobacillus fermentum.

Science.gov (United States)

Silva de Ruiz, C; del R Rey, M; Nader-Macías, M E

2003-06-01

To assess, using structural and ultrastructural studies of the urinary tract, the effects of the intraurethral inoculation of lactobacilli (probiotic treatment) as lactobacilli are the predominant micro-organisms of the urogenital tract of humans, monkeys and mice. Previous work showed the protective effect of Lactobacillus fermentum CRL 1058 intraurethrally inoculated against the challenge of uropathogenic Escherichia coli. There was also an effect of oestrogens and antibiotics in the kinetics of colonization of both micro-organisms in mice. In the present study L. fermentum was inoculated with agarose beads (107 colony-forming units) and the number of micro-organisms determined by plating in selective media, giving a high degree of colonization in all the organs studied. The urinary tract organs were processed by histological and electron microscopy techniques standardized in our laboratory. The intraurethral inoculation of lactobacilli produced no adverse effects or significant changes in any of the organs assessed (kidney, ureter, bladder or urethra), when evaluated by histological and ultrastructural techniques. The use of lactobacilli as a probiotic treatment is probably safe.