Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFM148 (Link to dictyBase) - - - Contig-U08795-1 VFM148P (Link... to Original site) VFM148F 479 VFM148Z 710 VFM148P 1169 - - Show VFM148 Library VF (Link to library) Clone ID VFM148 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...YYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLSYGLMS GKIMGEYLDTSSS...(All Frames) Frame A: iylflnqk*fv*ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVR
Akan, Zafer; Körpinar, Mehmet Ali; Tulgar, Metin
2011-06-01
Noise pollution is a common health problem for developing countries. Especially highways and airports lead to noise pollution in different levels and in many frequencies. In this study, we focused on the effect of noise pollution in airports. This work aimed measurements of noise pollution levels in Van Ferit Melen (VFM) airport and effect of noise pollution over the immunoglobulin A, G, and M changes among VFM airport workers in Turkey. It was seen that apron and terminal workers were exposed to high noise (>80 dB(A)) without any protective precautions. Noise-induced temporary threshold shifts and noise-induced permanent threshold shifts were detected between the apron workers (p 0.05). These findings suggested that the noise pollution in the VFM airport could lead to hearing loss and changes in blood serum immunoglobulin levels of airport workers. Blood serum immunoglobulin changes might be due to vibrational effects of noise pollution. Airport workers should apply protective precautions against effect of noise pollution in the VFM airport.
Variable frequency microwave heating apparatus
Energy Technology Data Exchange (ETDEWEB)
Bible, D.W.; Lauf, R.J.; Johnson, A.C.; Thigpen, L.T.
1999-10-05
A variable frequency microwave heating apparatus (10) designed to allow modulation of the frequency of the microwaves introduced into a multi-mode microwave cavity (34) for testing or other selected applications. The variable frequency microwave heating apparatus (10) includes a microwave signal generator (12) and a high-power microwave amplifier (20) or a high-power microwave oscillator (14). A power supply (22) is provided for operation of the high-power microwave oscillator (14) or microwave amplifier (20). A directional coupler (24) is provided for detecting the direction and amplitude of signals incident upon and reflected from the microwave cavity (34). A first power meter (30) is provided for measuring the power delivered to the microwave furnace (32). A second power meter (26) detects the magnitude of reflected power. Reflected power is dissipated in the reflected power load (28).
De Michelis, Paola; Tozzi, Roberta; Consolini, Giuseppe
2017-02-01
From the very first measurements made by the magnetometers onboard Swarm satellites launched by European Space Agency (ESA) in late 2013, it emerged a discrepancy between scalar and vector measurements. An accurate analysis of this phenomenon brought to build an empirical model of the disturbance, highly correlated with the Sun incidence angle, and to correct vector data accordingly. The empirical model adopted by ESA results in a significant decrease in the amplitude of the disturbance affecting VFM measurements so greatly improving the vector magnetic data quality. This study is focused on the characterization of the difference between magnetic field intensity measured by the absolute scalar magnetometer (ASM) and that reconstructed using the vector field magnetometer (VFM) installed on Swarm constellation. Applying empirical mode decomposition method, we find the intrinsic mode functions (IMFs) associated with ASM-VFM total intensity differences obtained with data both uncorrected and corrected for the disturbance correlated with the Sun incidence angle. Surprisingly, no differences are found in the nature of the IMFs embedded in the analyzed signals, being these IMFs characterized by the same dominant periodicities before and after correction. The effect of correction manifests in the decrease in the energy associated with some IMFs contributing to corrected data. Some IMFs identified by analyzing the ASM-VFM intensity discrepancy are characterized by the same dominant periodicities of those obtained by analyzing the temperature fluctuations of the VFM electronic unit. Thus, the disturbance correlated with the Sun incidence angle could be still present in the corrected magnetic data. Furthermore, the ASM-VFM total intensity difference and the VFM electronic unit temperature display a maximal shared information with a time delay that depends on local time. Taken together, these findings may help to relate the features of the observed VFM-ASM total intensity
Microwave Frequency Multiplier
Velazco, J. E.
2017-02-01
High-power microwave radiation is used in the Deep Space Network (DSN) and Goldstone Solar System Radar (GSSR) for uplink communications with spacecraft and for monitoring asteroids and space debris, respectively. Intense X-band (7.1 to 8.6 GHz) microwave signals are produced for these applications via klystron and traveling-wave microwave vacuum tubes. In order to achieve higher data rate communications with spacecraft, the DSN is planning to gradually furnish several of its deep space stations with uplink systems that employ Ka-band (34-GHz) radiation. Also, the next generation of planetary radar, such as Ka-Band Objects Observation and Monitoring (KaBOOM), is considering frequencies in the Ka-band range (34 to 36 GHz) in order to achieve higher target resolution. Current commercial Ka-band sources are limited to power levels that range from hundreds of watts up to a kilowatt and, at the high-power end, tend to suffer from poor reliability. In either case, there is a clear need for stable Ka-band sources that can produce kilowatts of power with high reliability. In this article, we present a new concept for high-power, high-frequency generation (including Ka-band) that we refer to as the microwave frequency multiplier (MFM). The MFM is a two-cavity vacuum tube concept where low-frequency (2 to 8 GHz) power is fed into the input cavity to modulate and accelerate an electron beam. In the second cavity, the modulated electron beam excites and amplifies high-power microwaves at a frequency that is a multiple integer of the input cavity's frequency. Frequency multiplication factors in the 4 to 10 range are being considered for the current application, although higher multiplication factors are feasible. This novel beam-wave interaction allows the MFM to produce high-power, high-frequency radiation with high efficiency. A key feature of the MFM is that it uses significantly larger cavities than its klystron counterparts, thus greatly reducing power density and arcing
VFM Discrimination Results from a Ten Station Network
1980-07-01
Chiang Mai , Thailand (CHTO) from a presumed explosion in eastern Kazakhstan .................... 24 5. Seismogram written at Tatalina, Alaska, for the same...results for the station located at Chiang Mai , Thailand (CHTO) ... .......... . 55 15c. VFM results for the station located at Zongo Valley, Bolivia...seismogram written at the Seismic Research Observatory (SRO) in Chiang Mai , Thailand (CHTO) from a presumed explosion in eastern Kazakhstan. The top is the
Green, C. T.; Liao, L.; Nolan, B. T.; Juckem, P. F.; Ransom, K.; Harter, T.
2017-12-01
Process-based modeling of regional NO3- fluxes to groundwater is critical for understanding and managing water quality. Measurements of atmospheric tracers of groundwater age and dissolved-gas indicators of denitrification progress have potential to improve estimates of NO3- reactive transport processes. This presentation introduces a regionalized version of a vertical flux method (VFM) that uses simple mathematical estimates of advective-dispersive reactive transport with regularization procedures to calibrate estimated tracer concentrations to observed equivalents. The calibrated VFM provides estimates of chemical, hydrologic and reaction parameters (source concentration time series, recharge, effective porosity, dispersivity, reaction rate coefficients) and derived values (e.g. mean unsaturated zone travel time, eventual depth of the NO3- front) for individual wells. Statistical learning methods are used to extrapolate parameters and predictions from wells to continuous areas. The regional VFM was applied to 473 well samples in central-eastern Wisconsin. Chemical measurements included O2, NO3-, N2 from denitrification, and atmospheric tracers of groundwater age including carbon-14, chlorofluorocarbons, tritium, and triogiogenic helium. VFM results were consistent with observed chemistry, and calibrated parameters were in-line with independent estimates. Results indicated that (1) unsaturated zone travel times were a substantial portion of the transit time to wells and streams (2) fractions of N leached to groundwater have changed over time, with increasing fractions from manure and decreasing fractions from fertilizer, and (3) under current practices and conditions, 60% of the shallow aquifer will eventually be affected by NO3- contamination. Based on GIS coverages of variables related to soils, land use and hydrology, the VFM results at individual wells were extrapolated regionally using boosted regression trees, a statistical learning approach, that related
Adhesive bonding using variable frequency microwave energy
Lauf, Robert J.; McMillan, April D.; Paulauskas, Felix L.; Fathi, Zakaryae; Wei, Jianghua
1998-01-01
Methods of facilitating the adhesive bonding of various components with variable frequency microwave energy are disclosed. The time required to cure a polymeric adhesive is decreased by placing components to be bonded via the adhesive in a microwave heating apparatus having a multimode cavity and irradiated with microwaves of varying frequencies. Methods of uniformly heating various articles having conductive fibers disposed therein are provided. Microwave energy may be selectively oriented to enter an edge portion of an article having conductive fibers therein. An edge portion of an article having conductive fibers therein may be selectively shielded from microwave energy.
Wideband Radio Frequency Interference Detection for Microwave Radiometer Subsystem
National Aeronautics and Space Administration — Anthropogenic Radio-Frequency Interference (RFI) is threatening the quality and utility of multi-frequency passive microwave radiometry. The GPM Microwave Imager...
The microwave effects on the properties of alumina at high frequencies of microwave sintering
International Nuclear Information System (INIS)
Sudiana, I. Nyoman; Ngkoimani, La Ode; Usman, Ida; Mitsudo, Seitaro; Sako, Katsuhide; Inagaki, Shunsuke; Aripin, H.
2016-01-01
Microwave sintering of materials has attracted much research interest because of its significant advantages (e.g. reduced sintering temperatures and soaking times) over the conventional heating. Most researchers compared processes that occurred during the microwave and conventional heating at the same temperature and time. The enhancements found in the former method are indicated as a 'non-thermal effect' which is usually used for explaining the phenomena in microwave processing. Numerous recent studies have been focused on the effect to elucidate the microwave interaction mechanism with materials. Moreover, recent progress on microwave sources such as gyrotrons has opened the possibility for processing materials by using a higher microwave frequency. Therefore, the technology is expected to exhibit a stronger non-thermal effect. This paper presents results from a series of experiments to study the non-thermal effect on microwave sintered alumina. Sintering by using a wide rage of microwave frequencies up to 300 GHz as well as a conventional furnace was carried out. The linear shrinkages of samples for each sintering method were measured. Pores and grains taken from scanning electron microstructure (SEM) images of cut surfaces were also examined. The results of a comparative study of the shrinkages and microstructure evolutions of the sintered samples under annealing in microwave heating systems and in an electric furnace were analyzed. A notably different behavior of the shrinkages and microstructures of alumina after being annealed was found. The results suggested that microwave radiations provided an additional force for mass transports. The results also indicated that the sintering process depended on microwave frequencies.
The microwave effects on the properties of alumina at high frequencies of microwave sintering
Energy Technology Data Exchange (ETDEWEB)
Sudiana, I. Nyoman, E-mail: sudiana75@yahoo.com; Ngkoimani, La Ode; Usman, Ida [Department of Physics, Faculty of Mathematic and Natural Science, Halu Oleo University, Kampus Bumi Tridharma Anduonohu, Kendari 93232 (Indonesia); Mitsudo, Seitaro; Sako, Katsuhide; Inagaki, Shunsuke [Research Center for Development of Far-Infrared Region, University of Fukui, 3-9-1 Bunkyo, Fukui-shi 910-8507 (Japan); Aripin, H. [Center for Material Processing and Renewable Energy, Faculty of Learning Teacher and Education Science, Siliwangi University, Jl. Siliwangi 24 Tasikmalaya 46115, West Java (Indonesia)
2016-03-11
Microwave sintering of materials has attracted much research interest because of its significant advantages (e.g. reduced sintering temperatures and soaking times) over the conventional heating. Most researchers compared processes that occurred during the microwave and conventional heating at the same temperature and time. The enhancements found in the former method are indicated as a 'non-thermal effect' which is usually used for explaining the phenomena in microwave processing. Numerous recent studies have been focused on the effect to elucidate the microwave interaction mechanism with materials. Moreover, recent progress on microwave sources such as gyrotrons has opened the possibility for processing materials by using a higher microwave frequency. Therefore, the technology is expected to exhibit a stronger non-thermal effect. This paper presents results from a series of experiments to study the non-thermal effect on microwave sintered alumina. Sintering by using a wide rage of microwave frequencies up to 300 GHz as well as a conventional furnace was carried out. The linear shrinkages of samples for each sintering method were measured. Pores and grains taken from scanning electron microstructure (SEM) images of cut surfaces were also examined. The results of a comparative study of the shrinkages and microstructure evolutions of the sintered samples under annealing in microwave heating systems and in an electric furnace were analyzed. A notably different behavior of the shrinkages and microstructures of alumina after being annealed was found. The results suggested that microwave radiations provided an additional force for mass transports. The results also indicated that the sintering process depended on microwave frequencies.
High-frequency and microwave circuit design
Nelson, Charles
2007-01-01
An integral part of any communications system, high-frequency and microwave design stimulates major progress in the wireless world and continues to serve as a foundation for the commercial wireless products we use every day. The exceptional pace of advancement in developing these systems stipulates that engineers be well versed in multiple areas of electronics engineering. With more illustrations, examples, and worked problems, High-Frequency and Microwave Circuit Design, Second Edition provides engineers with a diverse body of knowledge they can use to meet the needs of this rapidly progressi
Method for curing polymers using variable-frequency microwave heating
Lauf, Robert J.; Bible, Don W.; Paulauskas, Felix L.
1998-01-01
A method for curing polymers (11) incorporating a variable frequency microwave furnace system (10) designed to allow modulation of the frequency of the microwaves introduced into a furnace cavity (34). By varying the frequency of the microwave signal, non-uniformities within the cavity (34) are minimized, thereby achieving a more uniform cure throughout the workpiece (36). A directional coupler (24) is provided for detecting the direction of a signal and further directing the signal depending on the detected direction. A first power meter (30) is provided for measuring the power delivered to the microwave furnace (32). A second power meter (26) detects the magnitude of reflected power. The furnace cavity (34) may be adapted to be used to cure materials defining a continuous sheet or which require compressive forces during curing.
Reducing microwave absorption with fast frequency modulation.
Qin, Juehang; Hubler, A
2017-05-01
We study the response of a two-level quantum system to a chirp signal, using both numerical and analytical methods. The numerical method is based on numerical solutions of the Schrödinger solution of the two-level system, while the analytical method is based on an approximate solution of the same equations. We find that when two-level systems are perturbed by a chirp signal, the peak population of the initially unpopulated state exhibits a high sensitivity to frequency modulation rate. We also find that the aforementioned sensitivity depends on the strength of the forcing, and weaker forcings result in a higher sensitivity, where the frequency modulation rate required to produce the same reduction in peak population would be lower. We discuss potential applications of this result in the field of microwave power transmission, as it shows applying fast frequency modulation to transmitted microwaves used for power transmission could decrease unintended absorption of microwaves by organic tissue.
Utilization of multiple frequencies in 3D nonlinear microwave imaging
DEFF Research Database (Denmark)
Jensen, Peter Damsgaard; Rubæk, Tonny; Mohr, Johan Jacob
2012-01-01
The use of multiple frequencies in a nonlinear microwave algorithm is considered. Using multiple frequencies allows for obtaining the improved resolution available at the higher frequencies while retaining the regularizing effects of the lower frequencies. However, a number of different challenges...... at lower frequencies are used as starting guesses for reconstructions at higher frequencies. The performance is illustrated using simulated 2-D data and data obtained with the 3-D DTU microwave imaging system....
International Nuclear Information System (INIS)
Takahashi, Masayuki; Ohnishi, Naofumi
2016-01-01
A filamentary plasma is reproduced based on a fully kinetic model of electron and ion transports coupled with electromagnetic wave propagation. The discharge plasma transits from discrete to diffusive patterns at a 110-GHz breakdown, with decrease in the ambient pressure, because of the rapid electron diffusion that occurs during an increase in the propagation speed of the ionization front. A discrete plasma is obtained at low pressures when a low-frequency microwave is irradiated because the ionization process becomes more dominant than the electron diffusion, when the electrons are effectively heated by the low-frequency microwave. The propagation speed of the plasma increases with decrease in the incident microwave frequency because of the higher ionization frequency and faster plasma diffusion resulting from the increase in the energy-absorption rate. An external magnetic field is applied to the breakdown volume, which induces plasma filamentation at lower pressures because the electron diffusion is suppressed by the magnetic field. The thrust performance of a microwave rocket is improved by the magnetic fields corresponding to the electron cyclotron resonance (ECR) and its higher-harmonic heating, because slower propagation of the ionization front and larger energy-absorption rates are obtained at lower pressures. It would be advantageous if the fundamental mode of ECR heating is coupled with a lower frequency microwave instead of combining the higher-harmonic ECR heating with the higher frequency microwave. This can improve the thrust performance with smaller magnetic fields even if the propagation speed increases because of the decrease in the incident microwave frequency.
Energy Technology Data Exchange (ETDEWEB)
Takahashi, Masayuki, E-mail: m.takahashi@al.t.u-tokyo.ac.jp [Department of Aeronautics and Astronautics, The University of Tokyo, Bunkyo-ku 113-8656 (Japan); Ohnishi, Naofumi [Department of Aerospace Engineering, Tohoku University, Sendai 980-8579 (Japan)
2016-08-14
A filamentary plasma is reproduced based on a fully kinetic model of electron and ion transports coupled with electromagnetic wave propagation. The discharge plasma transits from discrete to diffusive patterns at a 110-GHz breakdown, with decrease in the ambient pressure, because of the rapid electron diffusion that occurs during an increase in the propagation speed of the ionization front. A discrete plasma is obtained at low pressures when a low-frequency microwave is irradiated because the ionization process becomes more dominant than the electron diffusion, when the electrons are effectively heated by the low-frequency microwave. The propagation speed of the plasma increases with decrease in the incident microwave frequency because of the higher ionization frequency and faster plasma diffusion resulting from the increase in the energy-absorption rate. An external magnetic field is applied to the breakdown volume, which induces plasma filamentation at lower pressures because the electron diffusion is suppressed by the magnetic field. The thrust performance of a microwave rocket is improved by the magnetic fields corresponding to the electron cyclotron resonance (ECR) and its higher-harmonic heating, because slower propagation of the ionization front and larger energy-absorption rates are obtained at lower pressures. It would be advantageous if the fundamental mode of ECR heating is coupled with a lower frequency microwave instead of combining the higher-harmonic ECR heating with the higher frequency microwave. This can improve the thrust performance with smaller magnetic fields even if the propagation speed increases because of the decrease in the incident microwave frequency.
Highly stable microwave carrier generation using a dual-frequency distributed feedback laser
Khan, M.R.H.; Bernhardi, Edward; Marpaung, D.A.I.; Burla, M.; de Ridder, R.M.; Worhoff, Kerstin; Pollnau, Markus; Roeloffzen, C.G.H.
2012-01-01
Photonic generation of microwave carriers by using a dual-frequency distributed feedback waveguide laser in ytterbium-doped aluminum oxide is demonstrated. A highperformance optical frequency locked loop is implemented to stabilize the microwave carrier. This approach results in a microwave
High-efficiency water-loaded microwave antenna in ultra-high-frequency band
Gong, Zilun; Bartone, Chris; Yang, Fuyi; Yao, Jie
2018-03-01
High-index dielectrics are widely used in microwave antennas to control the radiation characteristics. Liquid water, with a high dielectric index at microwave frequency, is an interesting material to achieving tunable functionalities. Here, we demonstrate a water-loaded microwave antenna system that has high loss-tolerance and wideband tunability enabled by fluidity. Our simulation and experimental results show that the resonance frequency can be effectively tuned by the size of loading water. Furthermore, the antenna systems with water loading can achieve high radiation efficiency (>90%) in the ultra-high-frequency (0.3-3 GHz) band. This work brings about opportunities in realistic tunable microwave antenna designs enabled by liquid.
Multikilowatt variable frequency microwave furnace
International Nuclear Information System (INIS)
Bible, D.W.; Lauf, R.J.; Everleigh, C.A.
1992-01-01
In this paper, the authors describe a new type of microwave processing furnace in which the frequency can be varied continuously from 4 to 8 GHz and the power level varied from zero up to 2.5 kW. The extraordinary bandwidth of this furnace is achieved by using a traveling wave tube (TWT) amplifier originally developed for electronic warfare applications. The TWT is a linear beam device characterized by a traveling electromagnetic wave that continuously extracts energy longitudinally along the path of an electron beam. The TWT, unlike other microwave tubes such as the magnetron, klystron, gyrotron, and others, does not depend upon resonant RF fields and is therefore capable of wide bandwidth operation.operation
Millimeter-wave interconnects for microwave-frequency quantum machines
Pechal, Marek; Safavi-Naeini, Amir H.
2017-10-01
Superconducting microwave circuits form a versatile platform for storing and manipulating quantum information. A major challenge to further scalability is to find approaches for connecting these systems over long distances and at high rates. One approach is to convert the quantum state of a microwave circuit to optical photons that can be transmitted over kilometers at room temperature with little loss. Many proposals for electro-optic conversion between microwave and optics use optical driving of a weak three-wave mixing nonlinearity to convert the frequency of an excitation. Residual absorption of this optical pump leads to heating, which is problematic at cryogenic temperatures. Here we propose an alternative approach where a nonlinear superconducting circuit is driven to interconvert between microwave-frequency (7 ×109 Hz) and millimeter-wave-frequency photons (3 ×1011 Hz). To understand the potential for quantum state conversion between microwave and millimeter-wave photons, we consider the driven four-wave mixing quantum dynamics of nonlinear circuits. In contrast to the linear dynamics of the driven three-wave mixing converters, the proposed four-wave mixing converter has nonlinear decoherence channels that lead to a more complex parameter space of couplings and pump powers that we map out. We consider physical realizations of such converter circuits by deriving theoretically the upper bound on the maximum obtainable nonlinear coupling between any two modes in a lossless circuit, and synthesizing an optimal circuit based on realistic materials that saturates this bound. Our proposed circuit dissipates less than 10-9 times the energy of current electro-optic converters per qubit. Finally, we outline the quantum link budget for optical, microwave, and millimeter-wave connections, showing that our approach is viable for realizing interconnected quantum processors for intracity or quantum data center environments.
Dielectric characterization of materials at microwave frequency range
Directory of Open Access Journals (Sweden)
J. de los Santos
2003-01-01
Full Text Available In this study a coaxial line was used to connect a microwave-frequency Network Analyzer and a base moving sample holder for dielectric characterization of ferroelectric materials in the microwave range. The main innovation of the technique is the introduction of a special sample holder that eliminates the air gap effect by pressing sample using a fine pressure system control. The device was preliminary tested with alumina (Al2O3 ceramics and validated up to 2 GHz. Dielectric measurements of lanthanum and manganese modified lead titanate (PLTM ceramics were carried out in order to evaluate the technique for a high permittivity material in the microwave range. Results showed that such method is very useful for materials with high dielectric permittivities, which is generally a limiting factor of other techniques in the frequency range from 50 MHz to 2 GHz.
High-Frequency Microwave Processing of Materials Laboratory
Federal Laboratory Consortium — FUNCTION: Conducts research on high-frequency microwave processing of materials using a highpower, continuous-wave (CW), 83-GHz, quasi-optical beam system for rapid,...
Vibrational resonances in biological systems at microwave frequencies.
Adair, Robert K
2002-03-01
Many biological systems can be expected to exhibit resonance behavior involving the mechanical vibration of system elements. The natural frequencies of such resonances will, generally, be in the microwave frequency range. Some of these systems will be coupled to the electromagnetic field by the charge distributions they carry, thus admitting the possibility that microwave exposures may generate physiological effects in man and other species. However, such microwave excitable resonances are expected to be strongly damped by interaction with their aqueous biological environment. Although those dissipation mechanisms have been studied, the limitations on energy transfers that follow from the limited coupling of these resonances to the electromagnetic field have not generally been considered. We show that this coupling must generally be very small and thus the absorbed energy is so strongly limited that such resonances cannot affect biology significantly even if the systems are much less strongly damped than expected from basic dissipation models.
Automated electronic intruder simulator for evaluation of odd frequency microwave detectors
International Nuclear Information System (INIS)
1979-01-01
A microwave intruder simulator for testing motion detection sensors is described. This simulator can be used to evaluate a variety of microwave sensors regardless of the value of the center frequency of the signal utilized. Representative curves from the evaluation of one microwave sensor are also presented
Design and analysis of planar spiral resonator bandstop filter for microwave frequency
Motakabber, S. M. A.; Shaifudin Suharsono, Muhammad
2017-11-01
In microwave frequency, a spiral resonator can act as either frequency reject or acceptor circuits. A planar logarithmic spiral resonator bandstop filter has been developed based on this property. This project focuses on the rejection property of the spiral resonator. The performance analysis of the exhibited filter circuit has been performed by using scattering parameters (S-parameters) technique in the ultra-wideband microwave frequency. The proposed filter is built, simulated and S-parameters analysis have been accomplished by using electromagnetic simulation software CST microwave studio. The commercial microwave substrate Taconic TLX-8 has been used to build this filter. Experimental results showed that the -10 dB rejection bandwidth of the filter is 2.32 GHz and central frequency is 5.72 GHz which is suitable for ultra-wideband applications. The proposed design has been full of good compliance with the simulated and experimental results here.
Nanoelectromechanical systems: Nanodevice motion at microwave frequencies
Henry Huang, Xue Ming; Zorman, Christian A.; Mehregany, Mehran; Roukes, Michael L.
2003-01-01
It has been almost forgotten that the first computers envisaged by Charles Babbage in the early 1800s were mechanical and not electronic, but the development of high-frequency nanoelectromechanical systems is now promising a range of new applications, including sensitive mechanical charge detectors and mechanical devices for high-frequency signal processing, biological imaging and quantum measurement. Here we describe the construction of nanodevices that will operate with fundamental frequencies in the previously inaccessible microwave range (greater than 1 gigahertz). This achievement represents a significant advance in the quest for extremely high-frequency nanoelectromechanical systems.
Intense high-frequency gyrotron-based microwave beams for material processing
Energy Technology Data Exchange (ETDEWEB)
Hardek, T.W.; Cooke, W.D.; Katz, J.D.; Perry, W.L.; Rees, D.E.
1997-03-01
Microwave processing of materials has traditionally utilized frequencies in the 0.915 and 2.45 GHz regions. Microwave power sources are readily available at these frequencies but the relatively long wavelengths can present challenges in uniformly heating materials. An additional difficulty is the poor coupling of ceramic based materials to the microwave energy. Los Alamos National Laboratory scientists, working in conjunction with the National Center for Manufacturing Sciences (NCMS), have assembled a high-frequency demonstration processing facility utilizing gyrotron based RF sources. The facility is primarily intended to demonstrate the unique features available at frequencies as high as 84 GHz. The authors can readily provide quasi-optical, 37 GHz beams at continuous wave (CW) power levels in the 10 kW range. They have also provided beams at 84 GHz at 10 kW CW power levels. They are presently preparing a facility to demonstrate the sintering of ceramics at 30 GHz. This paper presents an overview of the present demonstration processing facility and describes some of the features they have available now and will have available in the near future.
Large enhancement of deuteron polarization with frequency modulated microwaves
AUTHOR|(CDS)2067425; Arik, S; Arvidson, A; Badelek, B; Ballintijn, M K; Bardin,; Baum, G; Berglund, P; Betev, L; Birda, I G; Birsa, R; Bjrkholm, P; Bonner, B E; de Botton, N; Boutemeur, M; Bradamante, Franco; Bressan, A; Brullc, A; Buchanan, J; Bültmann, S; Burtin, E; Cavata, C; Chen, J P; Clement, J; Clocchiatti, M; Corcoran, M D; Crabb, D; Cranshaw, J; Çuhadar-Dönszelmann, T; Deshpande, S; Dalla Torre, A; Van Dantzig, R; Dhawan, S; Dulya, C; Dyring, A; Eichblatt, S; Faivre, Jean-Claude; Fasching, D; Day, D; Feinstein, F; Fernández, C; Frois, B; Garabatos, C; Garzón, J A; Gaussiran, T; Giorgi, M; von Goeler, E; Goloutvin, Igor A; Gómez, A; Gracia, G; De Groot, N; Grosse-Perdekamp, M; Gülmez, E; Hasegawa, T; Hautle, P; Hayashi, N; Heusch, C A; Horikawa, D; von Harrach, N; Hughes, V W; Igo, G; Ishimoto, S; Iwata, T; De Jong, M; Kabu, E M; Kageya, T; Kaiser, R; Karev, A; Kessler, H J; Ketel, T J; Kiryushin, Yu T; Kishi, A; Kisselev, Yu; Klostermann, L; Krämer, Dietrich; Kukhtin, V; Kyynarinen, J; Lamanna, M; Landgraf, U; Lau, V; Krivokhijinea, K; Layda, T; Le Go, J M; Lehár, F; de Lesquen, A; Lichtenstadt, J; Lindqvist, T; Litmaath, M; López-Ponte, S; Loewe, M; Magnon, A; Mallot, G K; Marie, F; Martin, A; Martino, J; Matsuda, T; Mayes, B; McCarthy, J S; van Middelkoop, K; Medved, G; Miller, D; Mitchell, J; Mori, K; Moromisato, J; Mutchler, G S; Nagaitsev, A; Nassalski, J; Naumann, Lutz; Neganov, B; Niinikoski, T O; Oberski, J E J; Ogawa, A; Okumi, S; Ozben, C S; Penzo, Aldo L; Pérez, C A; Perrot-Kunne, F; Piegaia, R; Pinsky, L; Platchkov, S; Pló, M; Pose, D; Postma, D; Peshekhonov, H; Pretz, J; Pussieux, T; Pyrlik, J; Reyhancan, I; Rieubland, Jean Michel; Rijllart, A; Roberts, J B; Rock, S E; Rodríguez, M; Rondio, E; Rondon, O; Ropelewski, Leszek; Rosado, A; Sabo, I; Saborido, J; Salvato, G; Sandacz, A; Sanders, D; Savin, I; Schiavon, Paolo; Schüler, K P; Segel, R; Seitz, R; Semertzidis, Y; Sergeev, S; Sever, F; Shanahan, P; Sichtermann, E P; Smirnov, G; Staude, A; Steinmetz, A; Stuhrmann, H; Teichert, K M; Tessarotto, F; Thiel, W; Velasco, M; Vogt, J; Voss, R; Weinstein, R; Whitten, C; Willumeit, R; Windmolders, R; Wislicki, W; Witzmann, A; Yañez, A; Zanetti, A M; Zhao, J; Zamiatin, N I
1996-01-01
We report a large enhancement of 1.7 in deuteron polarization up to values of 0.6 due to frequency modulation of the polarizing microwaves in a two liters polarized target using the method of dynamic nuclear polarization. This target was used during a deep inelastic polarized muon-deuteron scattering experiment at CERN. Measurements of the electron paramagnetic resonance absorption spectra show that frequency modulation gives rise to additional microwave absorption in the spectral wings. Although these results are not understood theoretically, they may provide a useful testing ground for the deeper understanding of dynamic nuclear polarization.
Broadband microwave frequency doubler based on left-handed nonlinear transmission lines
International Nuclear Information System (INIS)
Huang Jie; Gu Wenwen; Zhao Qian
2017-01-01
A bandwidth microwave second harmonic generator is successfully designed using composite right/left-handed nonlinear transmission lines (CRLH NLTLs) in a GaAs monolithic microwave integrated circuit (MMIC) technology. The structure parameters of CRLH NLTLs, e.g. host transmission line, rectangular spiral inductor, and nonlinear capacitor, have a great impact on the second harmonic performance enhancement in terms of second harmonic frequency, output power, and conversion efficiency. It has been experimentally demonstrated that the second harmonic frequency is determined by the anomalous dispersion of CRLH NLTLs and can be significantly improved by effectively adjusting these structure parameters. A good agreement between the measured and simulated second harmonic performances of Ka-band CRLH NLTLs frequency multipliers is successfully achieved, which further validates the design approach of frequency multipliers on CRLH NLTLs and indicates the potentials of CRLH NLTLs in terms of the generation of microwave and millimeter-wave signal source. (paper)
High-power microwave generation from a frequency-stabilized virtual cathode source
International Nuclear Information System (INIS)
Fazio, M.V.; Hoeberling, R.F.; Kinross-Wright, J.
1988-01-01
The evolution of virtual cathode based high-power microwave-source technology has been directed primarily toward achieving higher peak-power levels. As peak powers in excess of 10 GW have been reported, attention has begun to focus on techniques for producing a more frequency- and phase-stable virtual cathode source. Free-running virtual cathode microwave sources characteristically exhibit bandwidths in a single pulse of tens of percent, which makes them unsuitable for many applications such as power sources for phased array antennas and microwave linear accelerators. Presented here are results of an experimental approach utilizing a high-Q, resonant cavity surrounding the oscillating virtual cathode to achieve frequency stabilization and repeatable narrow-band operation. A cylindrical cavity resonator is used with the microwave power being extracted radially through circumferential slot apertures into L-band waveguide
Monitoring and control system for tuneable high frequency microwave assisted chemistry
International Nuclear Information System (INIS)
Lewis, G P; Wylie, S R; Shaw, A; Al-Shamma'a, A I; Phipps, D; Alkhaddar, R; Bond, G
2007-01-01
Microwave chemistry is an established technique in the synthesis of organic compounds at a frequency of 2.45 GHz. This is considered to be a result of the development of microwave ovens, rather than an objective solution, which maximises efficiency through careful selection of the operating frequency. To obtain a frequency for a dielectric, the complex permittivity should be determined as a function of frequency. If the correct heating frequency is found, superheating can occur when a liquid solvent reaches its boiling point and exceeds it. This paper presents sensor diodes and temperature sensors used in a mono-mode reactor, with computer control of an E-H tuner, frequency and incident power to control temperature and power, experimental results showing heating and reactions using ethanol are reported
Suto, Hirofumi; Kanao, Taro; Nagasawa, Tazumi; Mizushima, Koichi; Sato, Rie
2018-05-01
Microwave-assisted magnetization switching (MAS) is attracting attention as a method for reversing nanomagnets with a high magnetic anisotropy by using a small-amplitude magnetic field. We experimentally study MAS of a perpendicularly magnetized nanomagnet by applying a microwave magnetic field with a time-varying frequency. Because the microwave field frequency can follow the nonlinear decrease of the resonance frequency, larger magnetization excitation than that in a constant-frequency microwave field is induced, which enhances the MAS effect. The switching field decreases almost linearly as the start value of the time-varying microwave field frequency increases, and it becomes smaller than the minimum switching field in a constant-frequency microwave field. To obtain this enhancement of the MAS effect, the end value of the time-varying microwave field frequency needs to be almost the same as or lower than the critical frequency for MAS in a constant-frequency microwave field. In addition, the frequency change typically needs to take 1 ns or longer to make the rate of change slow enough for the magnetization to follow the frequency change. This switching behavior is qualitatively explained by the theory based on the macrospin model.
Nonreciprocal frequency conversion in a multimode microwave optomechanical circuit
Feofanov, A. K.; Bernier, N. R.; Toth, L. D.; Koottandavida, A.; Kippenberg, T. J.
Nonreciprocal devices such as isolators, circulators, and directional amplifiers are pivotal to quantum signal processing with superconducting circuits. In the microwave domain, commercially available nonreciprocal devices are based on ferrite materials. They are barely compatible with superconducting quantum circuits, lossy, and cannot be integrated on chip. Significant potential exists for implementing non-magnetic chip-scale nonreciprocal devices using microwave optomechanical circuits. Here we demonstrate a possibility of nonreciprocal frequency conversion in a multimode microwave optomechanical circuit using solely optomechanical interaction between modes. The conversion scheme and the results reflecting the actual progress on the experimental implementation of the scheme will be presented.
Murasawa, Kengo; Sato, Koki; Hidaka, Takehiko
2011-05-01
A new method for measuring optical-beat frequencies in the terahertz (THz) region using microwave higher harmonics is presented. A microwave signal was applied to the antenna gap of a photoconductive (PC) device emitting a continuous electromagnetic wave at about 1 THz by the photomixing technique. The microwave higher harmonics with THz frequencies are generated in the PC device owing to the nonlinearity of the biased photoconductance, which is briefly described in this article. Thirteen nearly periodic peaks in the photocurrent were observed when the microwave was swept from 16 to 20 GHz at a power of -48 dBm. The nearly periodic peaks are generated by the homodyne detection of the optical beat with the microwave higher harmonics when the frequency of the harmonics coincides with the optical-beat frequency. Each peak frequency and its peak width were determined by fitting a Gaussian function, and the order of microwave harmonics was determined using a coarse (i.e., lower resolution) measurement of the optical-beat frequency. By applying the Kalman algorithm to the peak frequencies of the higher harmonics and their standard deviations, the optical-beat frequency near 1 THz was estimated to be 1029.81 GHz with the standard deviation of 0.82 GHz. The proposed method is applicable to a conventional THz-wave generator with a photomixer.
Soran, Maria-Loredana; Stan, Manuela; Niinemets, Ülo; Copolovici, Lucian
2014-09-15
Influence of environmental stress factors on both crop and wild plants of nutritional value is an important research topic. The past research has focused on rising temperatures, drought, soil salinity and toxicity, but the potential effects of increased environmental contamination by human-generated electromagnetic radiation on plants have little been studied. Here we studied the influence of microwave irradiation at bands corresponding to wireless router (WLAN) and mobile devices (GSM) on leaf anatomy, essential oil content and volatile emissions in Petroselinum crispum, Apium graveolens and Anethum graveolens. Microwave irradiation resulted in thinner cell walls, smaller chloroplasts and mitochondria, and enhanced emissions of volatile compounds, in particular, monoterpenes and green leaf volatiles (GLV). These effects were stronger for WLAN-frequency microwaves. Essential oil content was enhanced by GSM-frequency microwaves, but the effect of WLAN-frequency microwaves was inhibitory. There was a direct relationship between microwave-induced structural and chemical modifications of the three plant species studied. These data collectively demonstrate that human-generated microwave pollution can potentially constitute a stress to the plants. Copyright © 2014 Elsevier GmbH. All rights reserved.
Soran, Maria-Loredana; Stan, Manuela; Niinemets, Ülo; Copolovici, Lucian
2015-01-01
Influence of environmental stress factors on both crop and wild plants of nutritional value is an important research topic. The past research has focused on rising temperatures, drought, soil salinity and toxicity, but the potential effects of increased environmental contamination by human-generated electromagnetic radiation on plants have little been studied. Here we studied the influence of microwave irradiation at bands corresponding to wireless router (WLAN) and mobile devices (GSM) on leaf anatomy, essential oil content and volatile emissions in Petroselinum crispum, Apium graveolens and Anethum graveolens. Microwave irradiation resulted in thinner cell walls, smaller chloroplasts and mitochondria, and enhanced emissions of volatile compounds, in particular, monoterpenes and green leaf volatiles. These effects were stronger for WLAN-frequency microwaves. Essential oil content was enhanced by GSM-frequency microwaves, but the effect of WLAN-frequency microwaves was inhibitory. There was a direct relationship between microwave-induced structural and chemical modifications of the three plant species studied. These data collectively demonstrate that human-generated microwave pollution can potentially constitute a stress to the plants. PMID:25050479
Microwave Frequency Comb from a Semiconductor in a Scanning Tunneling Microscope.
Hagmann, Mark J; Yarotski, Dmitry A; Mousa, Marwan S
2017-04-01
Quasi-periodic excitation of the tunneling junction in a scanning tunneling microscope, by a mode-locked ultrafast laser, superimposes a regular sequence of 15 fs pulses on the DC tunneling current. In the frequency domain, this is a frequency comb with harmonics at integer multiples of the laser pulse repetition frequency. With a gold sample the 200th harmonic at 14.85 GHz has a signal-to-noise ratio of 25 dB, and the power at each harmonic varies inversely with the square of the frequency. Now we report the first measurements with a semiconductor where the laser photon energy must be less than the bandgap energy of the semiconductor; the microwave frequency comb must be measured within 200 μm of the tunneling junction; and the microwave power is 25 dB below that with a metal sample and falls off more rapidly at the higher harmonics. Our results suggest that the measured attenuation of the microwave harmonics is sensitive to the semiconductor spreading resistance within 1 nm of the tunneling junction. This approach may enable sub-nanometer carrier profiling of semiconductors without requiring the diamond nanoprobes in scanning spreading resistance microscopy.
International Nuclear Information System (INIS)
Yuan Zhongcai; Shi Jiaming; Xu Bo
2005-01-01
The plasma diagnostic method using the transmission attenuation of microwaves at double frequencies (PDMUTAMDF) indicates that the frequency and the electron-neutral collision frequency of the plasma can be deduced by utilizing the transmission attenuation of microwaves at two neighboring frequencies in a non-magnetized plasma. Then the electron density can be obtained from the plasma frequency. The PDMUTAMDF is a simple method to diagnose the plasma indirectly. In this paper, the interaction of electromagnetic waves and the plasma is analyzed. Then, based on the attenuation and the phase shift of a microwave in the plasma, the principle of the PDMUTAMDF is presented. With the diagnostic method, the spatially mean electron density and electron collision frequency of the plasma can be obtained. This method is suitable for the elementary diagnosis of the atmospheric-pressure plasma
High-frequency and microwave heating as a pretreatment to kiln drying of hollowed-out timber
International Nuclear Information System (INIS)
Yamada, N.; Okumura, S.; Taniguchi, Y.
2001-01-01
To dry hollowed-out timber without V-shaped drying checks, its inner part should be dried faster than the outer part. The feasibility of high frequency heating and microwave heating as a pretreatment of kiln drying of hollow timber was examined. During high frequency heating, the top and bottom parts of the timber were dried faster than the right and left parts because the central hollow acts as an air-gap. The outer part dried faster than the inner part during microwave heating, probably because of insufficient penetration of microwave energy into the inner part. The uneven heating of hollowed timber was improved by turning the specimen around its axis during high frequency heating and by setting the specimen upright in the microwave oven
Perera, Gonaduwage; Johnson, Ian; Keller, Dustin
2017-09-01
Dynamic Nuclear Polarization (DNP) is used in most of the solid polarized target scattering experiments. Those target materials must be irradiated using microwaves at a frequency determined by the difference in the nuclear Larmor and electron paramagnetic resonance (EPR) frequencies. But the resonance frequency changes with time as a result of radiation damage. Hence the microwave frequency should be adjusted accordingly. Manually adjusting the frequency can be difficult, and improper adjustments negatively impact the polarization. In order to overcome these difficulties, two controllers were developed which automate the process of seeking and maintaining the optimal frequency: one being a standalone controller for a traditional DC motor and the other a LabVIEW VI for a stepper motor configuration. Further a Monte-Carlo simulation was developed which can accurately model the polarization over time as a function of microwave frequency. In this talk, analysis of the simulated data and recent improvements to the automated system will be presented. DOE.
The microwave absorbing properties of ZnO/Fe3O4/paraffin composites in low frequency band
Yin, Pengfei; Deng, Yu; Zhang, Limin; Huang, Juan; Li, Huayao; Li, Youhongyu; Qi, Yali; Tao, Yu
2018-02-01
ZnO/Fe3O4/paraffin composites with good microwave absorption performance in low frequency band were prepared by physical blending technology. The morphology, phase structures, frequency-dependent electromagnetic and microwave absorbing properties of the composites were investigated. The results showed that the addition content of ZnO can adjust the microwave absorbing properties i.e. the position, intensity, and absorption bandwidth of composites, and the synergetic consequence of dielectric loss and magnetic loss is the main microwave absorption mechanism of the composites. The bandwidths with RL below -10 dB over different frequency ranges were obtained in the low frequency range of 0.5 ˜ 3 GHz at a thickness of 5 mm, e.g. 0.93 GHz from 1.59 to 2.52 GHz and 0.85 GHz from 1.26 to 2.11 GHz corresponding to the mass ratios of ZnO and Fe3O4 are 1:2 and 1:4, respectively. Thus, such absorbers can be applied as effective microwave absorbers in low frequency range of 0.5 ˜ 3 GHz.
On chip frequency discriminator for microwave photonics signal processing
Marpaung, D.A.I.; Roeloffzen, C.G.H.
2012-01-01
Microwave photonics (MWP) techniques for the generation, distribution and pro- cessing of radio frequency (RF) signals have enjoyed a surge of interest in the last few years. The workhorse behind these MWP functionalities is a high performance MWP link. Such a link needs to fulfill several criteria
Ivanov, Eugene
2010-03-01
The quest to detect Gravitational Waves resulted in a number of important developments in the fields of oscillator frequency stabilization and precision noise measurements. This was due to the realization of similarities between the principles of high sensitivity measurements of weak mechanical forces and phase/amplitude fluctuations of microwave signals. In both cases interferometric carrier suppression and low-noise amplification of the residual noise sidebands were the main factors behind significant improvements in the resolution of spectral measurements. In particular, microwave frequency discriminators with almost thermal noise limited sensitivity were constructed leading to microwave oscillators with more than 25dB lower phase noise than the previous state-of-the-art. High power solid-state microwave amplifiers offered further opportunity of oscillator phase noise reduction due to the increased energy stored in the high-Q resonator of the frequency discriminator. High power microwave oscillators with the phase noise spectral density close to -160dBc/Hz at 1kHz Fourier frequency have been recently demonstrated. The principles of interferometric signal processing have been applied to the study of noise phenomena in microwave components which were considered to be ``noise free''. This resulted in the first experimental evidence of phase fluctuations in microwave circulators. More efficient use of signal power enabled construction of the ``power recycled'' interferometers with spectral resolution of -200dBc/Hz at 1kHz Fourier frequency. This has been lately superseded by an order of magnitude with a waveguide interferometer due to its higher power recycling factor. A number of opto-electronic measurement systems were developed to characterize the fidelity of frequency transfer from the optical to the microwave domain. This included a new type of a phase detector capable of measuring phase fluctuations of the weak microwave signals extracted from the demodulated
Microwave generation and frequency conversion using intense relativistic electron beams
International Nuclear Information System (INIS)
Buzzi, J.M.; Doucet, H.J.; Etlicher, B.
1977-01-01
Some aspects of the microwave generation and frequency conversion by relativistic electron beams are studied. Using an electron synchrotron maser, the excitation of microwaves by an annular relativistic electron beam propagating through a circular wave guide immersed in a longitudinal magnetic field is analyzed. This theoretical model is somewhat more realistic than the previous one because the guiding centers are not on the wave guide axis. Microwave reflection is observed on a R.E.B. front propagating into a gas filled waveguide. The frequency conversion from the incident X-band e.m. waves and the reflected Ka band observed signal is consistent with the Doppler model for β = 0.7. This value agrees with the average beam front velocity as measured from time-of-flight using two B/sub theta/ probes. The reflection is found to occur during the current rise time. With a low impedance device (2 Ω, 400 keV) a GW X-band emission has been observed using thin anodes and a gas filled waveguide. This emission is probably due to the self-fields of the beam and could be used as a diagnostic
Dielectric properties of materials at microwave frequencies
Directory of Open Access Journals (Sweden)
Ivo Křivánek
2008-01-01
Full Text Available The paper introduces the review of the present state of art in the measurement of the interaction of electromagnetic waves with different kinds of materials. It is analysis of the possibilities of the measurement of the interaction of high frequencies waves (microwaves with materials and proposal of the experimental method for the studies mentioned above.The electromagnetic field consists of two components: electric and magnetic field. The influence of these components on materials is different. The influence of the magnetic field is negligible and it has no impact on practical use. The influence of the electric field is strong as the interaction between them results in the creation of electric currents in the material (Křivánek and Buchar, 1993.Experiments focused on the evaluation of the complex dielectric permitivity of different materials have been performed. The permitivity of solid material is also measurable by phasemethod, when the specimen is a part of transmission sub-circuit. Microwave instrument for complex permittivity measurement works in X frequency band (8.2–12.5 GHz, the frequency 10.1 GHz was used for all the measurement in the laboratory of physics, Mendel University in Brno. The extensive number of experimental data have been obtained for different materials. The length of the square side of the aerial open end was 50 mm and internal dimensions of waveguides were 23 mm × 10 mm. The samples have form of the plate shape with dimensions 150 mm × 150 mm × 4 mm.
Hou, D.; Xie, X. P.; Zhang, Y. L.; Wu, J. T.; Chen, Z. Y.; Zhao, J. Y.
2013-12-01
Optical frequency combs (OFCs), based on mode-locked lasers (MLLs), have attracted considerable attention in many fields over recent years. Among the applications of OFCs, one of the most challenging works is the extraction of a highly stable microwave with low phase noise. Many synchronisation schemes have been exploited to synchronise an electronic oscillator with the pulse train from a MLL, helping to extract an ultra-stable microwave. Here, we demonstrate novel wideband microwave extraction from a stable OFC by synchronising a single widely tunable optoelectronic oscillator (OEO) with an OFC at different harmonic frequencies, using an optical phase detection technique. The tunable range of the proposed microwave extraction extends from 2 GHz to 4 GHz, and in a long-term synchronisation experiment over 12 hours, the proposed synchronisation scheme provided a rms timing drift of 18 fs and frequency instabilities at 1.2 × 10-15/1 s and 2.2 × 10-18/10000 s.
Danylov, A A; Light, A R; Waldman, J; Erickson, N
2015-12-10
Measurements of the frequency stability of a far-infrared molecular laser have been made by mixing the harmonic of an ultrastable microwave source with a portion of the laser output signal in a terahertz (THz) Schottky diode balanced mixer. A 3 GHz difference-frequency signal was used in a frequency discriminator circuit to lock the laser to the microwave source. Comparisons of the short- and long-term laser frequency stability under free-running and locked conditions show a significant improvement with locking. Short-term frequency jitter was reduced by an order of magnitude, from approximately 40 to 4 kHz, and long-term drift was reduced by more than three orders of magnitude, from approximately 250 kHz to 80 Hz. The results, enabled by the efficient Schottky diode balanced mixer downconverter, demonstrate that ultrastable microwave-based frequency stabilization of THz optically pumped lasers (OPLs) will now be possible at frequencies extending well above 4.0 THz.
An improved model for the dielectric constant of sea water at microwave frequencies
Klein, L. A.; Swift, C. T.
1977-01-01
The advent of precision microwave radiometry has placed a stringent requirement on the accuracy with which the dielectric constant of sea water must be known. To this end, measurements of the dielectric constant have been conducted at S-band and L-band with a quoted uncertainty of tenths of a percent. These and earlier results are critically examined, and expressions are developed which will yield computations of brightness temperature having an error of no more than 0.3 K for an undisturbed sea at frequencies lower than X-band. At the higher microwave and millimeter wave frequencies, the accuracy is in question because of uncertainties in the relaxation time and the dielectric constant at infinite frequency.
Analysis of microwave amplifier and frequency multiplier tube with a multipactor electron gun
International Nuclear Information System (INIS)
Yokoo, Kuniyoshi; Ono, Shoichi; Tai, Dong-Zhe.
1983-01-01
The performance analysis was made for a multipactor microwave tube with the aim of realizing a microwave amplifier or a frequency multiplier tube with a multipactor cathode with high efficiency and high power. The possibility for producing the multipactor tube with high efficiency and high power was shown by using effectively the characteristics of the multipactor cathode which emits pulsed electron current with narrow band, synchronizing with high frequency period. As the operating conditions for the multipactor cathode, it was shown that the wide spacing of the cathode was needed for the operation in high operating power, and the narrow spacing was needed for the operation in high efficiency and for reducing power consumption. It was also shown that there were the best values of the high-frequency voltage for the cathode operation. The study by the simulation for the multipactor cathode and for the acceleration zone of electron current was also performed to examine the possible performance for a microwave amplifier and a frequency multiplier tube. For the use of the multipactor cathode with a spacing of 1 mm, the conversion efficiency for d. c. input power was 86, 56 and 31 % for the primary, the secondary and the tertiary harmonic wave amplifications, respectively. (Asami, T.)
On the Power Dependence of Extraneous Microwave Fields in Atomic Frequency Standards
2005-01-01
uncertainty”, Metrologia 35 (1998) pp. 829-845. [6] K. Dorenwendt and A. Bauch, “Spurious Microwave Fields in Caesium Atomic Beam Standards...Cesium Beam Clocks Induced by Microwave Leakages”, IEEE Trans. UFFC 45 (1998)728-738. [8] M. Abgrall, “Evaluation des Performances de la Fontaine...Proc of the EFTF 2005 – in press. [12] A. DeMarchi, “The Optically Pumped Caesium Fountain: 10-15 Frequency Accuracy?”, Metrologia 18 (1982) pp
Frequency-tuned microwave photon counter based on a superconductive quantum interferometer
Shnyrkov, V. I.; Yangcao, Wu; Soroka, A. A.; Turutanov, O. G.; Lyakhno, V. Yu.
2018-03-01
Various types of single-photon counters operating in infrared, ultraviolet, and optical wavelength ranges are successfully used to study electromagnetic fields, analyze radiation sources, and solve problems in quantum informatics. However, their operating principles become ineffective at millimeter band, S-band, and ultra-high frequency bands of wavelengths due to the decrease in quantum energy by 4-5 orders of magnitude. Josephson circuits with discrete Hamiltonians and qubits are a good foundation for the construction of single-photon counters at these frequencies. This paper presents a frequency-tuned microwave photon counter based on a single-junction superconducting quantum interferometer and flux qutrit. The control pulse converts the interferometer into a two-level system for resonance absorption of photons. Decay of the photon-induced excited state changes the magnetic flux in the interferometer, which is measured by a SQUID magnetometer. Schemes for recording the magnetic flux using a DC SQUID or ideal parametric detector, based on a qutrit with high-frequency excitation, are discussed. It is shown that the counter consisting of an interferometer with a Josephson junction and a parametric detector demonstrates high performance and is capable of detecting single photons in a microwave band.
Directory of Open Access Journals (Sweden)
Hristo D. Hristov
2011-01-01
Full Text Available This paper examines the binary Fresnel zone plate (FZP lens frequency-harmonic and space-resolution focusing, and its application as a FZP lens antenna. A microwave FZP lens antenna (FZPA radiates both at design (90 GHz and terahertz (THz odd harmonic frequencies. Frequency and space domain antenna operation are studied analytically by use of the vector diffraction integral applied to a realistic printed FZPA. It is found that all harmonic gain peaks are roughly identical in form, bandwidth, and top values. At each harmonic frequency, the FZPA has a beamwidth that closely follows the Rayleigh resolution criterion. If the lens/antenna resolution is of prime importance and the small aperture efficiency is a secondary problem the microwave-design FZP lens antenna can be of great use at much higher terahertz frequencies. Important feature of the microwave FZP lens is its broader-zone construction compared to the equal in resolution terahertz-design FZP lens. Thus, unique and expensive microtechnology for the microwave FZP lens fabrication is not required. High-order harmonic operation of the FZP lens or lens antenna could find space resolution and frequency filtering applications in the terahertz and optical metrology, imaging tomography, short-range communications, spectral analysis, synchrotron facilities, and so on.
Dai, Yitang; Cen, Qizhuang; Wang, Lei; Zhou, Yue; Yin, Feifei; Dai, Jian; Li, Jianqiang; Xu, Kun
2015-12-14
Extraction of a microwave component from a low-time-jitter femtosecond pulse train has been attractive for current generation of spectrally pure microwave. In order to avoid the transfer from the optical amplitude noise to microwave phase noise (AM-PM), we propose to down-convert the target component to intermediate frequency (IF) before the opto-electronic conversion. Due to the much lower carrier frequency, the AM-PM is greatly suppressed. The target is then recovered by up-conversion with the same microwave local oscillation (LO). As long as the time delay of the second LO matches that of the IF carrier, the phase noise of the LO shows no impact on the extraction process. The residual noise of the proposed extraction is analyzed in theory, which is also experimentally demonstrated as averagely around -155 dBc/Hz under offset frequency larger than 1 kHz when 10-GHz tone is extracted from a home-made femtosecond fiber laser. Large tunable extraction from 1 GHz to 10 GHz is also reported.
Microwave frequency detector at X-band using GaAs MMIC technology
International Nuclear Information System (INIS)
Zhang Jun; Liao Xiaoping; Jiao Yongchang
2009-01-01
The design, fabrication, and experimental results of an MEMS microwave frequency detector are presented for the first time. The structure consists of a microwave power divider, two CPW transmission lines, a microwave power combiner, an MEMS capacitive power sensor and a thermopile. The detector has been designed and fabricated on GaAs substrate using the MMIC process at the X-band successfully. The MEMS capacitive power sensor is used for detecting the high power signal, while the thermopile is used for detecting the low power signal. Signals of 17 and 10 dBm are measured over the X-band. The sensitivity is 0.56 MHz/fF under 17 dBm by the capacitive power sensor, and 6.67 MHz/μV under 10 dBm by the thermopile, respectively. The validity of the presented design has been confirmed by the experiment.
A simple microwave technique for plasma density measurement using frequency modulation
International Nuclear Information System (INIS)
Bora, D.; Jayakumar, R.; Vijayashankar, M.K.
1984-01-01
A simple method of determining the phase variation unambiguously during microwave interferometric measurement is described. The frequency of the Klystron source is modulated with the help of staircase voltage pulse. The height of each stair is adjusted such that the corresponding phase shift in the test branch with an additional path length is 90 0 . Signals, proportional to cosine and sine of the phase shift due to plasma, can be generated in the same channel and plasma density information can be inferred. The microwave hardware remains the same as in conventional interferometry and the cost of such a scheme is low. (author)
Advanced RF and microwave functions based on an integrated optical frequency comb source.
Xu, Xingyuan; Wu, Jiayang; Nguyen, Thach G; Shoeiby, Mehrdad; Chu, Sai T; Little, Brent E; Morandotti, Roberto; Mitchell, Arnan; Moss, David J
2018-02-05
We demonstrate advanced transversal radio frequency (RF) and microwave functions based on a Kerr optical comb source generated by an integrated micro-ring resonator. We achieve extremely high performance for an optical true time delay aimed at tunable phased array antenna applications, as well as reconfigurable microwave photonic filters. Our results agree well with theory. We show that our true time delay would yield a phased array antenna with features that include high angular resolution and a wide range of beam steering angles, while the microwave photonic filters feature high Q factors, wideband tunability, and highly reconfigurable filtering shapes. These results show that our approach is a competitive solution to implementing reconfigurable, high performance and potentially low cost RF and microwave signal processing functions for applications including radar and communication systems.
Peak effect in surface resistance at microwave frequencies in Dy ...
Indian Academy of Sciences (India)
In the measurements at both frequencies the induced microwave current was always less than the critical current of the films. The reason for observation of this peak effect in these films has been explained in our earlier publication [5]. Comparing figures 1 and 2, it is observed that the peaks in sample S1 are broader and.
High Tc superconductors at microwave frequencies
International Nuclear Information System (INIS)
Gruener, G.
1991-01-01
The author discusses various experiments conducted in the micro- and millimeter wave spectral range on thin film and single crystal specimens of the high temperature oxide superconductors. For high quality film the surface resistance R s is, except at low temperatures, due to thermally excited carriers, with extrinsic effects playing only a secondary role. Because of the low loss various passive microwave components, such as resonators, delay lines and filters, with performance far superior to those made of normal metals can be fabricated. The conductivity measured at millimeter wave frequencies displays a peak below T c . Whether this is due to coherence factors or due to the change of the relaxation rate when the materials enter the superconducting state remains to be seen
Advanced microwave processing concepts
Energy Technology Data Exchange (ETDEWEB)
Lauf, R.J.; McMillan, A.D.; Paulauskas, F.L. [Oak Ridge National Laboratory, TN (United States)
1995-05-01
The purpose of this work is to explore the feasibility of several advanced microwave processing concepts to develop new energy-efficient materials and processes. The project includes two tasks: (1) commercialization of the variable-frequency microwave furnace; and (2) microwave curing of polymer composites. The variable frequency microwave furnace, whose initial conception and design was funded by the AIC Materials Program, will allow us, for the first time, to conduct microwave processing studies over a wide frequency range. This novel design uses a high-power traveling wave tube (TWT) originally developed for electronic warfare. By using this microwave source, one can not only select individual microwave frequencies for particular experiments, but also achieve uniform power densities over a large area by the superposition of many different frequencies. Microwave curing of thermoset resins will be studied because it hold the potential of in-situ curing of continuous-fiber composites for strong, lightweight components. Microwave heating can shorten curing times, provided issues of scaleup, uniformity, and thermal management can be adequately addressed.
International Nuclear Information System (INIS)
Song Qiwu; Huang Guangli; Nakajima, Hiroshi
2011-01-01
Solar microwave and hard X-ray spectral evolutions are co-analyzed in the 2000 June 10 and 2002 April 10 flares, and are simultaneously observed by the Owens-Valley Solar Array in the microwave band and by Yohkoh/Hard X-ray Telescope or RHESSI in the hard X-ray band, with multiple subpeaks in their light curves. The microwave and hard X-ray spectra are fitted by a power law in two frequency ranges of the optical thin part and two photon energy ranges, respectively. Similar to an earlier event in Shao and Huang, the well-known soft-hard-soft pattern of the lower energy range changed to the hard-soft-hard (HSH) pattern of the higher energy range during the spectral evolution of each subpeak in both hard X-ray flares. This energy dependence is actually supported by a positive correlation between the overall light curves and spectral evolution in the lower energy range, while it becomes an anti-correlation in the higher energy range. Regarding microwave data, the HSH pattern appears in the spectral evolution of each subpeak in the lower frequency range, which is somewhat similar to Huang and Nakajima. However, it returns back to the well-known pattern of soft-hard-harder for the overall spectral evolution in the higher frequency range of both events. This frequency dependence is confirmed by an anti-correlation between the overall light curves and spectral evolution in the lower frequency range, but it becomes a positive correlation in the higher frequency range. The possible mechanisms are discussed, respectively, for reasons why hard X-ray and microwave spectral evolutions have different patterns in different energy and frequency intervals.
Enhanced high-frequency microwave absorption of Fe3O4 architectures based on porous nanoflake
DEFF Research Database (Denmark)
Wang, Xiaoliang; Liu, Yanguo; Han, Hongyan
2017-01-01
Hierarchical Fe3O4 architectures assembled with porous nanoplates (p-Fe3O4) were synthesized. Due to the strong shape anisotropy of the nanoplates, the p-Fe3O4 exhibits increased microwave resonance towards high frequency range. The improved microwave absorption properties of the p-Fe3O4, including...
Enhanced high-frequency microwave absorption of Fe3O4 architectures based on porous nanoflake
DEFF Research Database (Denmark)
Wang, Xiaoliang; Liu, Yanguo; Han, Hongyan
2017-01-01
Hierarchical Fe3O4 architectures assembled with porous nanoplates (p-Fe3O4) were synthesized. Due to the strong shape anisotropy of the nanoplates, the p-Fe3O4 exhibits increased microwave resonance towards high frequency range. The improved microwave absorption properties of the p-Fe3O4, includi...
Normal and superconducting metals at microwave frequencies-classic experiments
International Nuclear Information System (INIS)
Dheer, P.N.
1999-01-01
A brief review of experimental and theoretical work on the behaviour of normal and superconducting materials at microwave frequencies before the publication of Bardeen, Cooper and Schrieffer's theory of superconductivity is given. The work discussed is mostly that of Pippard and his coworkers. It is shown that these investigations lead not only to a better understanding of the electrodynamics of normal and superconducting state but also of the nature of the superconducting state itself. (author)
Jasim, S. E.; Jusoh, M. A.; Mahmud, S. N. S.; Zamani, A. H.
2018-04-01
Development of low losses, small size and broad bandwidth microwave bandpass filter operating at higher frequencies is an active area of research. This paper presents a new route used to design and simulate microwave bandpass filter using finite element modelling and realized broad bandwidth, low losses, small dimension microwave bandpass filter operating at 10 GHz frequency using return loss method. The filter circuit has been carried out using Computer Aid Design (CAD), Ansoft HFSS software and designed with four parallel couple line model and small dimension (10 × 10 mm2) using LaAlO3 substrate. The response of the microwave filter circuit showed high return loss -50 dB at operating frequency at 10.4 GHz and broad bandwidth of 2.5 GHz from 9.5 to 12 GHz. The results indicate the filter design and simulation using HFSS is reliable and have the opportunity to transfer from lab potential experiments to the industry.
Experimental Verification of Plasmonic Cloaking at Microwave Frequencies with Metamaterials
International Nuclear Information System (INIS)
Edwards, Brian; Engheta, Nader; Alu, Andrea; Silveirinha, Mario G.
2009-01-01
Plasmonic cloaking is a scattering-cancellation technique based on the local negative polarizability of metamaterials. Here we report its first experimental realization and measurement at microwave frequencies. An array of metallic fins embedded in a high-permittivity fluid has been used to create a metamaterial plasmonic shell capable of cloaking a dielectric cylinder, yielding over 75% reduction of total scattering width.
To develop pasteurization treatments based on radio frequency (RF) or microwave energy, dielectric properties of almond shells were determined using an open-ended coaxial-probe with an impedance analyzer over a frequency range of 10 to 1800 MHz. Both the dielectric constant and loss factor of almond...
Directory of Open Access Journals (Sweden)
Daryush Talei
2013-01-01
Full Text Available Germination is a key process in plants' phenological cycles. Accelerating this process could lead to improvment of the seedling growth as well as the cultivation efficiency. To achieve this, the effect of microwave frequency on the germination of rice seeds was examined. The physiological feedbacks of the MR 219 rice variety in terms of seed germination rate (GR, germination percentage (GP, and mean germination time (MGT were analyzed by exposing its seeds to 2450 MHz of microwave frequency for one, four, seven, and ten hours. It was revealed that exposing the seeds to the microwave frequency for 10 hours resulted in the highest GP. This treatment led to 100% of germination after three days with a mean germination time of 2.1 days. Although the other exposure times of microwave frequency caused the moderate effects on germination with a GPa3 ranged from 93% to 98%, they failed to reduce the MGTa3. The results showed that ten-hour exposure times of microwave frequency for six days significantly facilitated and improved the germination indices (primary shoot and root length. Therefore, the technique is expected to benefit the improvement of rice seed germination considering its simplicity and efficacy in increasing the germination percentage and rate as well as the primary shoot and root length without causing any environmental toxicity.
Microwave amplifier and active circuit design using the real frequency technique
Jarry, Pierre
2016-01-01
This book focuses on the authors' Real Frequency Technique (RFT) and its application to a wide variety of multi-stage microwave amplifiers and active filters, and passive equalizers for radar pulse shaping and antenna return loss applications. The first two chapters review the fundamentals of microwave amplifier design and provide a description of the RFT. Each subsequent chapter introduces a new type of amplifier or circuit design, reviews its design problems, and explains how the RFT can be adapted to solve these problems. The authors take a practical approach by summarizing the design steps and giving numerous examples of amplifier realizations and measured responses. Provides a complete description of the RFT as it is first used to design multistage lumped amplifiers using a progressive optimization of the equalizers, leading to a small umber of parameters to optimize simultaneously Presents modifications to the RFT to design trans-impedance microwave amplifiers that are used for photodiodes acti...
DEFF Research Database (Denmark)
Zhao, Ying; Pang, Xiaodan; Deng, Lei
2011-01-01
A novel approach for broadband microwave frequency measurement by employing a single-drive dual-parallel Mach-Zehnder modulator is proposed and experimentally demonstrated. Based on bias manipulations of the modulator, conventional frequency-to-power mapping technique is developed by performing a...... 10−3 relative error. This high accuracy frequency measurement technique is a promising candidate for high-speed electronic warfare and defense applications....
Swept frequency measurements of microwave antennas in feline and canine brain
International Nuclear Information System (INIS)
Salcman, M.; Neuberth, G.; Nudelman, R.W.; Ferraro, F.T.; Hartman, M.
1986-01-01
Interstitial microwave hyperthermia may prove to be an important therapy for malignant brain tumors. For safety and efficiency, the size and number of intracranial microwave antennas needs to be limited. Low power swept frequency measurements of VSWR were carried out in the brains of anesthetized cats and dogs utilizing stereotactically placed monopole antennas. The coupling efficiency of antennas at any frequency was degraded (VSWR>2:1) if a length of antenna less than 2h was inserted or if a plastic catheter was utilized. Such measurements indicate that (h) can be shortened 25% from the resonant length without seriously degrading antenna performance. The total length can be halved if a catheter with a high dielectric is used. High power tests (2-10w) of short antennas at 915 MHz in a ceramic catheter (e = 10) at 45-50 0 C produce thermal fields approximately 2 cm in diameter in normal brain. It should be possible to efficiently and safely heat human brain tumors of average size utilizing these antennas and catheters at 915 MHz
Compensation of temperature frequency pushing in microwave resonator-meters on the basis VCO
Directory of Open Access Journals (Sweden)
Drobakhin O. O.
2008-02-01
Full Text Available It is shown that the influence of temperature oscillations on the error of measurements of parameters in the case of the application of microwave resonator meters on the basis of a voltage-controlled oscillator (VCO can be minimized by software using a special algorithm of VCO frequency setting correction. An algorithm of VCO frequency setting correction for triangle control voltage is proposed.
Microwave-to-optical frequency conversion with a Rydberg atom coupled to a coplanar waveguide
Gard, Bryan; Jacobs, Kurt; McDermott, Robert; Saffman, Mark
2017-04-01
A primary candidate for converting quantum information from microwave to optical frequencies is the use of Rydberg states of a single atom trapped near a surface. The fact that the Rydberg states possess both large electric dipole moments and microwave transition frequencies allows them to interact with superconducting mesoscopic circuits. By considering a concrete example, that of a Cesium atom, and using numerical search methods to optimize the control protocols, we determine the fidelities and transmission rates that could be achievable with such a device. We show that while protocols that exploit the adiabatic STIRAP mechanism provide the best raw transfer fidelities, the fastest communication speeds can be obtained by using heralding, which allows one to remove the adiabatic constraint. Support from Oak Ridge Associated Universities.
Teng, Yichao; Zhang, Pin; Zhang, Baofu; Chen, Yiwang
2018-02-01
A scheme to realize low-phase-noise frequency-quadrupled microwave generation without any filter is demonstrated. In this scheme, a multimode optoelectronic oscillator is mainly contributed by dual-parallel Mach-Zehnder modulators, fiber, photodetector, and microwave amplifier. The local source signal is modulated by a child MZM (MZMa), which is worked at maximum transmission point. Through properly adjusting the bias voltages of the other child MZM (MZMb) and the parent MZM (MZMc), optical carrier is effectively suppressed and second sidebands are retained, then the survived optical signal is fed back to the photodetector and MZMb to form an optoelectronic hybrid resonator and realize frequency-quadrupled signal generation. Due to the high Q-factor and mode selection effect of the optoelectronic hybrid resonator, compared with the source signal, the generated frequency-quadrupled signal has a lower phase noise. The approach has verified by experiments, and 18, 22, and 26 GHz frequency-quadrupled signal are generated by 4.5, 5.5, and 6.5 GHz local source signals. Compared with 4.5 GHz source signal, the phase noise of generated 18 GHz signal at 10 kHz frequency offset has 26.5 dB reduction.
Revathi, Venkatachalam; Dinesh Kumar, Sakthivel; Subramanian, Venkatachalam; Chellamuthu, Muthamizhchelvan
2015-11-01
Metamaterial structures are artificial structures that are useful in controlling the flow of electromagnetic radiation. In this paper, composite fibers of sub-micron thickness of barium substituted magnesium ferrite (Ba0.2Mg0.8Fe2O4) - polyvinylidene fluoride obtained by electrospinning is used as a substrate to design electromagnetic interference shielding structures. While electrospinning improves the ferroelectric properties of the polyvinylidene fluoride, the presence of barium magnesium ferrite modifies the magnetic property of the composite fiber. The dielectric and magnetic properties at microwave frequency measured using microwave cavity perturbation technique are used to design the reflection as well as absorption based tunable metamaterial structures for electromagnetic interference shielding in microwave frequency region. For one of the structures, the simulation indicates that single negative metamaterial structure becomes a double negative metamaterial under the external magnetic field.
Zaroushani, Vida; Khavanin, Ali; Jonidi Jafari, Ahmad; Mortazavi, Seyed Bagher
2016-01-01
Widespread use of X-band frequency (a part of the super high frequency microwave) in the various workplaces would contribute to occupational exposure with potential of adverse health effects. According to limited study on microwave shielding for the workplace, this study tried to prepare a new microwave shielding for this purpose. We used EI-403 epoxy thermosetting resin as a matrix and nickel oxide nanoparticle with the diameter of 15-35 nm as filler. The Epoxy/ Nickel oxide composites with 5, 7, 9 and 11 wt% were made in three different thicknesses (2, 4 and 6 mm). According to transmission / reflection method, shielding effectiveness (SE) in the X-band frequency range (8-12.5 GHz) was measured by scattering parameters directly given by the 2-port Vector Network Analyzer. The fabricated composites characterized by X-ray Diffraction and Field Emission Scanning Electron Microscope. The best average of shielding effectiveness in each thickness of fabricated composites obtained by 11%-2 mm, 7%-4 mm and 7%-6 mm composites with SE values of 46.80%, 66.72% and 64.52%, respectively. In addition, the 11%-6 mm, 5%-6 mm and 11%-4 mm-fabricated composites were able to attenuate extremely the incident microwave energy at 8.01, 8.51 and 8.53 GHz by SE of 84.14%, 83.57 and 81.30%, respectively. The 7%-4mm composite could be introduced as a suitable alternative microwave shield in radiation protection topics in order to its proper SE and other preferable properties such as low cost and weight, resistance to corrosion etc. It is necessary to develop and investigate the efficacy of the fabricated composites in the fields by future studies.
Energy Technology Data Exchange (ETDEWEB)
Kurpiers, Philipp; Walter, Theodore; Magnard, Paul; Salathe, Yves; Wallraff, Andreas [ETH Zuerich, Department of Physics, Zuerich (Switzerland)
2017-12-15
Low-loss waveguides are required for quantum communication at distances beyond the chip-scale for any low-temperature solid-state implementation of quantum information processors. We measure and analyze the attenuation constant of commercially available microwave-frequency waveguides down to millikelvin temperatures and single photon levels. More specifically, we characterize the frequency-dependent loss of a range of coaxial and rectangular microwave waveguides down to 0.005 dB/m using a resonant-cavity technique. We study the loss tangent and relative permittivity of commonly used dielectric waveguide materials by measurements of the internal quality factors and their comparison with established loss models. The results of our characterization are relevant for accurately predicting the signal levels at the input of cryogenic devices, for reducing the loss in any detection chain, and for estimating the heat load induced by signal dissipation in cryogenic systems. (orig.)
Plasma relativistic microwave electronics
International Nuclear Information System (INIS)
Kuzelev, M.V.; Loza, O.T.; Rukhadze, A.A.; Strelkov, P.S.; Shkvarunets, A.G.
2001-01-01
One formulated the principles of plasma relativistic microwave electronics based on the induced Cherenkov radiation of electromagnetic waves at interaction of a relativistic electron beam with plasma. One developed the theory of plasma relativistic generators and accelerators of microwave radiation, designed and studied the prototypes of such devices. One studied theoretically the mechanisms of radiation, calculated the efficiencies and the frequency spectra of plasma relativistic microwave generators and accelerators. The theory findings are proved by the experiment: intensity of the designed sources of microwave radiation is equal to 500 μW, the frequency of microwave radiation is increased by 7 times (from 4 up to 28 GHz), the width of radiation frequency band may vary from several up to 100%. The designed sources of microwave radiation are no else compared in the electronics [ru
Microwave-to-optical frequency conversion using a cesium atom coupled to a superconducting resonator
Gard, Bryan T.; Jacobs, Kurt; McDermott, R.; Saffman, M.
2017-07-01
A candidate for converting quantum information from microwave to optical frequencies is the use of a single atom that interacts with a superconducting microwave resonator on one hand and an optical cavity on the other. The large electric dipole moments and microwave transition frequencies possessed by Rydberg states allow them to couple strongly to superconducting devices. Lasers can then be used to connect a Rydberg transition to an optical transition to realize the conversion. Since the fundamental source of noise in this process is spontaneous emission from the atomic levels, the resulting control problem involves choosing the pulse shapes of the driving lasers so as to maximize the transfer rate while minimizing this loss. Here we consider the concrete example of a cesium atom, along with two specific choices for the levels to be used in the conversion cycle. Under the assumption that spontaneous emission is the only significant source of errors, we use numerical optimization to determine the likely rates for reliable quantum communication that could be achieved with this device. These rates are on the order of a few megaqubits per second.
Cosmic microwave background distortions at high frequencies
International Nuclear Information System (INIS)
Peter, W.; Peratt, A.L.
1988-01-01
The authors analyze the deviation of the cosmic background radiation spectrum from the 2.76+-0.02 0 Κ blackbody curve. If the cosmic background radiation is due to absorption and re-emission of synchrotron radiation from galactic-width current filaments, higher-order synchrotron modes are less thermalized than lower-order modes, causing a distortion of the blackbody curve at higher frequencies. New observations of the microwave background spectrum at short wavelengths should provide an indication of the number of synchrotron modes thermalized in this process. The deviation of the spectrum from that of a perfect blackbody can thus be correlated with astronomical observations such as filament temperatures and electron energies. The results are discussed and compared with the theoretical predictions of other models which assume the presence of intergalactic superconducting cosmic strings
International Nuclear Information System (INIS)
Rahim, Ismail; Nomura, Shinfuku; Mukasa, Shinobu; Toyota, Hiromichi
2015-01-01
This research involves two in-liquid plasma methods of methane hydrate decomposition, one using radio frequency wave (RF) irradiation and the other microwave radiation (MW). The ultimate goal of this research is to develop a practical process for decomposition of methane hydrate directly at the subsea site for fuel gas production. The mechanism for methane hydrate decomposition begins with the dissociation process of methane hydrate formed by CH_4 and water. The process continues with the simultaneously occurring steam methane reforming process and methane cracking reaction, during which the methane hydrate is decomposed releasing CH_4 into H_2, CO and other by-products. It was found that methane hydrate can be decomposed with a faster rate of CH_4 release using microwave irradiation over that using radio frequency irradiation. However, the radio frequency plasma method produces hydrogen with a purity of 63.1% and a CH conversion ratio of 99.1%, which is higher than using microwave plasma method which produces hydrogen with a purity of 42.1% and CH_4 conversion ratio of 85.5%. - Highlights: • The decomposition of methane hydrate is proposed using plasma in-liquid method. • Synthetic methane hydrate is used as the sample for decomposition in plasma. • Hydrogen can be produced from decomposition of methane hydrate. • Hydrogen purity is higher when using radio frequency stimulation.
Wideband Monolithic Microwave Integrated Circuit Frequency Converters with GaAs mHEMT Technology
DEFF Research Database (Denmark)
Krozer, Viktor; Johansen, Tom Keinicke; Djurhuus, Torsten
2005-01-01
We present monolithic microwave integrated circuit (MMIC) frequency converter, which can be used for up and down conversion, due to the large RF and IF port bandwidth. The MMIC converters are based on commercially available GaAs mHEMT technology and are comprised of a Gilbert mixer cell core...
Microwave frequency sensor for detection of biological cells in microfluidic channels.
Nikolic-Jaric, M; Romanuik, S F; Ferrier, G A; Bridges, G E; Butler, M; Sunley, K; Thomson, D J; Freeman, M R
2009-08-12
We present details of an apparatus for capacitive detection of biomaterials in microfluidic channels operating at microwave frequencies where dielectric effects due to interfacial polarization are minimal. A circuit model is presented, which can be used to adapt this detection system for use in other microfluidic applications and to identify ones where it would not be suitable. The detection system is based on a microwave coupled transmission line resonator integrated into an interferometer. At 1.5 GHz the system is capable of detecting changes in capacitance of 650 zF with a 50 Hz bandwidth. This system is well suited to the detection of biomaterials in a variety of suspending fluids, including phosphate-buffered saline. Applications involving both model particles (polystyrene microspheres) and living cells-baker's yeast (Saccharomyces cerevisiae) and Chinese hamster ovary cells-are presented.
A microwave powered sensor assembly for microwave ovens
DEFF Research Database (Denmark)
2016-01-01
The present invention relates to a microwave powered sensor assembly for micro- wave ovens. The microwave powered sensor assembly comprises a microwave antenna for generating an RF antenna signal in response to microwave radiation at a predetermined excitation frequency. A dc power supply circuit...... of the microwave powered sensor assembly is operatively coupled to the RF antenna signal for extracting energy from the RF antenna signal and produce a power supply voltage. A sensor is connected to the power supply voltage and configured to measure a physical or chemical property of a food item under heating...... in a microwave oven chamber....
A microwave exciter for Cs frequency standards based on a sapphire-loaded cavity oscillator.
Koga, Y; McNeilage, C; Searls, J H; Ohshima, S
2001-01-01
A low noise and highly stable microwave exciter system has been built for Cs atomic frequency standards using a tunable sapphire-loaded cavity oscillator (SLCO), which works at room temperature. This paper discusses the successful implementation of a control system for locking the SLCO to a long-term reference signal and reports an upper limit of the achieved frequency tracking error 6 x 10(-15) at tau = 1 s.
Role of Radio Frequency and Microwaves in Magnetic Fusion Plasma Research
Directory of Open Access Journals (Sweden)
Hyeon K. Park
2017-10-01
Full Text Available The role of electromagnetic (EM waves in magnetic fusion plasma—ranging from radio frequency (RF to microwaves—has been extremely important, and understanding of EM wave propagation and related technology in this field has significantly advanced magnetic fusion plasma research. Auxiliary heating and current drive systems, aided by various forms of high-power RF and microwave sources, have contributed to achieving the required steady-state operation of plasmas with high temperatures (i.e., up to approximately 10 keV; 1 eV = 10000 K that are suitable for future fusion reactors. Here, various resonance values and cut-off characteristics of wave propagation in plasmas with a nonuniform magnetic field are used to optimize the efficiency of heating and current drive systems. In diagnostic applications, passive emissions and active sources in this frequency range are used to measure plasma parameters and dynamics; in particular, measurements of electron cyclotron emissions (ECEs provide profile information regarding electron temperature. Recent developments in state-of-the-art 2D microwave imaging systems that measure fluctuations in electron temperature and density are largely based on ECE. The scattering process, phase delays, reflection/diffraction, and the polarization of actively launched EM waves provide us with the physics of magnetohydrodynamic instabilities and transport physics.
Near-Field Microwave Magnetic Nanoscopy of Superconducting Radio Frequency Cavity Materials
Tai, Tamin; Ghamsari, Behnood G.; Bieler, Thomas R.; Tan, Teng; Xi, X. X.; Anlage, Steven M.
2013-01-01
A localized measurement of the RF critical field on superconducting radio frequency (SRF) cavity materials is a key step to identify specific defects that produce quenches of SRF cavities. Two new measurements are performed to demonstrate these capabilities with a novel near-field scanning probe microwave microscope. The first is a third harmonic nonlinear measurement on a high Residual- Resistance-Ratio bulk Nb sample showing strong localized nonlinear response for the first time, with surfa...
21 CFR 179.30 - Radiofrequency radiation for the heating of food, including microwave frequencies.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Radiofrequency radiation for the heating of food... PRODUCTION, PROCESSING AND HANDLING OF FOOD Radiation and Radiation Sources § 179.30 Radiofrequency radiation for the heating of food, including microwave frequencies. Radiofrequency radiation, including...
Microwave amplification based on quasiparticle SIS up and down frequency converters
Directory of Open Access Journals (Sweden)
T. Kojima
2018-02-01
Full Text Available Heterodyne instruments have recently attained quantum-limited low-noise performance, particularly in radio astronomy, but it is difficult to develop large heterodyne arrays such as a modern radio camera using cryogenic sensitive detectors based on microwave kinetic inductance detectors, transition edge sensors, etc. In the realization of the heterodyne array, the reduction of power dissipation for semiconductor-based amplifiers remains a major challenge. Alternatively, superconducting parametric amplifiers still seem to have several barriers to application, especially in terms of operating temperature. Here, we show a novel concept of microwave amplification based on up and down frequency-conversion processes using quasiparticle superconductor-insulator-superconductor (SIS tunnel junctions. We demonstrate positive gain using a proof-of-concept test module, which operates with a power dissipation of several μW at a bath temperature of 4 K. The performance of the module suggests great potential for application in large arrays.
International Nuclear Information System (INIS)
1979-02-01
Studies of possible hazards to human health from exposure to radio frequency and microwave radiation show that there is a need for controls. Exposure to high levels of radio frequency and microwave radiation over prolonged periods can cause adverse health effects. The type and extent of injury depend not only on the intensity (strength) of the field and the exposure duration but also on various other factors such as the frequency of the radiation, type of modulation, polarization, and distance from the source. (auth)
Wideband Monolithic Microwave Integrated Circuit Frequency Converters with GaAs mHEMT Technology
Krozer, Viktor; Johansen, Tom Keinicke; Djurhuus, Torsten; Vidkjær, Jens
2005-01-01
We present monolithic microwave integrated circuit (MMIC) frequency converter, which can be used for up and down conversion, due to the large RF and IF port bandwidth. The MMIC converters are based on commercially available GaAs mHEMT technology and are comprised of a Gilbert mixer cell core, baluns and combiners. Single ended and balanced configurations DC and AC coupled have been investigated. The instantaneous 3 dB bandwidth at both the RF and the IF port of the frequency converters is ∼ 2...
Directory of Open Access Journals (Sweden)
Eva Hakansson
2016-07-01
Full Text Available Complex permittivity of conducting polypyrrole (PPy-coated Nylon-Lycra textiles is measured using a free space transmission measurement technique over the frequency range of 1–18 GHz. The aging of microwave dielectric properties and reflection, transmission and absorption for a period of 18 months is demonstrated. PPy-coated fabrics are shown to be lossy over the full frequency range. The levels of absorption are shown to be higher than reflection in the tested samples. This is attributed to the relatively high resistivity of the PPy-coated fabrics. Both the dopant concentration and polymerisation time affect the total shielding effectiveness and microwave aging behaviour. Distinguishing either of these two factors as being exclusively the dominant mechanism of shielding effectiveness is shown to be difficult. It is observed that the PPy-coated Nylon-Lycra samples with a p-toluene sulfonic acid (pTSA concentration of 0.015 M and polymerisation times of 60 min and 180 min have 37% and 26% decrease in total transmission loss, respectively, upon aging for 72 weeks at room temperature (20 °C, 65% Relative humidity (RH. The concentration of the dopant also influences the microwave aging behaviour of the PPy-coated fabrics. The samples with a higher dopant concentration of 0.027 mol/L pTSA are shown to have a transmission loss of 32.6% and 16.5% for short and long polymerisation times, respectively, when aged for 72 weeks. The microwave properties exhibit better stability with high dopant concentration and/or longer polymerization times. High pTSA dopant concentrations and/or longer polymerisation times result in high microwave insertion loss and are more effective in reducing the transmission and also increasing the longevity of the electrical properties.
A Quarter Ellipse Microstrip Resonator for Filters in Microwave Frequencies
Directory of Open Access Journals (Sweden)
Samuel Á. Jaramillo-Flórez
2013-11-01
Full Text Available This work describes the results of computational simulations and construction of quadrant elliptical resonators excited by coplanar slot line waveguide for designing microwave filters in RF communications systems. By means of the equation of optics, are explained the fundamentals of these geometry of resonators proposed. Are described the construction of quadrant elliptical resonators, one of microstrip and other two of cavity, of size different, and an array of four quadrant elliptical resonators in cascade. The results of the measures and the computational calculus of scattering S11 and S21 of elliptical resonators is made for to identify the resonant frequencies of the resonators studied, proving that these have performance in frequency as complete ellipses by the image effect due to their two mirror in both semiaxis, occupying less area, and the possible applications are discussed.
Microwave Resonators and Filters
2015-12-22
1 Microwave Resonators and Filters Daniel E. Oates MIT Lincoln Laboratory 244 Wood St. Lexington, MA 02478 USA Email: oates@ll.mit.edu...explained in other chapters, the surface resistance of superconductors at microwave frequencies can be as much as three orders of magnitude lower than the...resonators and filters in the first edition of this handbook (Z.-Y. Shen 2003) discussed the then state of the art of microwave frequency applications
Microwave generation and complex microwave responsivity measurements on small Dayem bridges
DEFF Research Database (Denmark)
Pedersen, Niels Falsig; Sørensen, O; Mygind, Jesper
1977-01-01
Measurements of the active properties of a Dayem micro-bridge at X-band frequencies is described. The bridge was mounted in a microwave cavity designed to match the bridge properly and the microwave output from the cavity was detected using a sensitive X-band spectrometer. Microwave power...
Microwave frequency dependence of the properties of the ion beam extracted from a CAPRICE type ECRIS
International Nuclear Information System (INIS)
Maimone, F.; Tinschert, K.; Spaedtke, P.; Maeder, J.; Rossbach, J.; Lang, R.; Celona, L.
2012-01-01
In order to improve the quality of ion beams extracted from ECR ion sources it is mandatory to better understand the relations between the plasma conditions and the beam properties. The present investigations concentrate on the analysis of different beam properties under the influence of various applications of frequency tuning and of multiple frequency heating. The changes in the microwave frequency feeding the plasma affect the electromagnetic field distribution and the dimension and position of the ECR surface inside the plasma chamber. This in turn has an influence on the generation of the extracted ion beam in terms of intensity, shape and emittance. In order to analyze the corresponding effects, measurements have been performed with the CAPRICE-Type ECRIS installed at the ECR Injector Setup (EIS) of GSI. The experimental setup uses a microwave sweep generator which feeds a TWTA (Traveling Wave Tube Amplifier) covering a wide frequency range from 12.5 to 16.5 GHz. This arrangement provides a precise determination of the frequencies and of the reflection coefficient along with the beam properties and it confirms again how the frequency and the corresponding electromagnetic field feeding the plasma affects the ECRIS performances. A sequence of viewing targets positioned inside the beam line monitors the beam shape evolution. The paper is followed by the associated poster
Evaluating superconductors for microwave applications
International Nuclear Information System (INIS)
Hammond, B.; Bybokas, J.
1989-01-01
It is becoming increasingly obvious that some of the earliest applications for high Tc superconductors will be in the microwave market. While this is a major opportunity for the superconductor community, it also represents a significant challenge. At DC or low frequencies a superconductor can be easily characterized by simple measurements of resistivity and magnetic susceptibility versus temperature. These parameters are fundamental to superconductor characterization and various methods exist for measuring them. The only valid way to determine the microwave characteristics of a superconductor is to measure it at microwave frequencies. It is for this reason that measuring microwave surface resistance has emerged as one of the most demanding and telling tests for materials intended for high frequency applications. In this article, the theory of microwave surface resistance is discussed. Methods for characterizing surface resistance theoretically and by practical implementation are described
Young, Leo
2013-01-01
Advances in Microwaves, Volume 8 covers the developments in the study of microwaves. The book discusses the circuit forms for microwave integrated circuits; the analysis of microstrip transmission lines; and the use of lumped elements in microwave integrated circuits. The text also describes the microwave properties of ferrimagnetic materials, as well as their interaction with electromagnetic waves propagating in bounded waveguiding structures. The integration techniques useful at high frequencies; material technology for microwave integrated circuits; specific requirements on technology for d
DEFF Research Database (Denmark)
Bartlett, J.G.; Cardoso, J.-F.; Delabrouille, J.
2014-01-01
H-atom. The dust temperature is observed to be anti-correlated with the dust emissivity and opacity. We interpret this result as evidence of dust evolution within the diffuse ISM. The mean dust opacity is measured to be (7.1 ± 0.6) × 10-27 cm2 H-1 × (v/353 GHz) 1.53 ± 0.03for 100 ≤ v ≤ 353 GHz......The dust-Hi correlation is used to characterize the emission properties of dust in the diffuse interstellar medium (ISM) from far infrared wavelengths to microwave frequencies. The field of this investigation encompasses the part of the southern sky best suited to study the cosmic infrared...... and microwave backgrounds. We cross-correlate sky maps from Planck, the Wilkinson Microwave Anisotropy Probe (WMAP), and the diffuse infrared background experiment (DIRBE), at 17 frequencies from 23 to 3000 GHz, with the Parkes survey of the 21 cm line emission of neutral atomic hydrogen, over a contiguous area...
International Nuclear Information System (INIS)
Li, Sucheng; Anwar, Shahzad; Lu, Weixin; Hang, Zhi Hong; Hou, Bo; Shen, Mingrong; Wang, Chin-Hua
2014-01-01
We study the absorption properties of ultrathin conductive films in the microwave regime, and find a moderate absorption effect which gives rise to maximal absorbance 50% if the sheet (square) resistance of the film meets an impedance matching condition. The maximal absorption exhibits a frequency-independent feature and takes place on an extremely subwavelength scale, the film thickness. As a realistic instance, ∼5 nm thick Au film is predicted to achieve the optimal absorption. In addition, a methodology based on metallic mesh structure is proposed to design the frequency-independent ultrathin absorbers. We perform a design of such absorbers with 50% absorption, which is verified by numerical simulations
International Nuclear Information System (INIS)
Bybokas, J.
1989-01-01
As superconductors move from the laboratory to the marketplace, it becomes more important for researchers and manufacturers to understand the markets for this technology. The large market for microwave systems represents a major opportunity for high-T c superconductors. Conductor losses are a primary design limitation in conventional microwave systems. The low losses of superconductors at microwave frequencies will allow component designers and system designers to improve their products in many ways. The most important market segments for microwave systems are outlined in this discussion
Near-field microwave magnetic nanoscopy of superconducting radio frequency cavity materials
Tai, Tamin; Ghamsari, Behnood G.; Bieler, Thomas R.; Tan, Teng; Xi, X. X.; Anlage, Steven M.
2014-06-01
A localized measurement of the RF critical field on superconducting radio frequency (SRF) cavity materials is a key step to identify specific defects that produce quenches of SRF cavities. Two measurements are performed to demonstrate these capabilities with a near-field scanning probe microwave microscope. The first is a third harmonic nonlinear measurement on a high Residual-Resistance-Ratio bulk Nb sample showing strong localized nonlinear response, with surface RF magnetic field Bsurface˜102 mT. The second is a raster scanned harmonic response image on a MgB2 thin film demonstrating a uniform nonlinear response over large areas.
Directory of Open Access Journals (Sweden)
Jinwu Chen
2017-02-01
Full Text Available Single phase Li2W2O7 with anorthic structure was prepared by the conventional solid-state reaction method at 550∘C and the anorthic structure was stable up to 660∘C. The dielectric properties at radio frequency (RF and microwave frequency range were characterized. The sample sintered at 640∘C exhibited the optimum microwave dielectric properties with a relative permittivity of 12.2, a quality factor value of 17,700GHz (at 9.8GHz, and a temperature coefficient of the resonant frequency of −232ppm/∘C as well as a high relative density ∼94.1%. Chemical compatibility measurement indicated Li2W2O7 did not react with aluminum electrodes when sintered at 640∘C for 4h.
Demodulation effect is observed in neurones by exposure to low frequency modulated microwaves
Energy Technology Data Exchange (ETDEWEB)
Perez-Bruzon, R N; Figols, T; Azanza, M J [Laboratorio de Magnetobiologia, Departamento de Anatomia e Histologia Humanas, Facultad de Medicina, Universidad de Zaragoza (Spain); Moral, A del, E-mail: naogit@yahoo.co [Laboratorio de Magnetismo de Solidos, Departamento de Fisica de Materia Condensada and Instituto de Ciencia de Materiales de Aragon, Universidad de Zaragoza and CSIC (Spain)
2010-01-01
Neurones exposure to a microwave (carrier f{sub c}=13.6 GHz; power P {approx_equal} 5 mW; H{sub o} {approx_equal} 0.10 Am{sup -1} = 1.25 mOe; E{sub 0} {approx_equal} 3.5 V/m; {Delta}T {approx_equal} 0.01{sup 0}C; SAR: 3.1x10{sup -3} - 5.8x10{sup -3} W/Kg) EMF amplitude modulated by ELF-AC field (frequency, f{sub m}= 0-100 Hz) shows no electrophysiological effect under the carrier MF alone, but {sup f}requency resonances: at 2, 4, 8, 12, 16, 50, 100 Hz: demodulation effect. Resonances appear when applied ELF-MF is close to a dominant characteristic frequency of the neurone impulse Fourier spectrum. This is an interesting result considering that ELF-MF modulating RF or MW in the range of human EEG could induce frequency-resonant effects on exposed human brain.
Dynamic regimes in YBCO in applied magnetic field probed by swept frequency microwave measurements
International Nuclear Information System (INIS)
Sarti, S; Silva, E; Giura, M; Fastampa, R; Boffa, M; Cucolo, A M
2004-01-01
We report measurements of the microwave resistivity in YBa 2 Cu 3 O 7-δ (YBCO), in the presence of an applied magnetic field. Measurements are performed as a function of frequency, over a continuum spectrum between 6 and 20 GHz, by means of a Corbino disc geometry. These data allow for a direct identification of different dynamical regimes in the dissipation of YBCO in the presence of an applied magnetic field. While at high temperatures a frequency independent resistivity is observed, at lower temperatures we find a marked frequency dependence. The line in the (H,T) plane at which this change in the dynamical regime is observed is clearly identified and discussed in terms of vortex motion and fluctuational resistivity
A Novel Application of Fourier Transform Spectroscopy with HEMT Amplifiers at Microwave Frequencies
Wilkinson, David T.; Page, Lyman
1995-01-01
The goal was to develop cryogenic high-electron-mobility transistor (HEMT) based radiometers and use them to measure the anisotropy in the cosmic microwave background (CMB). In particular, a novel Fourier transform spectrometer (FTS) built entirely of waveguide components would be developed. A dual-polarization Ka-band HEMT radiometer and a similar Q-band radiometer were built. In a series of measurements spanning three years made from a ground-based site in Saskatoon, SK, the amplitude, frequency spectrum, and spatial frequency spectrum of the anisotropy were measured. A prototype Ka-band FTS was built and tested, and a simplified version is proposed for the MAP satellite mission. The 1/f characteristics of HEMT amplifiers were quantified using correlation techniques.
Demodulation effect is observed in neurones by exposure to low frequency modulated microwaves
International Nuclear Information System (INIS)
Perez-Bruzon, R N; Figols, T; Azanza, M J; Moral, A del
2010-01-01
Neurones exposure to a microwave (carrier f c =13.6 GHz; power P ≅ 5 mW; H o ≅ 0.10 Am -1 = 1.25 mOe; E 0 ≅ 3.5 V/m; ΔT ≅ 0.01 0 C; SAR: 3.1x10 -3 - 5.8x10 -3 W/Kg) EMF amplitude modulated by ELF-AC field (frequency, f m = 0-100 Hz) shows no electrophysiological effect under the carrier MF alone, but f requency resonances: at 2, 4, 8, 12, 16, 50, 100 Hz: demodulation effect. Resonances appear when applied ELF-MF is close to a dominant characteristic frequency of the neurone impulse Fourier spectrum. This is an interesting result considering that ELF-MF modulating RF or MW in the range of human EEG could induce frequency-resonant effects on exposed human brain.
Integrated microwave photonics
Marpaung, D.A.I.; Roeloffzen, C.G.H.; Heideman, Rene; Leinse, Arne; Sales, S.; Capmany, J.
2013-01-01
Microwave photonics (MWP) is an emerging field in which radio frequency (RF) signals are generated, distributed, processed and analyzed using the strength of photonic techniques. It is a technology that enables various functionalities which are not feasible to achieve only in the microwave domain. A
MICROWAVE INTERACTIONS WITH INHOMOGENEOUS PARTIALLY IONIZED PLASMA
Energy Technology Data Exchange (ETDEWEB)
Kritz, A. H.
1962-11-15
Microwave interactions with inhomogeneous plasmas are often studied by employing a simplified electromagnetic approach, i.e., by representing the effects of the plasma by an effective dielectric coefficient. The problems and approximations associated with this procedure are discussed. The equation describing the microwave field in an inhomogeneous partially ionized plasma is derived, and the method that is applied to obtain the reflected, transmitted, and absorbed intensities in inhomogeneous plasmas is presented. The interactions of microwaves with plasmas having Gaussian electron density profiles are considered. The variation of collision frequency with position is usually neglected. In general, the assumption of constant collision frequency is not justified; e.g., for a highly ionized plasma, the electron density profile determines, in part, the profile of the electron-ion collision frequency. The effect of the variation of the collision frequency profile on the interaction of microwaves with inhomogeneous plasmas is studied in order to obtain an estimate of the degree of error that may result when constant collision frequency is assumed instead of a more realistic collision frequency profile. It is shown that the degree of error is of particular importance when microwave analysis is used as a plasma diagnostic. (auth)
Microwave mixer technology and applications
Henderson, Bert
2013-01-01
Although microwave mixers play a critical role in wireless communication and other microwave applications employing frequency conversion circuits, engineers find that most books on this subject emphasize theoretical aspects, rather than practical applications. That's about to change with the forthcoming release of Microwave Mixer Technology and Applications. Based on a review of over one thousand patents on mixers and frequency conversion, authors Bert Henderson and Edmar Camargo have written a comprehensive book for mixer designers who want solid ideas for solving their own design challenges.
Boskovic, BO; Stolojan, V; Zeze, DA; Forrest, RD; Silva, SRP; Haq, S
2004-01-01
Carbon nanofibers have been grown at room temperature using a combination of radio frequency and microwave assisted plasma-enhanced chemical vapor deposition. The nanofibers were grown, using Ni powder catalyst, onto substrates kept at room temperature by using a purposely designed water-cooled sample holder. Branched carbon nanofiber growth was obtained without using a template resulting in interconnected carbon nanofiber network formation on substrates held at room temperatur...
International Nuclear Information System (INIS)
Zeng, J Y; Li, Z; Chen, Q; Bi, H Y
2014-01-01
Soil moisture plays a key role in global water cycles. In the study, soil moisture retrievals from airborne microwave radiometer observations using a single-frequency algorithm were presented. The algorithm is based on a simplified radiative transfer (tau-omega) model and the influence of both the roughness and vegetation is combined into a single parameter in the algorithm. The microwave polarization difference index (MPDI) is used to eliminate the effects of temperature. Then soil moisture is obtained through a nonlinear iterative procedure by making the absolute value of the differences between the simulated and observed MPDI minimum. The algorithm was validated with aircraft passive microwave data from the Polarimetric Scanning Radiometer (PSR) at the Arizona during the Soil Moisture Experiment 2004 (SMEX04). The results show that the soil moisture retrieved by the algorithm is in good agreement with ground measurements with a small bias and an overall accuracy of 0.037m 3 m −3
Yonglin, Jiang; Bingguo, Liu; Peng, Liu; Jinhui, Peng; Libo, Zhang
2017-12-01
Conversion of electromagnetic energy into heat depends largely on the dielectric properties of the material being treated. Therefore, determining the dielectric properties of molybdenite concentrate and its microwave power penetration depth in relation to a temperature increment at the commercial frequency of 2.45 GHz is necessary to design industrial microwave processing units. In this study, the dielectric constants increased as the temperature increased in the entire experimental range. The loss factor presented an opposite trend, except for 298 K to 373 K (25 °C to 100 °C) in which a cavity perturbation resonator was used. The plots of nonlinear surface fitting indicate that the increase in dielectric loss causes a considerable decrease in penetration depth, but the dielectric constants exert a small positive effect. The thermogravimetric analysis (TGA-DSC) of the molybdenite concentrate was carried out to track its thermal decomposition process, aim to a dielectric analysis during the microwave heating. MoO3 was prepared from molybdenite concentrate through oxidation roasting in a microwave heating system and a resistance furnace, respectively. The phase transitions and morphology evolutions during oxidation roasting were characterized through X-ray diffraction and scanning electron microscopy. Results show that microwave thermal technique can produce high-purity molybdenum trioxide.
DEFF Research Database (Denmark)
Gliese, Ulrik Bo; Nielsen, Søren Nørskov; Nielsen, Søren Nørskov
1996-01-01
Chromatic dispersion significantly limits the distance and/or frequency in fibre-optic microwave and millimeter-wave links based on direct detection due to a decrease of the carrier to noise ratio. The limitations in links based on coherent remote heterodyne detection, however, are far less...
International Nuclear Information System (INIS)
Kinefuchi, K.; Funaki, I.; Shimada, T.; Abe, T.
2012-01-01
Under certain conditions during rocket flights, ionized exhaust plumes from solid rocket motors may interfere with radio frequency transmissions. To understand the relevant physical processes involved in this phenomenon and establish a prediction process for in-flight attenuation levels, we attempted to measure microwave attenuation caused by rocket exhaust plumes in a sea-level static firing test for a full-scale solid propellant rocket motor. The microwave attenuation level was calculated by a coupling simulation of the inviscid-frozen-flow computational fluid dynamics of an exhaust plume and detailed analysis of microwave transmissions by applying a frequency-dependent finite-difference time-domain method with the Drude dispersion model. The calculated microwave attenuation level agreed well with the experimental results, except in the case of interference downstream the Mach disk in the exhaust plume. It was concluded that the coupling estimation method based on the physics of the frozen plasma flow with Drude dispersion would be suitable for actual flight conditions, although the mixing and afterburning in the plume should be considered depending on the flow condition.
Energy Technology Data Exchange (ETDEWEB)
Kinefuchi, K. [Department of Aeronautics and Astronautics, University of Tokyo, 7-3-1, Hongo, Bunkyo-ku, Tokyo 113-8656 (Japan); Funaki, I.; Shimada, T.; Abe, T. [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1, Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan)
2012-10-15
Under certain conditions during rocket flights, ionized exhaust plumes from solid rocket motors may interfere with radio frequency transmissions. To understand the relevant physical processes involved in this phenomenon and establish a prediction process for in-flight attenuation levels, we attempted to measure microwave attenuation caused by rocket exhaust plumes in a sea-level static firing test for a full-scale solid propellant rocket motor. The microwave attenuation level was calculated by a coupling simulation of the inviscid-frozen-flow computational fluid dynamics of an exhaust plume and detailed analysis of microwave transmissions by applying a frequency-dependent finite-difference time-domain method with the Drude dispersion model. The calculated microwave attenuation level agreed well with the experimental results, except in the case of interference downstream the Mach disk in the exhaust plume. It was concluded that the coupling estimation method based on the physics of the frozen plasma flow with Drude dispersion would be suitable for actual flight conditions, although the mixing and afterburning in the plume should be considered depending on the flow condition.
Development of a Multi-Point Microwave Interferometry (MPMI) Method
Energy Technology Data Exchange (ETDEWEB)
Specht, Paul Elliott [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Cooper, Marcia A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jilek, Brook Anton [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2015-09-01
A multi-point microwave interferometer (MPMI) concept was developed for non-invasively tracking a shock, reaction, or detonation front in energetic media. Initially, a single-point, heterodyne microwave interferometry capability was established. The design, construction, and verification of the single-point interferometer provided a knowledge base for the creation of the MPMI concept. The MPMI concept uses an electro-optic (EO) crystal to impart a time-varying phase lag onto a laser at the microwave frequency. Polarization optics converts this phase lag into an amplitude modulation, which is analyzed in a heterodyne interfer- ometer to detect Doppler shifts in the microwave frequency. A version of the MPMI was constructed to experimentally measure the frequency of a microwave source through the EO modulation of a laser. The successful extraction of the microwave frequency proved the underlying physical concept of the MPMI design, and highlighted the challenges associated with the longer microwave wavelength. The frequency measurements made with the current equipment contained too much uncertainty for an accurate velocity measurement. Potential alterations to the current construction are presented to improve the quality of the measured signal and enable multiple accurate velocity measurements.
Nonlinear effects in microwave photoconductivity of two-dimensional electron systems
International Nuclear Information System (INIS)
Ryzhii, V; Suris, R
2003-01-01
We present a model for microwave photoconductivity of two-dimensional electron systems in a magnetic field which describes the effects of strong microwave and steady-state electric fields. Using this model, we derive an analytical formula for the photoconductivity associated with photon- and multi-photon-assisted impurity scattering as a function of the frequency and power of microwave radiation. According to the developed model, the microwave conductivity is an oscillatory function of the frequency of microwave radiation and the cyclotron frequency which becomes zero at the cyclotron resonance and its harmonics. It exhibits maxima and minima (with absolute negative conductivity) at microwave frequencies somewhat different from the resonant frequencies. The calculated power dependence of the amplitude of the microwave photoconductivity oscillations exhibits pronounced sublinear behaviour similar to a logarithmic function. The height of the microwave photoconductivity maxima and the depth of its minima are nonmonotonic functions of the electric field. The possibility of a strong widening of the maxima and minima due to a strong sensitivity of their parameters on the electric field and the presence of strong long-range electric-field fluctuations is pointed to. The obtained dependences are consistent with the results of the experimental observations
Zhu, Zhuozhuo; Guo, Wenchuan
2017-08-24
To develop advanced drying methods using radio-frequency (RF) or microwave (MW) energy, dielectric properties of potato starch were determined using an open-ended coaxial-line probe and network analyzer at frequencies between 20 and 4,500 MHz, moisture contents between 15.1% and 43.1% wet basis (w.b.), and temperatures between 25 and 75 °C. The results showed that both dielectric constant (ε') and loss factor (ε″) were dependent on frequency, moisture content, and temperature. ε' decreased with increasing frequency at a given moisture content or temperature. At low moisture contents (≤25.4% w.b.) or low temperatures (≤45 °C), ε″ increased with increasing frequency. However, ε″ changed from decrease to increase with increasing frequency at high moisture contents or temperatures. At low temperatures (25-35 °C), both ε' and ε″ increased with increasing moisture content. At low moisture contents (15.1-19.5% w.b.), they increased with increasing temperature. The change trends of ε' and ε″ were different and dependent on temperature and moisture content at their high levels. The penetration depth (d p ) decreased with increasing frequency. RF treatments may provide potential large-scale industrial drying application for potato starch. This research offers useful information on dielectric properties of potato starch related to drying with electromagnetic energy.
Processing of complex shapes with single-mode resonant frequency microwave applicators
International Nuclear Information System (INIS)
Fellows, L.A.; Delgado, R.; Hawley, M.C.
1994-01-01
Microwave processing is an alternative to conventional composite processing techniques. Single-mode microwave applicators efficiently couple microwave energy into the composite. The application of the microwave energy is greatly affected by the geometry of the composite. In the single mode microwave applicator, two types of modes are available. These modes are best suited to processing flat planar samples or cylindrical samples with geometries that align with the electric fields. Mode-switching is alternating between different electromagnetic modes with the intelligent selection of the modes to alleviate undesirable temperature profiles. This method has improved the microwave heating profiles of materials with complex shapes that do not align with either type of electric field. Parts with two different complex geometries were fabricated from a vinyl toluene/vinyl ester resin with a continuous glass fiber reinforcement by autoclaving and by microwave techniques. The flexural properties of the microwave processed samples were compared to the flexural properties of autoclaved samples. The trends of the mechanical properties for the complex shapes were consistent with the results of experiments with flat panels. This demonstrated that mode-switching techniques are as applicable for the complex shapes as they are for the simpler flat panel geometry
Microwave reflection, transmission, and absorption by human brain tissue
Ansari, M. A.; Akhlaghipour, N.; Zarei, M.; Niknam, A. R.
2018-04-01
These days, the biological effects of electromagnetic (EM) radiations on the brain, especially in the frequency range of mobile communications, have caught the attention of many scientists. Therefore, in this paper, the propagation of mobile phone electromagnetic waves in the brain tissues is investigated analytically and numerically. The brain is modeled by three layers consisting of skull, grey and white matter. First, we have analytically calculated the microwave reflection, transmission, and absorption coefficients using signal flow graph technique. The effect of microwave frequency and variations in the thickness of layers on the propagation of microwave through brain are studied. Then, the penetration of microwave in the layers is numerically investigated by Monte Carlo method. It is shown that the analytical results are in good agreement with those obtained by Monte Carlo method. Our results indicate the absorbed microwave energy depends on microwave frequency and thickness of brain layers, and the absorption coefficient is optimized at a number of frequencies. These findings can be used for comparing the microwave absorbed energy in a child's and adult's brain.
National Oceanic and Atmospheric Administration, Department of Commerce — The SSM/I is a seven-channel, four frequency, linearly-polarized, passive microwave radiometric system which measures atmospheric, ocean and terrain microwave...
DEFF Research Database (Denmark)
Company Torres, Victor; Tafur Monroy, Idelfonso; Lancis, Jesus
2008-01-01
We present a proof-of-principle experiment for achieving simultaneous distribution of baseband radio-frequency data and up-conversion with broadcasting support over a passive optical network. The technique is based on an incoherent frequency-to-time mapping method for pulse shaping. Specifically...... resembles the shape of the incoherent source. The photodetected signal contains both the baseband data and an up-frequency converted copy with central wavelength for the microwave carrier into the ultra-wideband range and tuning capability by selection of the fiber length. (c) 2008 Elsevier B.V. All rights...
Young, Leo
1967-01-01
Advances in Microwaves, Volume 2 focuses on the developments in microwave solid-state devices and circuits. This volume contains six chapters that also describe the design and applications of diplexers and multiplexers. The first chapter deals with the parameters of the tunnel diode, oscillators, amplifiers and frequency converter, followed by a simple physical description and the basic operating principles of the solid state devices currently capable of generating coherent microwave power, including transistors, harmonic generators, and tunnel, avalanche transit time, and diodes. The next ch
Occupational exposure to radio frequency/microwave radiation and the risk of brain tumors
DEFF Research Database (Denmark)
Berg, Gabriele; Spallek, Jacob; Schüz, Joachim
2006-01-01
It is still under debate whether occupational exposure to radio frequency/microwave electromagnetic fields (RF/MW-EMF) contributes to the development of brain tumors. This analysis examined the role of occupational RF/MW-EMF exposure in the risk of glioma and meningioma. A population-based, case....... "High" exposure was defined as an occupational exposure that may exceed the RF/MW-EMF exposure limits for the general public recommended by the International Commission on Non-Ionizing Radiation Protection. Multiple conditional logistic regressions were performed separately for glioma and meningioma...
Modulated microwave microscopy and probes used therewith
Lai, Keji; Kelly, Michael; Shen, Zhi-Xun
2012-09-11
A microwave microscope including a probe tip electrode vertically positionable over a sample and projecting downwardly from the end of a cantilever. A transmission line connecting the tip electrode to the electronic control system extends along the cantilever and is separated from a ground plane at the bottom of the cantilever by a dielectric layer. The probe tip may be vertically tapped near or at the sample surface at a low frequency and the microwave signal reflected from the tip/sample interaction is demodulated at the low frequency. Alternatively, a low-frequency electrical signal is also a non-linear electrical element associated with the probe tip to non-linearly interact with the applied microwave signal and the reflected non-linear microwave signal is detected at the low frequency. The non-linear element may be semiconductor junction formed near the apex of the probe tip or be an FET formed at the base of a semiconducting tip.
Microwave Plasma System: PVA Tepla 300
Federal Laboratory Consortium — Description:CORAL Name: Microwave AsherA tool using microwave oxygen plasma to remove organics on the surfacesSpecifications / Capabilities:Frequency: 2.45 GHzPower:...
Analytical Retrieval of Global Land Surface Emissivity Maps at AMSR-E passive microwave frequencies
Norouzi, H.; Temimi, M.; Khanbilvardi, R.
2009-12-01
Land emissivity is a crucial boundary condition in Numerical Weather Prediction (NWP) modeling. Land emissivity is also a key indicator of land surface and subsurface properties. The objective of this study, supported by NOAA-NESDIS, is to develop global land emissivity maps using AMSR-E passive microwave measurements along with several ancillary data. The International Satellite Cloud Climatology Project (ISCCP) database has been used to obtain several inputs for the proposed approach such as land surface temperature, cloud mask and atmosphere profile. The Community Radiative Transfer Model (CRTM) has been used to estimate upwelling and downwelling atmospheric contributions. Although it is well known that correction of the atmospheric effect on brightness temperature is required at higher frequencies (over 19 GHz), our preliminary results have shown that a correction at 10.7 GHz is also necessary over specific areas. The proposed approach is based on three main steps. First, all necessary data have been collected and processed. Second, a global cloud free composite of AMSR-E data and corresponding ancillary images is created. Finally, monthly composting of emissivity maps has been performed. AMSR-E frequencies at 6.9, 10.7, 18.7, 36.5 and 89.0 GHz have been used to retrieve the emissivity. Water vapor information obtained from ISCCP (TOVS data) was used to calculate upwelling, downwelling temperatures and atmospheric transmission in order to assess the consistency of those derived from the CRTM model. The frequent land surface temperature (LST) determination (8 times a day) in the ISCCP database has allowed us to assess the diurnal cycle effect on emissivity retrieval. Differences in magnitude and phase between thermal temperature and low frequencies microwave brightness temperature have been noticed. These differences seem to vary in space and time. They also depend on soil texture and thermal inertia. The proposed methodology accounts for these factors and
Variable Power, Short Microwave Pulses Generation using a CW Magnetron
Directory of Open Access Journals (Sweden)
CIUPA, R.
2011-05-01
Full Text Available Fine control of microwave power radiation in medical and scientific applications is a challenging task. Since a commercial Continuous Wave (CW magnetron is the most inexpensive microwave device available today on the market, it becomes the best candidate for a microwave power generator used in medical diathermy and hyperthermia treatments or high efficiency chemical reactions using microwave reactors as well. This article presents a new method for driving a CW magnetron with short pulses, using a modified commercial Zero Voltage Switching (ZVS inverter, software driven by a custom embedded system. The microwave power generator designed with this method can be programmed for output microwave pulses down to 1% of the magnetron's power and allows microwave low frequency pulse modulation in the range of human brain electrical activity, intended for medical applications. Microwave output power continuous control is also possible with the magnetron running in the oscillating area, using a dual frequency Pulse Width Modulation (PWM, where the low frequency PWM pulse is modulating a higher resonant frequency required by the ZVS inverter's transformer. The method presented allows a continuous control of both power and energy (duty-cycle at the inverter's output.
Experimental and numerical modeling research of rubber material during microwave heating process
Chen, Hailong; Li, Tao; Li, Kunling; Li, Qingling
2018-05-01
This paper aims to investigate the heating behaviors of block rubber by experimental and simulated method. The COMSOL Multiphysics 5.0 software was utilized in numerical simulation work. The effects of microwave frequency, power and sample size on temperature distribution are examined. The effect of frequency on temperature distribution is obvious. The maximum and minimum temperatures of block rubber increase first and then decrease with frequency increasing. The microwave heating efficiency is maximum in the microwave frequency of 2450 MHz. However, more uniform temperature distribution is presented in other microwave frequencies. The influence of microwave power on temperature distribution is also remarkable. The smaller the power, the more uniform the temperature distribution on the block rubber. The effect of power on microwave heating efficiency is not obvious. The effect of sample size on temperature distribution is evidently found. The smaller the sample size, the more uniform the temperature distribution on the block rubber. However, the smaller the sample size, the lower the microwave heating efficiency. The results can serve as references for the research on heating rubber material by microwave technology.
Sok, J; Lee, E H
1998-01-01
An applied dc voltage varies the dielectric constant of ferroelectric SrTiO sub 3 films. A tuning mechanism for superconducting microwave resonators was realized by using the variation in the dielectric constant of SrTiO sub 3 films. In order to estimate the values of the capacitance, C, and the loss tangent, tan delta, of SrTiO sub 3 ferroelectric capacitors, we used high-temperature superconducting microwave resonators which were composed of two ports, two poles, and dc bias circuits at the zero-field points. SrTiO sub 3 ferroelectric capacitors successfully controlled the resonant frequency of the resonator. Resonant frequencies of 3.98 GHz and 4.20 GHz were measured at bias voltages of 0 V and 50 V which correspond to capacitance values of 0.94 pF and 0.7pF, respectively. The values of the loss tangent, tan delta sub e sub f sub f , obtained in this measurements, were about 0.01.
Microwave integrated circuit for Josephson voltage standards
Holdeman, L. B.; Toots, J.; Chang, C. C. (Inventor)
1980-01-01
A microwave integrated circuit comprised of one or more Josephson junctions and short sections of microstrip or stripline transmission line is fabricated from thin layers of superconducting metal on a dielectric substrate. The short sections of transmission are combined to form the elements of the circuit and particularly, two microwave resonators. The Josephson junctions are located between the resonators and the impedance of the Josephson junctions forms part of the circuitry that couples the two resonators. The microwave integrated circuit has an application in Josephson voltage standards. In this application, the device is asymmetrically driven at a selected frequency (approximately equal to the resonance frequency of the resonators), and a d.c. bias is applied to the junction. By observing the current voltage characteristic of the junction, a precise voltage, proportional to the frequency of the microwave drive signal, is obtained.
Sorrentino, Roberto
2010-01-01
An essential text for both students and professionals, combining detailed theory with clear practical guidance This outstanding book explores a large spectrum of topics within microwave and radio frequency (RF) engineering, encompassing electromagnetic theory, microwave circuits and components. It provides thorough descriptions of the most common microwave test instruments and advises on semiconductor device modelling. With examples taken from the authors' own experience, this book also covers:network and signal theory;electronic technology with guided electromagnetic pr
Peter W. Gaiser; Magdalena D. Anguelova
2012-01-01
Foam fraction can be retrieved from space-based microwave radiometric data at frequencies from 1 to 37 GHz. The retrievals require modeling of ocean surface emissivity fully covered with sea foam. To model foam emissivity well, knowledge of foam properties, both mechanical and dielectric, is necessary because these control the radiative processes in foam. We present a physical description of foam dielectric properties obtained from the foam dielectric constant including foam skin depth; foam ...
Directory of Open Access Journals (Sweden)
S. Talebi
2018-04-01
Full Text Available This paper presents a theoretical study of derivation Microwave Vegetation Indices (MVIs in different pairs of frequencies using two methods. In the first method calculating MVI in different frequencies based on Matrix Doubling Model (to take in to account multi scattering effects has been done and analyzed in various soil properties. The second method was based on MVI theoretical basis and its independency to underlying soil surface signals. Comparing the results from two methods with vegetation properties (single scattering albedo and optical depth indicated partial correlation between MVI from first method and optical depth, and full correlation between MVI from second method and vegetation properties. The second method to derive MVI can be used widely in global microwave vegetation monitoring.
The scientific base of heating water by microwave
Energy Technology Data Exchange (ETDEWEB)
Akdoğan, Ender, E-mail: ender.akdogan@tpe.gov.tr [Department of Physics Engineering, Ankara University, Dögol St. Tandoğan Ankara 06560 Türkiye (Turkey); Çiftçi, Muharrem, E-mail: muharrem-ciftci@windowslive.com [Author" 1 Department of Physics, Ankara University, Dögol St. Tandoğan Ankara 06560 Türkiye (Turkey)
2016-03-25
This article is based on the master thesis [4] related to our invention which was published in World Intellectual Property Organization (WO/2011/048506) as a microwave water heater. In the project, a prototype was produced to use microwave in industrial heating. In order to produce the prototype, the most appropriate material kind for microwave-water experiments was determined by a new energy loss rate calculation technique. This new energy loss calculation is a determinative factor for material permeability at microwave frequency band (1-100 GHz). This experimental series aim to investigate the rationality of using microwave in heating industry. Theoretically, heating water by microwave (with steady frequency 2.45 GHz) is analyzed from sub-molecular to Classical Mechanic results of heating. In the study, we examined Quantum Mechanical base of heating water by microwave experiments. As a result, we derived a Semi-Quantum Mechanical equation for microwave-water interactions and thus, Wien displacement law can be derived to verify experimental observations by this equation.
Microwave integrated circuit radiometer front-ends for the Push Broom Microwave Radiometer
Harrington, R. F.; Hearn, C. P.
1982-01-01
Microwave integrated circuit front-ends for the L-band, S-band and C-band stepped frequency null-balanced noise-injection Dicke-switched radiometer to be installed in the NASA Langley airborne prototype Push Broom Microwave Radiometer (PBMR) are described. These front-ends were developed for the fixed frequency of 1.413 GHz and the variable frequencies of 1.8-2.8 GHz and 3.8-5.8 GHz. Measurements of the noise temperature of these units were made at 55.8 C, and the results of these tests are given. While the overall performance was reasonable, improvements need to be made in circuit losses and noise temperatures, which in the case of the C-band were from 1000 to 1850 K instead of the 500 K specified. Further development of the prototypes is underway to improve performance and extend the frequency range.
Experimental verification of the dominant microwaves from the reflexing electrons
International Nuclear Information System (INIS)
Wu, M.W.; Chen, C.Y.; Hwong, C.S.; Guung, T.C.; Tung, K.N.; Hou, W.S.
1989-01-01
At a fixed diode voltage and a cathode-anode gap of 4.5 mm, the frequency of the dominant microwaves scales approximately one-fourth of the diode current for the diode current from 3.7 to 4.9 kA, showing that the dominant microwaves are not generated from the oscillating virtual cathodes. The most persuasive result is that the frequency of the dominant microwaves is kept almost constant as the diode current increases from 4.9 to 7.5 kA, which indicates that these microwaves are generated from the oscillations of the reflexing electrons. The frequency of the dominant microwaves for the overall range of the diode current is 8.0 - 8.5 GHz and the maximum peak power of the microwaves is --40 MW. The complete spectra of the microwaves at various diode current is presented and the components contributed from the oscillations of the virtual cathodes in each spectrum are pointed out
Modeling microwave/electron-cloud interaction
International Nuclear Information System (INIS)
Mattes, M; Sorolla, E; Zimmermann, F
2013-01-01
Starting from the separate codes BI-RME and ECLOUD or PyECLOUD, we are developing a novel joint simulation tool, which models the combined effect of a charged particle beam and of microwaves on an electron cloud. Possible applications include the degradation of microwave transmission in telecommunication satellites by electron clouds; the microwave-transmission techniques being used in particle accelerators for the purpose of electroncloud diagnostics; the microwave emission by the electron cloud itself in the presence of a magnetic field; and the possible suppression of electron-cloud formation in an accelerator by injecting microwaves of suitable amplitude and frequency. A few early simulation results are presented. (author)
Kohjiro, Satoshi; Hirayama, Fuminori
2018-07-01
A novel approach, frequency-domain cascading microwave multiplexers (MW-Mux), has been proposed and its basic operation has been demonstrated to increase the number of pixels multiplexed in a readout line U of MW-Mux for superconducting detector arrays. This method is an alternative to the challenging development of wideband, large power, and spurious-free room-temperature (300 K) electronics. The readout system for U pixels consists of four main parts: (1) multiplexer chips connected in series those contain U superconducting resonators in total. (2) A cryogenic high-electron-mobility transistor amplifier (HEMT). (3) A 300 K microwave frequency comb generator based on N(≡U/M) parallel units of digital-to-analog converters (DAC). (4) N parallel units of 300 K analog-to-digital converters (ADC). Here, M is the number of tones each DAC produces and each ADC handles. The output signal of U detectors multiplexed at the cryogenic stage is transmitted through a cable to the room temperature and divided into N processors where each handles M pixels. Due to the reduction factor of 1/N, U is not anymore dominated by the 300 K electronics but can be increased up to the potential value determined by either the bandwidth or the spurious-free power of the HEMT. Based on experimental results on the prototype system with N = 2 and M = 3, neither excess inter-pixel crosstalk nor excess noise has been observed in comparison with conventional MW-Mux. This indicates that the frequency-domain cascading MW-Mux provides the full (100%) usage of the HEMT band by assigning N 300 K bands on the frequency axis without inter-band gaps.
Heat transfer within a concrete slab applying the microwave decontamination process
International Nuclear Information System (INIS)
Li, W.; Ebadian, M.A.; White, T.L.; Grubb, R.G.
1993-01-01
Decontamination of a radioactive contaminated concrete surface is a new technology for the treatment of radioactive waste. In this paper, concrete decontamination using microwave technology is investigated theoretically. A plane wave assumption of microwave propagation has been employed to estimate the microwave field and power dissipation within the concrete. A one-dimensional, unsteady heat conduction model with microwave heat dissipation resulting from microwave-material interaction has been used to evaluate frequency, steel reinforcement within the concrete, and thermal boundary conditions are also considered in the present model. Four commonly used microwave frequencies of 0.896, 2.45, 10.6, and 18.0 GHz have been utilized in the analysis. The results revealed that as the microwave frequency increases to, or higher than 10.6 GHz, the microwave power dissipation shifts toward the front surface of the concrete. Furthermore, it was observed that use of a higher frequency microwave could reduce power intensity requirements needed to raise the temperature difference or thermal stress to the same value in the same period of time. It was found that the presence of reinforcing steel mesh causes part of the microwave energy to be blocked and reflected. Thus, the temperature or thermal stress of the concrete increases before the reinforcement, and decreases after the reinforcement. 16 refs., 6 figs., 3 tabs
International Nuclear Information System (INIS)
Rao, K.S.; Chandra, G.; Rao, P.V.N.
1987-01-01
The analysis of brightness temperature data acquired from field and aircraft experiments demonstrates a linear relationship between soil moisture and brightness temperature. However, the analysis of brightness temperature data acquired by the Skylab radiometer demonstrates a non-linear relationship between soil moisture and brightness temperature. In view of the above and also because of recent theoretical developments for the calculation of the dielectric constant and brightness temperature under varying soil moisture profile conditions, an attempt is made to study the theoretical relationship between brightness temperature and soil moisture as a function of frequency. Through the above analysis, the appropriate microwave frequency range for soil moisture studies is recommended
Tunable Multiband Microwave Photonic Filters
Directory of Open Access Journals (Sweden)
Mable P. Fok
2017-11-01
Full Text Available The increasing demand for multifunctional devices, the use of cognitive wireless technology to solve the frequency resource shortage problem, as well as the capabilities and operational flexibility necessary to meet ever-changing environment result in an urgent need of multiband wireless communications. Spectral filter is an essential part of any communication systems, and in the case of multiband wireless communications, tunable multiband RF filters are required for channel selection, noise/interference removal, and RF signal processing. Unfortunately, it is difficult for RF electronics to achieve both tunable and multiband spectral filtering. Recent advancements of microwave photonics have proven itself to be a promising candidate to solve various challenges in RF electronics including spectral filtering, however, the development of multiband microwave photonic filtering still faces lots of difficulties, due to the limited scalability and tunability of existing microwave photonic schemes. In this review paper, we first discuss the challenges that were facing by multiband microwave photonic filter, then we review recent techniques that have been developed to tackle the challenge and lead to promising developments of tunable microwave photonic multiband filters. The successful design and implementation of tunable microwave photonic multiband filter facilitate the vision of dynamic multiband wireless communications and radio frequency signal processing for commercial, defense, and civilian applications.
Wu, L Y; Wang, K L; Jiang, T; Kang, L; Yang, S Z; Wu, P H
2002-01-01
In this paper, we present our approach to probe the local microwave properties of superconducting thin films by using the microwave near-field scanning technique. We have employed a coaxial cavity together with a niobium tip as the probe and established a scanning sample stage cooled by liquid nitrogen to study thin film devices at low temperature in our scanning microwave near-field microscope. Nondestructive images have been obtained on the inhomogeneity of the YBaCuO superconducting thin films at microwave frequency. We believe that these results would be helpful in evaluating the microwave performance of the devices.
Modeling Plasma Formation in a Micro-gap at Microwave Frequency
Bowman, Arthur; Remillard, Stephen
2013-03-01
In the presence of a strong electric field, gas molecules become ionized, forming a plasma. The study of this dielectric breakdown at microwave frequency has important applications in improving the operation of radio frequency (RF) devices, where the high electric fields present in small gaps can easily ionize gases like air. A cone and tuner resonant structure was used to induce breakdown of diatomic Nitrogen in adjustable micro-gaps ranging from 13 to 1,156 μm. The electric field for plasma formation exhibited strong pressure dependence in the larger gap sizes, as predicted by previous theoretical and experimental work. Pressure is proportional to the frequency of collision between electrons and molecules, which increases with pressure when the gap is large, but levels off in the micro-gap region. A separate model of the breakdown electric field based on the characteristic diffusion length of the plasma also fit the data poorly for these smaller gap sizes. This may be explained by a hypothesis that dielectric breakdown at and below the 100 μm gap size occurs outside the gap, an argument that is supported by the observation of very high breakdown threshold electric fields in this region. Optical emissions revealed that vibrational and rotational molecular transitions of the first positive electronic system are suppressed in micro-gaps, indicating that transitions into the molecular ground state do not occur in micro-gap plasmas. Acknowledgements: National Science Foundation under NSF-REU Grant No. PHY/DMR-1004811, the Provost's Office of Hope College, and the Hope College Division of Natural and Applied Sciences.
Photonic microwave signals with zeptosecond-level absolute timing noise
Xie, Xiaopeng; Bouchand, Romain; Nicolodi, Daniele; Giunta, Michele; Hänsel, Wolfgang; Lezius, Matthias; Joshi, Abhay; Datta, Shubhashish; Alexandre, Christophe; Lours, Michel; Tremblin, Pierre-Alain; Santarelli, Giorgio; Holzwarth, Ronald; Le Coq, Yann
2017-01-01
Photonic synthesis of radiofrequency (RF) waveforms revived the quest for unrivalled microwave purity because of its ability to convey the benefits of optics to the microwave world. In this work, we perform a high-fidelity transfer of frequency stability between an optical reference and a microwave signal via a low-noise fibre-based frequency comb and cutting-edge photodetection techniques. We demonstrate the generation of the purest microwave signal with a fractional frequency stability below 6.5 × 10-16 at 1 s and a timing noise floor below 41 zs Hz-1/2 (phase noise below -173 dBc Hz-1 for a 12 GHz carrier). This outperforms existing sources and promises a new era for state-of-the-art microwave generation. The characterization is achieved through a heterodyne cross-correlation scheme with the lowermost detection noise. This unprecedented level of purity can impact domains such as radar systems, telecommunications and time-frequency metrology. The measurement methods developed here can benefit the characterization of a broad range of signals.
Integrated InP frequency discriminator for Phase-modulated microwave photonic links.
Fandiño, J S; Doménech, J D; Muñoz, P; Capmany, J
2013-02-11
We report the design, fabrication and characterization of an integrated frequency discriminator on InP technology for microwave photonic phase modulated links. The optical chip is, to the best of our knowledge, the first reported in an active platform and the first to include the optical detectors. The discriminator, designed as a linear filter in intensity, features preliminary SFDR values the range between 67 and 79 dB.Hz(2/3) for signal frequencies in the range of 5-9 GHz limited, in principle, by the high value of the optical losses arising from the use of several free space coupling devices in our experimental setup. As discussed, these losses can be readily reduced by the use of integrated spot-size converters improving the SFDR by 17.3 dB (84-96 dB.Hz(2/3)). Further increase up to a range of (104-116 dB.Hz(2/3)) is possible by reducing the system noise eliminating the EDFA employed in the setup and using a commercially available laser source providing higher output power and lower relative intensity noise. Other paths for improvement requiring a filter redesign to be linear in the optical field are also discussed.
International Nuclear Information System (INIS)
Angerer, Andreas; Astner, Thomas; Wirtitsch, Daniel; Majer, Johannes; Sumiya, Hitoshi; Onoda, Shinobu; Isoya, Junichi; Putz, Stefan
2016-01-01
We design and implement 3D-lumped element microwave cavities that spatially focus magnetic fields to a small mode volume. They allow coherent and uniform coupling to electron spins hosted by nitrogen vacancy centers in diamond. We achieve large homogeneous single spin coupling rates, with an enhancement of more than one order of magnitude compared to standard 3D cavities with a fundamental resonance at 3 GHz. Finite element simulations confirm that the magnetic field distribution is homogeneous throughout the entire sample volume, with a root mean square deviation of 1.54%. With a sample containing 10"1"7 nitrogen vacancy electron spins, we achieve a collective coupling strength of Ω = 12 MHz, a cooperativity factor C = 27, and clearly enter the strong coupling regime. This allows to interface a macroscopic spin ensemble with microwave circuits, and the homogeneous Rabi frequency paves the way to manipulate the full ensemble population in a coherent way.
Microwave power engineering generation, transmission, rectification
Okress, Ernest C
1968-01-01
Microwave Power Engineering, Volume 1: Generation, Transmission, Rectification considers the components, systems, and applications and the prevailing limitations of the microwave power technology. This book contains four chapters and begins with an introduction to the basic concept and developments of microwave power technology. The second chapter deals with the development of the main classes of high-power microwave and optical frequency power generators, such as magnetrons, crossed-field amplifiers, klystrons, beam plasma amplifiers, crossed-field noise sources, triodes, lasers. The third
International Nuclear Information System (INIS)
Anon.
1988-01-01
The Microwave Tokamak Experiment, now under construction at the Laboratory, will use microwave heating from a free-electron laser. The intense microwave pulses will be injected into the tokamak to realize several goals, including a demonstration of the effects of localized heat deposition within magnetically confined plasma, a better understanding of energy confinement in tokamaks, and use of the new free-electron laser technology for plasma heating. The experiment, soon to be operational, provides an opportunity to study dense plasmas heated by powers unprecedented in the electron-cyclotron frequency range required by the especially high magnetic fields used with the MTX and needed for reactors. 1 references, 5 figures, 3 tables
Integrated Microwave Photonics
Marpaung, David; Roeloffzen, Chris; Heideman, René; Leinse, Arne; Sales Maicas, Salvador; Capmany Francoy, José
2013-01-01
Microwave photonics (MWP) is an emerging field in which radio frequency (RF) signals are generated, distributed, processed and analyzed using the strength of photonic techniques. It is a technology that enables various functionalities which are not feasible to achieve only in the microwave domain. A particular aspect that recently gains significant interests is the use of photonic integrated circuit (PIC) technology in the MWP field for enhanced functionalities and robustness as well as the r...
Microwave processing of radioactive materials-I
International Nuclear Information System (INIS)
White, T.L.; Berry, J.B.
1989-01-01
This paper is the first of two papers that reviews the major past and present applications of microwave energy for processing radioactive materials, with particular emphasis on processing radioactive wastes. Microwave heating occurs through the internal friction produced inside a dielectric material when its molecules vibrate in response to an oscillating microwave field. For this presentation, we shall focus on the two FCC-approved microwave frequencies for industrial, scientific, and medical use, 915 and 2450 MHz. Also, because of space limitations, we shall postpone addressing plasma processing of hazardous wastes using microwave energy until a later date. 13 refs., 4 figs
360° tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator
DEFF Research Database (Denmark)
Pu, Minhao; Xue, Weiqi; Liu, Liu
2010-01-01
We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained......We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained...
Dual-band and high-efficiency polarization converter based on metasurfaces at microwave frequencies
Liu, Yajun; Xia, Song; Shi, Hongyu; Zhang, Anxue; Xu, Zhuo
2016-06-01
We present a dual-band and high-efficiency polarization converter in microwave regime. The proposed converter can convert a linearly polarized wave to its cross-polarized wave for two distinct bands: Ku (11.5-20.0 GHz) and Ka (28.8-34.0 GHz). It can also convert the linearly polarized wave to a circularly polarized wave at four other frequencies. The experimental results are in good agreement with simulation results for both frequency bands. The polarization conversion ratio is above 0.94 for the Ku-band and 0.90 for the Ka-band. Furthermore, the converter can achieve dual-band and high-efficiency polarization conversion over angles of incidence up to 45°. The converter is also polarization-selective in that only the x- and y-polarized waves can be converted. The physical mechanism of the dual-band polarization conversion effect is interpreted via decomposed electric field components that couple with different plasmon resonance modes of the structure.
Zaldívar Huerta, Ignacio E.; Pérez Montaña, Diego F.; Nava, Pablo Hernández; Juárez, Alejandro García; Asomoza, Jorge Rodríguez; Leal Cruz, Ana L.
2013-12-01
We experimentally demonstrate the use of an electro-optical transmission system for distribution of video over long-haul optical point-to-point links using a microwave photonic filter in the frequency range of 0.01-10 GHz. The frequency response of the microwave photonic filter consists of four band-pass windows centered at frequencies that can be tailored to the function of the spectral free range of the optical source, the chromatic dispersion parameter of the optical fiber used, as well as the length of the optical link. In particular, filtering effect is obtained by the interaction of an externally modulated multimode laser diode emitting at 1.5 μm associated to the length of a dispersive optical fiber. Filtered microwave signals are used as electrical carriers to transmit TV-signal over long-haul optical links point-to-point. Transmission of TV-signal coded on the microwave band-pass windows located at 4.62, 6.86, 4.0 and 6.0 GHz are achieved over optical links of 25.25 km and 28.25 km, respectively. Practical applications for this approach lie in the field of the FTTH access network for distribution of services as video, voice, and data.
SETI - A preliminary search for narrowband signals at microwave frequencies
Cuzzi, J. N.; Clark, T. A.; Tarter, J. C.; Black, D. C.
1977-01-01
In the search for intelligent signals of extraterrestrial origin, certain forms of signals merit immediate and special attention. Extremely narrowband signals of spectral width similar to our own television transmissions are most favored energetically and least likely to be confused with natural celestial emission. A search of selected stars has been initiated using observational and data processing techniques optimized for the detection of such signals. These techniques allow simultaneous observation of 10 to the 5th to 10 to the 6th channels within the observed spectral range. About two hundred nearby (within 80 LY) solar type stars have been observed at frequencies near the main microwave transitions of the hydroxyl radical. In addition, several molecular (hydroxyl) masers and other non-thermal sources have been observed in this way in order to uncover any possible fine spectral structure of natural origin and to investigate the potential of such an instrument for radioastronomy.
Dielectric properties of almond kernels associated with radio frequency and microwave pasteurization
Li, Rui; Zhang, Shuang; Kou, Xiaoxi; Ling, Bo; Wang, Shaojin
2017-02-01
To develop advanced pasteurization treatments based on radio frequency (RF) or microwave (MW) energy, dielectric properties of almond kernels were measured by using an open-ended coaxial-line probe and impedance analyzer at frequencies between 10 and 3000 MHz, moisture contents between 4.2% to 19.6% w.b. and temperatures between 20 and 90 °C. The results showed that both dielectric constant and loss factor of the almond kernels decreased sharply with increasing frequency over the RF range (10-300 MHz), but gradually over the measured MW range (300-3000 MHz). Both dielectric constant and loss factor of almond kernels increased with increasing temperature and moisture content, and largely enhanced at higher temperature and moisture levels. Quadratic polynomial equations were developed to best fit the relationship between dielectric constant or loss factor at 27, 40, 915 or 2450 MHz and sample temperature/moisture content with R2 greater than 0.967. Penetration depth of electromagnetic wave into samples decreased with increasing frequency (27-2450 MHz), moisture content (4.2-19.6% w.b.) and temperature (20-90 °C). The temperature profiles of RF heated almond kernels under three moisture levels were made using experiment and computer simulation based on measured dielectric properties. Based on the result of this study, RF treatment has potential to be practically used for pasteurization of almond kernels with acceptable heating uniformity.
The Interaction of C-Band Microwaves with Large Plasma Sheets
International Nuclear Information System (INIS)
Ding Liang; Huo Wenqing; Yang Xinjie; Xu Yuemin
2012-01-01
A large plasma sheet 60 cm×60 cm×2 cm in size was generated using a hollow cathode, and measurements were conducted for interactions including transmission, reflection and absorption. With different discharge parameters, plasma sheets can vary and influence microwave strength. Microwave reflection decreases when the discharge current rises, and the opposite occurs in transmission. The C-band microwave is absorbed when it is propagated through large plasma sheets at higher pressure. When plasma density and collision frequency are fitted with incident microwave frequency, a large amount of microwave energy is consumed. Reflection, transmission and absorption all exist simultaneously. Plasma sheets are an attractive alternative to microwave steering at low pressure, and the microwave reflection used in receiving radar can be altered by changing the discharge parameters.
Linear, Low Noise Microwave Photonic Systems using Phase and Frequency Modulation
2012-05-11
Lightwave Technology, Journal of, vol. 24, no. 12, pp. 4628 –4641, Dec 2006. [2] J. Capmany and D. Novak, “Microwave photonics combines two worlds...Journal of, vol. 32, no. 7, pp. 1141 –1149, Jul 1996. [13] J. Capmany and D. Novak, “Microwave photonics combines two worlds,” Nature Photonics, vol. 1, no... Capmany , “Analytical model and figures of merit for filtered Microwave photonic links,” Opt. Express, vol. 19, no. 20, pp. 19 758–19 774, Sep 2011
Connecting field ionization to photoionization via 17- and 36-GHz microwave fields
International Nuclear Information System (INIS)
Gurian, J. H.; Overstreet, K. R.; Gallagher, T. F.; Maeda, H.
2010-01-01
Here we present experimental results connecting field ionization to photoionization in Li Rydberg atoms obtained with 17- and 36-GHz microwave fields. At a low principal quantum number n, where the microwave frequency ω is much lower than the classical, or Kepler frequency, ω K =1/n 3 , microwave ionization occurs by field ionization, at E=1/9n 4 . When the microwave frequency exceeds the Kepler frequency, ω>1/n 3 , the field required for ionization is independent of n and given by E=2.4ω 5/3 , in agreement with dynamic localization models, which cross over to a Fermi's Golden Rule approach at the photoionization limit. A surprising aspect of our results is that when ω≅1/2n 2 , the one- and multiphoton ionization rates are similar, and even at the lowest microwave powers, all are 10 times lower than the perturbation theory rate calculated for single-photon ionization. Further, we show that when the Rydberg atoms are excited in the presence of the microwave field, the probability of an atom's being bound at the end of the microwave pulse passes smoothly across the limit. This microwave stimulated recombination to bound Rydberg states can be well described by a simple classical model. More generally, these results suggest that the problem of a Rydberg atom coupled to a high-frequency microwave field is similar to the problem of interchannel internal coupling in multilimit atoms, a problem well described by quantum defect theory.
System design development for microwave and millimeter-wave materials processing
Feher, Lambert; Thumm, Manfred
2002-06-01
The most notable effect in processing dielectrics with micro- and millimeter-waves is volumetric heating of these materials, offering the opportunity of very high heating rates for the samples. In comparison to conventional heating where the heat transfer is diffusive and depends on the thermal conductivity of the material, the microwave field penetrates the sample and acts as an instantaneous heat source at each point of the sample. By this unique property, microwave heating at 2.45 GHz and 915 MHz ISM (Industrial, Medical, Scientific) frequencies is established as an important industrial technology since more than 50 years ago. Successful application of microwaves in industries has been reported e.g. by food processing systems, domestic ovens, rubber industry, vacuum drying etc. The present paper shows some outlines of microwave system development at Forschungszentrum Karlsruhe, IHM by transferring properties from the higher frequency regime (millimeter-waves) to lower frequency applications. Anyway, the need for using higher frequencies like 24 GHz (ISM frequency) for industrial applications has to be carefully verified with respect to special physical/engineering advantages or to limits the standard microwave technology meets for the specific problem.
RF and microwave microelectronics packaging II
Sturdivant, Rick
2017-01-01
Reviews RF, microwave, and microelectronics assembly process, quality control, and failure analysis Bridges the gap between low cost commercial and hi-res RF/Microwave packaging technologies Engages in an in-depth discussion of challenges in packaging and assembly of advanced high-power amplifiers This book presents the latest developments in packaging for high-frequency electronics. It is a companion volume to “RF and Microwave Microelectronics Packaging” (2010) and covers the latest developments in thermal management, electrical/RF/thermal-mechanical designs and simulations, packaging and processing methods, and other RF and microwave packaging topics. Chapters provide detailed coverage of phased arrays, T/R modules, 3D transitions, high thermal conductivity materials, carbon nanotubes and graphene advanced materials, and chip size packaging for RF MEMS. It appeals to practicing engineers in the electronic packaging and high-frequency electronics domain, and to academic researchers interested in underst...
Harmonic distortion in microwave photonic filters.
Rius, Manuel; Mora, José; Bolea, Mario; Capmany, José
2012-04-09
We present a theoretical and experimental analysis of nonlinear microwave photonic filters. Far from the conventional condition of low modulation index commonly used to neglect high-order terms, we have analyzed the harmonic distortion involved in microwave photonic structures with periodic and non-periodic frequency responses. We show that it is possible to design microwave photonic filters with reduced harmonic distortion and high linearity even under large signal operation.
Directory of Open Access Journals (Sweden)
Stelios Floros
Full Text Available The use of microwaves in every day's applications raises issues regarding the non thermal biological effects of microwaves. In this work we employ molecular dynamics simulations to advance further the dielectric studies of protein solutions in the case of lysozyme, taking into consideration possible frequency dependent changes in the structural and dynamic properties of the system upon application of electric field in the microwave region. The obtained dielectric spectra are identical with those derived in our previous work using the Fröhlich-Kirkwood approach in the framework of the linear response theory. Noticeable structural changes in the protein have been observed only at frequencies near its absorption maximum. Concerning Cα position fluctuations, different frequencies affected different regions of the protein sequence. Furthermore, the influence of the field on the kinetics of protein-water as well as on the water-water hydrogen bonds in the first hydration shell has been studied; an extension of the Luzar-Chandler kinetic model was deemed necessary for a better fit of the applied field results and for the estimation of more accurate hydrogen bond lifetime values.
Great microwave bursts and hard X-rays from solar flares
International Nuclear Information System (INIS)
Wiehl, H.J.; Batchelor, D.A.; Crannell, C.J.; Dennis, B.R.; Price, P.N.
1983-06-01
The microwave and hard X-ray charateristics of 13 solar flares that produced microwave fluxes greater than 500 Solar Flux Units were analyzed. These Great Microwave Bursts were observed in the frequency range from 3 to 35 GHz at Berne, and simultaneous hard X-ray observations were made in the energy range from 30 to 500 keV with the Hard X-Ray Burst Spectrometer on the Solar Maximum Mission spacecraft. The principal aim of this analysis is to determine whether or not the same distribution of energetic electrons can explain both emissions. Correlations were found between respective temporal characteristics and, for the first time, between microwave and hard X-ray spectral characteristics. A single-temperature and a multi-temperature model from the literature were tested for consistency with the coincident X-ray and microwave spectra at microwave burst maximum. Four events are inconsistent with both of the models tested, and neither of the models attempts to explain the high-frequency part of the microwave spectrum. A model in which the emissions above and below the peak frequency originate in two different parts of a diverging magnetic loop is proposed. With this model the entire microwave spectrum of all but one of the events is explained
High-performance flexible microwave passives on plastic
Ma, Zhenqiang; Seo, Jung-Hun; Cho, Sang June; Zhou, Weidong
2014-06-01
We report the demonstration of bendable inductors, capacitors and switches fabricated on a polyethylene terephthalate (PET) substrate that can operate at high microwave frequencies. By employing bendable dielectric and single crystalline semiconductor materials, spiral inductors and metal-insulator-metal (MIM) capacitors with high quality factors and high resonance frequencies and single-pole, single-throw (SPST) switches were archived. The effects of mechanical bending on the performance of inductors, capacitors and switches were also measured and analyzed. We further investigated the highest possible resonance frequencies and quality factors of inductors and capacitors and, high frequency responses and insertion loss. These demonstrations will lead to flexible radio-frequency and microwave systems in the future.
Multi-Functional Fibre-Optic Microwave Links
DEFF Research Database (Denmark)
Gliese, Ulrik Bo
1998-01-01
The multi-functionality of microwave links based on remote heterodyne detection of signals from a dual-frequency laser transmitter is discussed and experimentally demonstrated in this paper. Typically, direct detection in conjunction with optical intensity modulation is used to implement fibre......-optic microwave links. The resulting links are inherently transparent and mainly used for signal transmission. As opposed to direct detection links, remote heterodyne detection links can directly perform functionalities such as modulation, frequency conversion, and transparent signal recovery in addition...
Energy Technology Data Exchange (ETDEWEB)
Torrisi, Giuseppe [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, 95125 Catania (Italy); University Mediterranea of Reggio Calabria, Reggio Calabria (Italy); Mascali, David; Neri, Lorenzo; Leonardi, Ornella; Celona, Luigi; Castro, Giuseppe; Agnello, Riccardo; Caruso, Antonio; Passarello, Santi; Longhitano, Alberto; Gammino, Santo [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, 95125 Catania (Italy); Sorbello, Gino [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, 95125 Catania (Italy); University of Catania, Catania, Italy and INFN-LNS, Catania (Italy); Isernia, Tommaso [University Mediterranea of Reggio Calabria, Reggio Calabria (Italy)
2016-02-15
The Electron Cyclotron Resonance Ion Sources (ECRISs) development is strictly related to the availability of new diagnostic tools, as the existing ones are not adequate to such compact machines and to their plasma characteristics. Microwave interferometry is a non-invasive method for plasma diagnostics and represents the best candidate for plasma density measurement in hostile environment. Interferometry in ECRISs is a challenging task mainly due to their compact size. The typical density of ECR plasmas is in the range 10{sup 11}–10{sup 13} cm{sup −3} and it needs a probing beam wavelength of the order of few centimetres, comparable to the chamber radius. The paper describes the design of a microwave interferometer developed at the LNS-INFN laboratories based on the so-called “frequency sweep” method to filter out the multipath contribution in the detected signals. The measurement technique and the preliminary results (calibration) obtained during the experimental tests will be presented.
Heat transfer within a concrete slab with a finite microwave heating source
International Nuclear Information System (INIS)
Lagos, L.E.; Li, W.; Ebadian, M.A.; Grubb, R.G.
1995-01-01
In the present paper, the concrete decontamination and decommissioning process with a finite microwave heating source is investigated theoretically. For the microwave induced heating pattern, a multilayer concrete slab, which includes steel reinforcement mesh, is assumed to be exposed to a finite plane microwave source at normal incidence. Two-dimensional heat transport within the concrete is also considered to evaluate the variations of temperature with heating time at different frequencies with and without the presence of the reinforcement bars. Four commonly used industrial microwave frequencies of 0.896, 2.45, 10.6 and 18.0 GHz have been selected. The results revealed that as the microwave frequency increases to, or higher than 10.6 GHz, the maximum temperature shifts toward the front surface of the concrete. It was found that the presence of a steel reinforcement mesh causes part of the microwave energy to be blocked and reflected. Furthermore, it was observed that the temperature distribution is nearly uniform within the dimensions of the microwave applicator for a high microwave power intensity and a short heating time. (author)
Stepped-frequency radar sensors theory, analysis and design
Nguyen, Cam
2016-01-01
This book presents the theory, analysis and design of microwave stepped-frequency radar sensors. Stepped-frequency radar sensors are attractive for various sensing applications that require fine resolution. The book consists of five chapters. The first chapter describes the fundamentals of radar sensors including applications followed by a review of ultra-wideband pulsed, frequency-modulated continuous-wave (FMCW), and stepped-frequency radar sensors. The second chapter discusses a general analysis of radar sensors including wave propagation in media and scattering on targets, as well as the radar equation. The third chapter addresses the analysis of stepped-frequency radar sensors including their principles and design parameters. Chapter 4 presents the development of two stepped-frequency radar sensors at microwave and millimeter-wave frequencies based on microwave integrated circuits (MICs), microwave monolithic integrated circuits (MMICs) and printed-circuit antennas, and discusses their signal processing....
International Nuclear Information System (INIS)
Wang, De-bo; Liao, Xiao-ping
2009-01-01
A novel symmetrical microwave power sensor based on GaAs monolithic microwave integrated circuit (MMIC) technology is presented in this paper. In this power sensor, the left section inputs the microwave power, while the right section inputs the dc power. Because of the symmetrical structure, this power sensor is created to provide more accurate microwave power measurement capability without mismatch uncertainty and restrain temperature drift. The loss model is built and the loss voltage is 0.8 mV at 20 GHz when the input power is 100 mW. This power sensor is designed and fabricated using GaAs MMIC technology. And it is measured in the frequency range up to 20 GHz with the input power in the −20 dBm to 19 dBm range. Over the 19 dBm dynamic range, the sensitivity can achieve about 0.2 mV mW −1 . The difference between the input powers in the two sections is below 0.1% for equal output voltages. For an amplitude modulation measurement, the carrier frequency is the main factor to influence the measurement results. In short, the key aspect of this power sensor is that the microwave power measurement can be replaced by a dc power measurement with precise wideband
Planck intermediate results XXXI. Microwave survey of Galactic supernova remnants
DEFF Research Database (Denmark)
Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.
2016-01-01
The all-sky Planck survey in 9 frequency bands was used to search for emission from all 274 known Galactic supernova remnants. Of these, 16 were detected in at least two Planck frequencies. The radio-through-microwave spectral energy distributions were compiled to determine the mechanism for micr......The all-sky Planck survey in 9 frequency bands was used to search for emission from all 274 known Galactic supernova remnants. Of these, 16 were detected in at least two Planck frequencies. The radio-through-microwave spectral energy distributions were compiled to determine the mechanism...... for microwave emission. In only one case, IC 443, is there high-frequency emission clearly from dust associated with the supernova remnant. In all cases, the low-frequency emission is from synchrotron radiation. As predicted for a population of relativistic particles with energy distribution that extends...
Elliptical metasurfaces for cloaking and antenna applications at microwave and terahertz frequencies
Mehrpourbernety, Hossein
One of the interesting applications of metamaterials is the phenomenon of electromagnetic invisibility and cloaking, which implies the suppression of bistatic scattering width of a given object, independent of incident and observation angles. In this regard, diverse techniques have been proposed to analyze and design electromagnetic cloak structures, including transformation optics, anomalous resonance methods, transmission-line networks, and plasmonic cloaking, among others. A common drawback of all these methods is that they rely on bulk materials, which are difficult to realize in practice. To overcome this issue, the mantle cloaking method has been proposed, which utilizes an ultrathin metasurface that provides anti-phase surface currents to reduce the scattering dominant mode of a given object. Recently, an analytical model has been proposed to cloak dielectric and conducting cylindrical objects realized with printed and slotted arrays at microwave frequencies. At low-terahertz (THz) frequencies, one of the promising materials to realize the required metasurface is graphene. In this regard, a graphene monolayer, characterized by inductive reactance, has been proposed to cloak dielectric planar and cylindrical objects. Then, it has been shown that a metasurface made of graphene nanopatches owns dual capacitive/inductive inductance and can be used to cloak both dielectric and conducting cylindrical objects at low-THz frequencies. So far, planar and cylindrical dielectric and conducting structures have been studied. In our study, we have extended the concept and presented an accurate analytical approach to investigate the cloaking of two-dimensional (2-D) elliptical objects including infinite dielectric elliptical cylinders using graphene monolayer; metallic elliptical cylinders, and also, as a special case, 2-D metallic strips using a nanostructured graphene patch array at low-THz frequencies. We have also obtained the results for cloaking of ellipses at
International Nuclear Information System (INIS)
Rebuffi, L.
1987-10-01
The development and optimization of a microwave technique, concerning the high frequency (electronic cyclotron frequency) plasma heating is presented. The experiments are effectuated on the Fontenay-aux-Roses TFR tokamak, with 660 kw whole power, during 100 msec, produced at 60 GHz. Low power tests are performed on the different transmission line components (there are 3, formed by metallic circular waveguides). The work also includes: the development of a lens formed by thin metallic plans; the study of slotted surface mirror; the development of a system for the accurate measurement (5.10 -6 ) of the gyrotronic frequency; a theory, based on the equivalent circuits method, generalized to the rotational and polarization mirrors; the development of a numerical simulation code. A practical scheme, for the optimization of the parameters concerning the optical transmission line project, is given. The results of this work can be applied to the experiment involving power levels, frequencies and times of impulsion increasingly higher (respectively about MW, 100 GHz and 10s) than the reported ones. Moreover, they can also be used in any experiment in the microwave field [fr
Tunable Water-based Microwave Metasurface
DEFF Research Database (Denmark)
Kapitanova, Polina; Odit, Mikhail; Dobrykh, Dmitry
2017-01-01
A water-based dynamically tunable microwave metasurface is developed and experimentally investigated. A simple approach to tune the metasurface properties by changing the shape of water-based unit cells by gravitation force is proposed. The transmission spectra of the metasurface for linear...... angle. The proposed approach can be used to design cheap metasurfaces for electromagnetic wave control in the microwave frequency range....
International Nuclear Information System (INIS)
Boskovic, Bojan O.; Stolojan, Vlad; Zeze, Dagou A.; Forrest, Roy D.; Silva, S. Ravi P.; Haq, Sajad
2004-01-01
Carbon nanofibers have been grown at room temperature using a combination of radio frequency and microwave assisted plasma-enhanced chemical vapor deposition. The nanofibers were grown, using Ni powder catalyst, onto substrates kept at room temperature by using a purposely designed water-cooled sample holder. Branched carbon nanofiber growth was obtained without using a template resulting in interconnected carbon nanofiber network formation on substrates held at room temperature. This method would allow room-temperature direct synthesized nanofiber networks over relatively large areas, for a range of temperature sensitive substrates, such as organic materials, plastics, and other polymers of interest for nanoelectronic two-dimensional networks, nanoelectromechanical devices, nanoactuators, and composite materials
Simple microwave plasma source at atmospheric pressure
International Nuclear Information System (INIS)
Kim, Jeong H.; Hong, Yong C.; Kim, Hyoung S.; Uhm, Han S.
2003-01-01
We have developed a thermal plasma source operating without electrodes. One electrodeless torch is the microwave plasma-torch, which can produce plasmas in large quantities. We can generate plasma at an atmospheric pressure by marking use of the same magnetrons used as commercial microwave ovens. Most of the magnetrons are operated at the frequency of 2.45 GHz; the magnetron power microwave is about 1kW. Electromagnetic waves from the magnetrons propagate through a shorted waveguide. Plasma was generated under a resonant condition, by an auxiliary ignition system. The plasma is stabilized by vortex stabilization. Also, a high-power and high-efficiency microwave plasma-torch has been operated in air by combining two microwave plasma sources with 1kW, 2.45 GHz. They are arranged in series to generate a high-power plasma flame. The second torch adds all its power to the plasma flame of the first torch. Basically, electromagnetic waves in the waveguide were studied by a High Frequency Structure Simulator (HFSS) code and preliminary experiments were conducted
International Nuclear Information System (INIS)
Zhao Mao-Rong; Wu Zheng-Mao; Deng Tao; Zhou Zhen-Li; Xia Guang-Qiong
2015-01-01
Based on a semiconductor laser (SL) with incoherent optical feedback, a novel all-optical scheme for generating tunable and broadband microwave frequency combs (MFCs) is proposed and investigated numerically. The results show that, under suitable operation parameters, the SL with incoherent optical feedback can be driven to operate at a regular pulsing state, and the generated MFCs have bandwidths broader than 40 GHz within a 10 dB amplitude variation. For a fixed bias current, the line spacing (or repetition frequency) of the MFCs can be easily tuned by varying the feedback delay time and the feedback strength, and the tuning range of the line spacing increases with the increase in the bias current. The linewidth of the MFCs is sensitive to the variation of the feedback delay time and the feedback strength, and a linewidth of tens of KHz can be achieved through finely adjusting the feedback delay time and the feedback strength. In addition, mappings of amplitude variation, repetition frequency, and linewidth of MFCs in the parameter space of the feedback delay time and the feedback strength are presented. (paper)
Organic Synthesis Using Microwaves and Supported Reagents
In the electromagnetic radiation region, microwaves (0.3GHz-300GHz) lie between radiowave (Rf) and infrared (IR) frequencies with relatively large wavelengths (1 mm-1 m). Microwaves, non-ionizing radiation incapable of breaking bonds, are a form of energy that manifest as heat t...
Microwave multiplex readout for superconducting sensors
Energy Technology Data Exchange (ETDEWEB)
Ferri, E., E-mail: elena.ferri@mib.infn.it [Università Milano-Bicocca, Milan (Italy); INFN Sez. di Milano-Bicocca, Milan (Italy); Becker, D.; Bennett, D. [NIST, Boulder, CO (United States); Faverzani, M. [Università Milano-Bicocca, Milan (Italy); INFN Sez. di Milano-Bicocca, Milan (Italy); Fowler, J.; Gard, J. [NIST, Boulder, CO (United States); Giachero, A. [Università Milano-Bicocca, Milan (Italy); INFN Sez. di Milano-Bicocca, Milan (Italy); Hays-Wehle, J.; Hilton, G. [NIST, Boulder, CO (United States); Maino, M. [Università Milano-Bicocca, Milan (Italy); INFN Sez. di Milano-Bicocca, Milan (Italy); Mates, J. [NIST, Boulder, CO (United States); Puiu, A.; Nucciotti, A. [Università Milano-Bicocca, Milan (Italy); INFN Sez. di Milano-Bicocca, Milan (Italy); Reintsema, C.; Schmidt, D.; Swetz, D.; Ullom, J.; Vale, L. [NIST, Boulder, CO (United States)
2016-07-11
The absolute neutrino mass scale is still an outstanding challenge in both particle physics and cosmology. The calorimetric measurement of the energy released in a nuclear beta decay is a powerful tool to determine the effective electron-neutrino mass. In the last years, the progress on low temperature detector technologies has allowed to design large scale experiments aiming at pushing down the sensitivity on the neutrino mass below 1 eV. Even with outstanding performances in both energy (~ eV on keV) and time resolution (~ 1 μs) on the single channel, a large number of detectors working in parallel is required to reach a sub-eV sensitivity. Microwave frequency domain readout is the best available technique to readout large array of low temperature detectors, such as Transition Edge Sensors (TESs) or Microwave Kinetic Inductance Detectors (MKIDs). In this way a multiplex factor of the order of thousands can be reached, limited only by the bandwidth of the available commercial fast digitizers. This microwave multiplexing system will be used to readout the HOLMES detectors, an array of 1000 microcalorimeters based on TES sensors in which the {sup 163}Ho will be implanted. HOLMES is a new experiment for measuring the electron neutrino mass by means of the electron capture (EC) decay of {sup 163}Ho. We present here the microwave frequency multiplex which will be used in the HOLMES experiment and the microwave frequency multiplex used to readout the MKID detectors developed in Milan as well.
Photonics-Based Microwave Image-Reject Mixer
Directory of Open Access Journals (Sweden)
Dan Zhu
2018-03-01
Full Text Available Recent developments in photonics-based microwave image-reject mixers (IRMs are reviewed with an emphasis on the pre-filtering method, which applies an optical or electrical filter to remove the undesired image, and the phase cancellation method, which is realized by introducing an additional phase to the converted image and cancelling it through coherent combination without phase shift. Applications of photonics-based microwave IRM in electronic warfare, radar systems and satellite payloads are described. The inherent challenges of implementing photonics-based microwave IRM to meet specific requirements of the radio frequency (RF system are discussed. Developmental trends of the photonics-based microwave IRM are also discussed.
Study of the microwave emissivity characteristics over Gobi Desert
International Nuclear Information System (INIS)
Yubao, Qiu; Lijuan, Shi; Wenbo, Wu
2014-01-01
The microwave emissivity represents the capacity of the thermal radiation of the surface, and it is the significant parameter for understanding the geophysical processes such as surface energy budget and surface radiation. Different land covers have different emissivity properties, and the Gobi Desert in Central Asia seriously impact the sandstorms occur and develop in China, because of its special geographical environment and surface soil characteristics. In this study half-month averaged microwave emissivity from March 2003 to February 2004 over the Gobi Desert has been estimated. Emissivities in this area at different frequencies, polarization and their seasonal variations are discussed respectively. The results showed that emissivity polarization difference decrease as the frequency increases, and the polarization difference is large (0.03–0.127). The H polarization emissivity increases with increasing frequency, but the V-polarized microwave emissivity is reduced with increasing frequency because of the body scattering. In winter, emissivity decreases sharply in snow covered area, especially for higher frequencies (such as 89GHz). In addition, we compared emissivity with MODIS NDVI data at the same time in the Gobi Desert, and the results indicate that NDVI derived the good negative correlation with microwave emissivity polarization difference at 37GHz
Energy Technology Data Exchange (ETDEWEB)
Torres, F.; Jecko, B. [Univ. de Limoges (France). Inst. de Recherche en Communications Optiques et Microondes
1997-01-01
It is well known that the temperature rise in a material modifies its physical properties and, particularly, its dielectric permittivity. The dissipated electromagnetic power involved in microwave heating processes depending on {var_epsilon}({omega}), the electrical characteristics of the heated media must vary with the temperature to achieve realistic simulations. In this paper, the authors present a fast and accurate algorithm allowing, through a combined electromagnetic and thermal procedure, to take into account the influence of the temperature on the electrical properties of materials. First, the temperature dependence of the complex permittivity ruled by a Debye relaxation equation is investigated, and a realistic model is proposed and validated. Then, a frequency-dependent finite-differences time-domain ((FD){sup 2}TD) method is used to assess the instantaneous electromagnetic power lost by dielectric hysteresis. Within the same iteration, a time-scaled form of the heat transfer equation allows one to calculate the temperature distribution in the heated medium and then to correct the dielectric properties of the material using the proposed model. These new characteristics will be taken into account by the EM solver at the next iteration. This combined algorithm allows a significant reduction of computation time. An application to a microwave oven is proposed.
Peak effect in laser ablated DyBa2Cu3O7-δ films at microwave frequencies at subcritical currents
Bhangale, A.R.; Raychaudhuri, P.; Banerjee, T.; Shirodkar, V.S.
2001-01-01
In this article we report the observation of a peak in the microwave surface resistance (at frequencies ~10 GHz) of laser ablated DyBa2Cu3O7-δ films in magnetic field ranging from 2 to 9 kOe (||c) close to the superconducting transition temperature [Tc(H)]. The exact nature of the peak is sample
Room temperature microwave-assisted recording on 500-Gbpsi-class perpendicular medium
Nozaki, Y.; Ishida, N.; Soeno, Y.; Sekiguchi, K.
2012-10-01
Microwave-assisted recording on a 500-Gbpsi-class perpendicular medium was experimentally demonstrated at room temperature. Magnetization reversal under a radio-frequency magnetic field was measured by an electrically shorted coplanar waveguide, which enabled us to evaluate the change in the medium's ferromagnetic resonance spectrum. A frequency-dependent reduction in the switching field was clearly observed in response to a microwave impulse 50 ns in duration. A significant reduction of up to 30% in the coercive field was achieved by applying a microwave impulse with an amplitude of 25 dBm and a frequency of 15 GHz.
International Nuclear Information System (INIS)
Nguyen Cao, L.; Gagne, R.R.J.
1976-01-01
In order to verify experimentally and compare recent ion theories for cylindrical electrostatic probes, the ion density in a radio-frequency plasma was evaluated from V-I curves by means of six different theories. At low pressures, the theories of Bernstein and Rabinowitz, of Lam and Laframboise, give values of density which differ respectively by 20, 25 and 30% compared with the values obtained using a 10GHz focussed microwave interferometer. At the continuum limit, The Schulz and Brown's, and Su and Kiel's theories give density values which disagree respectively by 55 and 20%, compared with the values obtained by microwaves. For pressures varying from 0.05 to 3mmHg, the decrease of ion current, as predicted theorically by Waymouth, was observed. The density perturbation near the probe was found to be a dominant factor affecting the precision of density measurements, for pressures up to 2mmHg at least for our experimental conditions [fr
On the Earth Microwave Background: Absorption and Scattering by the Atmosphere
Directory of Open Access Journals (Sweden)
Robitaille P.-M.
2007-07-01
Full Text Available The absorption and scattering of microwave radiation by the atmosphere of the Earth is considered under a steady state scenario. Using this approach, it is demonstrated that the microwave background could not have a cosmological origin. Scientific observations in the microwave region are explained by considering an oceanic source, combined with both Rayleigh and Mie scattering in the atmosphere in the absence of net absorption. Importantly, at high frequencies, Mie scattering occurs primarily with forward propagation. This helps to explain the lack of high frequency microwave background signals when radio antennae are positioned on the Earth’s surface.
A semiconductor nanowire Josephson junction microwave laser
Cassidy, Maja; Uilhoorn, Willemijn; Kroll, James; de Jong, Damaz; van Woerkom, David; Nygard, Jesper; Krogstrup, Peter; Kouwenhoven, Leo
We present measurements of microwave lasing from a single Al/InAs/Al nanowire Josephson junction strongly coupled to a high quality factor superconducting cavity. Application of a DC bias voltage to the Josephson junction results in photon emission into the cavity when the bias voltage is equal to a multiple of the cavity frequency. At large voltage biases, the strong non-linearity of the circuit allows for efficient down conversion of high frequency microwave photons down to multiple photons at the fundamental frequency of the cavity. In this regime, the emission linewidth narrows significantly below the bare cavity linewidth to 50%. The junction-cavity coupling and laser emission can be tuned rapidly via an external gate, making it suitable to be integrated into a scalable qubit architecture as a versatile source of coherent microwave radiation. This work has been supported by the Netherlands Organisation for Scientific Research (NWO/OCW), Foundation for Fundamental Research on Matter (FOM), European Research Council (ERC), and Microsoft Corporation Station Q.
Microwave Enhanced Cotunneling in SET Transistors
DEFF Research Database (Denmark)
Manscher, Martin; Savolainen, M.; Mygind, Jesper
2003-01-01
Cotunneling in single electron tunneling (SET) devices is an error process which may severely limit their electronic and metrologic applications. Here is presented an experimental investigation of the theory for adiabatic enhancement of cotunneling by coherent microwaves. Cotunneling in SET...... transistors has been measured as function of temperature, gate voltage, frequency, and applied microwave power. At low temperatures and applied power levels, including also sequential tunneling, the results can be made consistent with theory using the unknown damping in the microwave line as the only free...
Experimental study on microwave vulnerability effect of integrated circuit
International Nuclear Information System (INIS)
Fang Jinyong; Shen Juai; Yang Zhiqiang; Qiao Dengjiang
2003-01-01
The microwave vulnerability effect of IC was presented in this paper. The damage power threshold of IC will decrease with the decrease of microwave frequency or the increase of pulse repetitive frequency, and if the microwave pulse width become larger, the damage power threshold will decrease too. However, there is an inflexion range and the damage power threshold varies little when the pulse width is larger than the inflexion range. The experiment results show that the damage power threshold of IC fit normal distribution, and the variance is very small, so the damage probability fits 0-1 distribution
Liu, Dingxin; Niu, Jiebin; Zhu, Haolin; Zhang, Jianyong
2018-02-01
Flexible transparent materials are a hot spot in current research but also a key technical difficulty in industry. They are playing an increasingly important role in flexible transparent display applications such as organic light-emitting diodes, transparent electrodes, and so on. On the other hand, the present research on nanopatterned antennas is mainly concentrated on the optical frequency but rarely on the microwave (such as 3G, 4G, and 5G) and terahertz frequency band communications, where nanopatterned antennas can have many novel applications. To the authors’ knowledge, this is the first paper that presents a method for preparing a flexible transparent Au electromagnetic metamaterial nanopatterned antenna. We study its free-space performance at ultra-high frequency and its application in electronic products such as smartphones, tablets, personal computers, and wearable devices (such as smart watches) which have the function of mobile communication. The experimental results showed that the transparency of the antenna designed and fabricated in this work can be as high as 94%, and its efficiency can reach 74.5%-91.9% of antennas commonly seen at present in academia and industry. By adjusting the capacitive and inductive reactance of the nanopatterned antenna’s matching circuit, combined with its measured efficiency and 3D electromagnetic simulation results, we speculate on the mechanism of the Au electromagnetic metamaterial nanopatterned antenna with good performance.
Gas Discharge Produced by Strong Microwaves of Nanosecond Duration
International Nuclear Information System (INIS)
Vikharev, A.L.
2000-01-01
The results of the investigation of nanosecond microwave discharge are reviewed. Nanosecond microwave discharge is a new branch of gas discharge physics. The paper lists base types of microwave generators used to produce nanosecond discharge and classifies the discharges relative to their base parameters: the way the discharge gets localized in a limited space, amplitude and frequency of microwave field, gas pressure, duration of microwave pulses. The laboratory experiments performed and the new effects which appear in nanosecond microwave discharge are briefly summarized. Different applications of such a discharge are analyzed on the basis of the experimental modelling. (author)
Design of an ellipsoidal mirror for freewave characterization of materials at microwave frequencies
International Nuclear Information System (INIS)
Rojo, M; Muñoz, J; Molina-Cuberos, G J; Margineda, J; García-Collado, Á J
2016-01-01
Free-wave characterization of the electromagnetic properties of materials at microwave frequencies requires that scattering at the edges of the samples and/or holder be minimized. Here, an ellipsoidal mirror is designed and characterized in order to decrease the size of the beam, thereby avoiding the scattering problems, even when relatively small samples are used. In the experimental configuration, both the emitting antenna and sample are located at the mirror focuses. Since both the emitted and reflected (focused) beams are Gaussian in nature, we make use of Gaussian beam theory to carry out the design. The mirror parameters are optimized by numerical simulations (COMSOL Multiphysics ® ) and then experimentally tested. An experimental setup is presented for dielectric, magnetic and chiral measurement in the 4.5–18 GHz band. (paper)
Cantilever-Based Microwave Biosensors: Analysis, Designs and Optimizations
DEFF Research Database (Denmark)
Jiang, Chenhui; Johansen, Tom Keinicke; Jónasson, Sævar Þór
2011-01-01
This paper presents a novel microwave readout scheme for measuring deflection of cantilevers in nanometer range. The cantilever deflection can be sensed by the variation of transmission levels or resonant frequencies of microwave signals. The sensitivity of the cantilever biosensor based on LC...
Microwave Imaging for Breast Cancer Detection
DEFF Research Database (Denmark)
Rubæk, Tonny; Fhager, Andreas; Jensen, Peter Damsgaard
2011-01-01
Still more research groups are promoting microwave imaging as a viable supplement or substitution to more conventional imaging modalities. A widespread approach for microwave imaging of the breast is tomographic imaging in which one seeks to reconstruct the distributions of permittivity and condu......Still more research groups are promoting microwave imaging as a viable supplement or substitution to more conventional imaging modalities. A widespread approach for microwave imaging of the breast is tomographic imaging in which one seeks to reconstruct the distributions of permittivity...... and conductivity in the breast. In this paper two nonlinear tomographic algorithms are compared – one is a single-frequency algorithm and the other is a time-domain algorithm....
Microwave dynamics of YBCO bi-epitaxial Josephson structures
DEFF Research Database (Denmark)
Constantinian, K. Y.; Ovsyannikov, G. A.; Mashtakov, A. D.
1996-01-01
The processes of interaction of microwaves (frequency View the MathML source) with a single high-Tc superconducting YBa2Cu3Ox (YBCO) bi-epitaxial grain-boundary junction and with an array of two junctions connected in series, have been investigated experimentally at temperatures T = 4.2− 77 K......, as well as the subharmonic detector response at weak magnetic fields φ microwave field induced frequency synchronization of two series connected bi-epitaxial YBCO junctions....
Carbon Fiber TOW Angle Determination Using Microwave Reflectometry
Wilson, William C.; Moore, Jason P.; Juarez, Peter D.
2016-01-01
NASA's Advanced Composites Project is investigating technologies that increase automated remote inspection of aircraft composite structures. Therefore, microwave Frequency Domain Reflectometry (FDR) is being investigated as a method of enabling rapid remote inspection of angular orientation of the tow using microwave radiation. This work will present preliminary data demonstrating that frequency shifts in the reflection spectrum of a carbon fiber tow sample are indicative of the angle of the tow with respect to an interrogating antenna's linear polarized output.
Fallahpour, M.; Case, J. T.; Kharkovsky, S.; Zoughi, R.
2010-01-01
Microwave imaging techniques, an integral component of nondestructive testing and evaluation (NDTE), have received significant attention in the past decade. These techniques have included the implementation of synthetic aperture focusing (SAF) algorithms for obtaining high spatial resolution images. The next important step in these developments is the implementation of 3-D holographic imaging algorithms. These are well-known wideband imaging technique requiring a swept-frequency (i.e., wideband), which unlike SAF that is a single frequency technique, are not easily performed on a real-time basis. This is due to the fact that a significant number of data points (in the frequency domain) must be obtained within the frequency band of interest. This not only makes for a complex imaging system design, it also significantly increases the image-production time. Consequently in an attempt to reduce the measurement time and system complexity, an investigation was conducted to determine the minimum required number of frequency samples needed to image a specific object while preserving a desired maximum measurement range and range resolution. To this end the 3-D holographic algorithm was modified to use properlyinterpolated frequency data. Measurements of the complex reflection coefficient for several samples were conducted using a swept-frequency approach. Subsequently, holographical images were generated using data containing a relatively large number of frequency samples and were compared with images generated by the reduced data set data. Quantitative metrics such as average, contrast, and signal-to-noise ratio were used to evaluate the quality of images generated using reduced data sets. Furthermore, this approach was applied to both weakly- and strongly-scattering indications. This paper presents the methods used and the results of this investigation.
SPS ionosphere/microwave beam interactions: Arecibo experimental studies
International Nuclear Information System (INIS)
Duncan, L.M.
1980-10-01
The purpose of this program is to determine the environmental impacts associated with the operation of the proposed SPS microwave power transmission system. It is expected that thermal effects will provide the dominant force driving the nonlinear ionosphere/microwave beam interactions. Collisional damping of radio waves, producing ohmic heating of the ionospheric plasma, depends inversely on the square of the radio wave frequency. Therefore, equivalent heating and equivalent thermal forces can be generated at lower radiated power densities by using lower radio wave frequencies. This principle is fundamental to a large part of the experimental program. An understanding of the physics of the specific interactions excited by the SPS microwave beam is also an important part of the assessment program. This program is designed to determine instability thresholds, the growth rates and spatial extent of the resultant ionospheric disturbances, and the frequency and power dependences of the interactions. How these interactions are affected by variations in the natural ionospheric conditions, how different instabilities occurring simultaneously may affect each other, and how distinct microwave beams might mutually interact are studied. Status of the program is described
Sakiyan, Ozge; Sumnu, Gulum; Sahin, Serpil; Meda, Venkatesh
2007-05-01
Dielectric properties can be used to understand the behavior of food materials during microwave processing. Dielectric properties influence the level of interaction between food and high frequency electromagnetic energy. Dielectric properties are, therefore, important in the design of foods intended for microwave preparation. In this study, it was aimed to determine the variation of dielectric properties of different cake formulations during baking in microwave and infrared-microwave combination oven. In addition, the effects of formulation and temperature on dielectric properties of cake batter were examined. Dielectric constant and loss factor of cake samples were shown to be dependent on formulation, baking time, and temperature. The increase in baking time and temperature decreased dielectric constant and loss factor of all formulations. Fat content was shown to increase dielectric constant and loss factor of cakes.
Microwave conductance properties of aligned multiwall carbon nanotube textile sheets
Energy Technology Data Exchange (ETDEWEB)
Brown, Brian L. [Univ. of Texas, Dallas, TX (United States); Martinez, Patricia [Univ. of Texas, Dallas, TX (United States); Zakhidov, Anvar A. [Univ. of Texas, Dallas, TX (United States); Shaner, Eric A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lee, Mark [Univ. of Texas, Dallas, TX (United States)
2015-07-06
Understanding the conductance properties of multi-walled carbon nanotube (MWNT) textile sheets in the microwave regime is essential for their potential use in high-speed and high-frequency applications. To expand current knowledge, complex high-frequency conductance measurements from 0.01 to 50 GHz and across temperatures from 4.2 K to 300 K and magnetic fields up to 2 T were made on textile sheets of highly aligned MWNTs with strand alignment oriented both parallel and perpendicular to the microwave electric field polarization. Sheets were drawn from 329 and 520 μm high MWNT forests that resulted in different DC resistance anisotropy. For all samples, the microwave conductance can be modeled approximately by a shunt capacitance in parallel with a frequency-independent conductance, but with no inductive contribution. Finally, this is consistent with diffusive Drude conduction as the primary transport mechanism up to 50 GHz. Further, it is found that the microwave conductance is essentially independent of both temperature and magnetic field.
Electron-beam and microwave treatment of some microbial strains
International Nuclear Information System (INIS)
Martin, D.; Ferdes, O.S.; Minea, R.; Tirlea, A.; Badea, M.; Plamadeala, S.; Ferdes, M.
1998-01-01
The experimental results concerning the combined effects of microwaves and accelerated electron beams on various microbial strains such as E. coli, Salmonella sp. and Monascus purpureus are presented. A special designed microwave applicator with a 2.45 GHz frequency CW magnetron of 850 maximum output power and with associate electronics that allow to control the microwave power, the current intensity, and the exposure time was used. The electron-beam irradiation was performed at different irradiation doses and at a dose rate of 1.5 - 2.0 kGy/min by using a linac at a mean electron energy about 6 MeV, mean bean current of 10 μA, pulse period of 3.5 μs and repetition frequency 100 Hz. The experiments were carried out in 5 variants: microwave treatment; electron-beam irradiation; microwaves followed by electron beam; electrons followed by microwaves; and simultaneous application of microwaves and electron beam. The microbiocidal effect was found to be enhanced by additional use of microwave energy to electron beam irradiation. Enhancement of inactivation rate is only remarkable for the microwave treatment or simultaneous electron beam and microwave irradiation at a temperature above the critical value at which microorganisms begin to perish by heat. Simultaneous irradiation with electron beam and microwaves results in a reduction of temperature and time as well as in the decrease of the upper limit of required electron beam absorbed dose for an assumed microbiological quality parameter. The results obtained indicate the occurrence of a synergistic effect of the two physical fields on a non-thermal basis. Hence, combined microwave-electron beam treatment may be applied as an effective method to reduce microbial load
Trends of microwave dielectric materials for antenna application
International Nuclear Information System (INIS)
Sulong, T. A. T.; Osman, R. A. M.; Idris, M. S.
2016-01-01
Rapid development of a modern microwave communication system requires a high quality microwave dielectric ceramic material to be used as mobile and satellite communication. High permittivity of dielectric ceramics leads to fabrication of compact device for electronic components. Dielectric ceramics which used for microwave applications required three important parameters such as high or appropriate permittivity (ε_r), high quality factor (Q _f ≥ 5000 GH z) and good temperature coefficient of resonant frequency (τ_f). This paper review of various dielectric ceramic materials used as microwave dielectric materials and related parameters for antenna applications.
Mohammed, Priscilla N.; Piepmeier, Jeffrey R.; Johnson, Joel T.; Aksoy, Mustafa; Bringer, Alexandra
2015-01-01
The Soil Moisture Active Passive (SMAP) mission, launched in January 2015, provides global measurements of soil moisture using a microwave radiometer. SMAPs radiometer passband lies within the passive frequency allocation. However, both unauthorized in-band transmitters as well as out-of-band emissions from transmitters operating at frequencies adjacent to this allocated spectrum have been documented as sources of radio frequency interference (RFI) to the L-band radiometers on SMOS and Aquarius. The spectral environment consists of high RFI levels as well as significant occurrences of low level RFI equivalent to 0.1 to 10 K. The SMAP ground processor reports the antenna temperature both before and after RFI mitigation is applied. The difference between these quantities represents the detected RFI level. The presentation will review the SMAP RFI detection and mitigation procedure and discuss early on-orbit RFI measurements from the SMAP radiometer. Assessments of global RFI properties and source types will be provided, as well as the implications of these results for SMAP soil moisture measurements.
A reflexing electron microwave amplifier for rf particle accelerator applications
International Nuclear Information System (INIS)
Fazio, M.V.; Hoeberling, R.F.
1988-01-01
The evolution of rf-accelerator technology toward high-power, high-current, low-emittance beams produces an ever-increasing demand for efficient, very high power microwave power sources. The present klystron technology has performed very well but is not expected to produce reliable gigawatt peak-power units in the 1- to 10-GHz regime. Further major advancements must involve other types of sources. The reflexing-electron class of sources can produce microwave powers at the gigawatt level and has demonstrated operation from 800-MHz to 40-GHz. The pulse length appears to be limited by diode closure, and reflexing-electron devices have been operated in a repetitively pulsed mode. A design is presented for a reflexing electron microwave amplifier that is frequency and phase locked. In this design, the generated microwave power can be efficiently coupled to one or several accelerator loads. Frequency and phase-locking capability may permit parallel-source operation for higher power. The low-frequency (500-MHz to 10-GHz) operation at very high power required by present and proposed microwave particle accelerators makes an amplifier, based on reflexing electron phenomena, a candidate for the development of new accelerator power sources. (author)
Investigation of a metallic photonic crystal high power microwave mode converter
Directory of Open Access Journals (Sweden)
Dong Wang
2015-02-01
Full Text Available It is demonstrated that an L band metallic photonic crystal TEM-TE11 mode converter is suitable for narrow band high power microwave application. The proposed mode converter is realized by partially filling metallic photonic crystals along azimuthal direction in a coaxial transmission line for phase-shifting. A three rows structure is designed and simulated by commercial software CST Microwave Studio. Simulation results show that its conversion efficiency is 99% at the center frequency 1.58 GHz. Over the frequency range of 1.56-1.625 GHz, the conversion efficiency exceeds 90 %, with a corresponding bandwidth of 4.1 %. This mode converter has a gigawatt level power handling capability which is suitable for narrow band high power microwave application. Using magnetically insulated transmission line oscillator(MILO as a high power microwave source, particle-in-cell simulation is carried out to test the performance of the mode converter. The expected TE11 mode microwave output is obtained and the MILO works well. Mode conversion performance of the converter is tested by far-field measurement method. And the experimental result confirms the validity of our design. Then, high power microwave experiment is carried out on a Marx-driven Blumlein water line pulsed power accelerator. Microwave frequency, radiated pattern and power are measured in the far-field region and the results agree well with simulation results. The experiment also reveals that no microwave breakdown or pulse shortening took place in the experimental setup.
High-Power Microwave Transmission and Mode Conversion Program
Energy Technology Data Exchange (ETDEWEB)
Vernon, Ronald J. [Univ. of Wisconsin, Madison, WI (United States)
2015-08-14
This is a final technical report for a long term project to develop improved designs and design tools for the microwave hardware and components associated with the DOE Plasma Fusion Program. We have developed basic theory, software, fabrication techniques, and low-power measurement techniques for the design of microwave hardware associated gyrotrons, microwave mode converters and high-power microwave transmission lines. Specifically, in this report we discuss our work on designing quasi-optical mode converters for single and multiple frequencies, a new method for the analysis of perturbed-wall waveguide mode converters, perturbed-wall launcher design for TE0n mode gyrotrons, quasi-optical traveling-wave resonator design for high-power testing of microwave components, and possible improvements to the HSX microwave transmission line.
International Nuclear Information System (INIS)
Leung, K.N.; Walther, S.; Owren, H.W.
1985-05-01
A small microwave ion source has been fabricated from a quartz tube with one end enclosed by a two grid accelerator. The source is also enclosed by a cavity operated at a frequency of 2.45 GHz. Microwave power as high as 500 W can be coupled to the source plasma. The source has been operated with and without multicusp fields for different gases. In the case of hydrogen, ion current density of 200 mA/cm -2 with atomic ion species concentration as high as 80% has been extracted from the source
Xu, Ou; Zhang, Jiejun; Yao, Jianping
2016-11-01
High speed and high resolution interrogation of a fiber Bragg grating (FBG) sensor based on microwave photonic filtering and chirped microwave pulse compression is proposed and experimentally demonstrated. In the proposed sensor, a broadband linearly chirped microwave waveform (LCMW) is applied to a single-passband microwave photonic filter (MPF) which is implemented based on phase modulation and phase modulation to intensity modulation conversion using a phase modulator (PM) and a phase-shifted FBG (PS-FBG). Since the center frequency of the MPF is a function of the central wavelength of the PS-FBG, when the PS-FBG experiences a strain or temperature change, the wavelength is shifted, which leads to the change in the center frequency of the MPF. At the output of the MPF, a filtered chirped waveform with the center frequency corresponding to the applied strain or temperature is obtained. By compressing the filtered LCMW in a digital signal processor, the resolution is improved. The proposed interrogation technique is experimentally demonstrated. The experimental results show that interrogation sensitivity and resolution as high as 1.25 ns/με and 0.8 με are achieved.
Energy Technology Data Exchange (ETDEWEB)
François, B.; Boudot, R. [FEMTO-ST, CNRS, Université de Franche-Comté, 26 chemin de l' Epitaphe, 25030 Besançon (France); Calosso, C. E. [INRIM, Strada delle Cacce 91, 10135 Torino (Italy); Danet, J. M. [LNE-SYRTE, Observatoire de Paris, CNRS-UPMC, 61 avenue de l' Observatoire, 75014 Paris (France)
2014-09-15
We report the development, absolute phase noise, and residual phase noise characterization of a 9.192 GHz microwave frequency synthesis chain devoted to be used as a local oscillator in a high-performance cesium vapor cell atomic clock based on coherent population trapping (CPT). It is based on frequency multiplication of an ultra-low phase noise 100 MHz oven-controlled quartz crystal oscillator using a nonlinear transmission line-based chain. Absolute phase noise performances of the 9.192 GHz output signal are measured to be −42, −100, −117 dB rad{sup 2}/Hz and −129 dB rad{sup 2}/Hz at 1 Hz, 100 Hz, 1 kHz, and 10 kHz offset frequencies, respectively. Compared to current results obtained in a state-of-the-art CPT-based frequency standard developed at LNE-SYRTE, this represents an improvement of 8 dB and 10 dB at f = 166 Hz and f = 10 kHz, respectively. With such performances, the expected Dick effect contribution to the atomic clock short term frequency stability is reported at a level of 6.2 × 10{sup −14} at 1 s integration time, that is a factor 3 higher than the atomic clock shot noise limit. Main limitations are pointed out.
The frequency spectrum crisis - Issues and answers
Armes, G. L.
The frequency spectrum represents a unique resource which can be overtaxed. In the present investigation, it is attempted to evalute the demand for satellite and microwave services. Dimensions of increased demand are discussed, taking into account developments related to the introduction of the personal computer, the activities of the computer and communications industries in preparation for the office of the future, and electronic publishing. Attention is given to common carrier spectrum congestion, common carrier microwave, satellite communications, teleports, international implications, satellite frequency bands, satellite spectrum implications, alternatives regarding the utilization of microwave frequency bands, U.S. Government spectrum utilization, and the impact at C-band.
RF and microwave engineering fundamentals of wireless communications
Gustrau, Frank
2012-01-01
This book provides a fundamental and practical introduction to radio frequency and microwave engineering and physical aspects of wireless communication In this book, the author addresses a wide range of radio-frequency and microwave topics with emphasis on physical aspects including EM and voltage waves, transmission lines, passive circuits, antennas, radio wave propagation. Up-to-date RF design tools like RF circuit simulation, EM simulation and computerized smith charts, are used in various examples to demonstrate how these methods can be applied effectively in RF engineering
Entanglement transfer from microwaves to diamond NV centers
Gomez, Angela V.; Rodriguez, Ferney J.; Quiroga, Luis
2014-03-01
Strong candidates to create quantum entangled states in solid-state environments are the nitrogen-vacancy (NV) defect centers in diamond. By the combination of radiation from different wavelength (optical, microwave and radio-frequency), several protocols have been proposed to create entangled states of different NVs. Recently, experimental sources of non-classical microwave radiation have been successfully realized. Here, we consider the entanglement transfer from spatially separated two-mode microwave squeezed (entangled) photons to a pair of NV centers by exploiting the fact that the spin triplet ground state of a NV has a natural splitting with a frequency on the order of GHz (microwave range). We first demonstrate that the transfer process in the simplest case of a single pair of spatially separated NVs is feasible. Moreover, we proceed to extend the previous results to more realistic scenarios where 13C nuclear spin baths surrounding each NV are included, quantifying the degradation of the entanglement transfer by the dephasing/dissipation effects produced by the nuclear baths. Finally, we address the issue of assessing the possibility of entanglement transfer from the squeezed microwave light to two nuclear spins closely linked to different NV center electrons. Facultad de Ciencias Uniandes.
Directory of Open Access Journals (Sweden)
K. Kashimura
2016-06-01
Full Text Available The temperature dependence of the microwave absorption behavior of BaTiO3 particles was investigated over various frequencies and temperatures of 25-1000 ∘C. First, using both the coaxial transmission line method and the cavity perturbation method by a network analyzer, the real and imaginary parts of the relative permittivity of BaTiO3 ( ε r ′ and ε r ″ , respectively were measured, in order to improve the reliability of the data obtained at 2.45 GHz. The imaginary parts of the relative permittivity as measured by the two methods were explored by their heating behaviors. Furthermore, the temperature dependence of the microwave absorption behavior of BaTiO3 particles was investigated for frequencies of 2.0-13.5 GHz and temperatures of 25-1000 ∘C using the coaxial transmission line method.
Gigahertz flexible graphene transistors for microwave integrated circuits.
Yeh, Chao-Hui; Lain, Yi-Wei; Chiu, Yu-Chiao; Liao, Chen-Hung; Moyano, David Ricardo; Hsu, Shawn S H; Chiu, Po-Wen
2014-08-26
Flexible integrated circuits with complex functionalities are the missing link for the active development of wearable electronic devices. Here, we report a scalable approach to fabricate self-aligned graphene microwave transistors for the implementation of flexible low-noise amplifiers and frequency mixers, two fundamental building blocks of a wireless communication receiver. A devised AlOx T-gate structure is used to achieve an appreciable increase of device transconductance and a commensurate reduction of the associated parasitic resistance, thus yielding a remarkable extrinsic cutoff frequency of 32 GHz and a maximum oscillation frequency of 20 GHz; in both cases the operation frequency is an order of magnitude higher than previously reported. The two frequencies work at 22 and 13 GHz even when subjected to a strain of 2.5%. The gigahertz microwave integrated circuits demonstrated here pave the way for applications which require high flexibility and radio frequency operations.
Trends of microwave dielectric materials for antenna application
Energy Technology Data Exchange (ETDEWEB)
Sulong, T. A. T., E-mail: tuanamirahtuansulong@gmail.com; Osman, R. A. M., E-mail: rozana@unimap.edu.my [School of Microelectronic Engineering, Universiti Malaysia Perlis, Pauh Putra Campus, 02600 Arau, Perlis (Malaysia); Idris, M. S., E-mail: sobri@unimap.edu.my [Sustainable Engineering Research Cluster, School of Material Engineering, Universiti Malaysia Perlis, Blok B, Taman Pertiwi Indah, Seriab, 01000 Kangar, Perlis (Malaysia)
2016-07-19
Rapid development of a modern microwave communication system requires a high quality microwave dielectric ceramic material to be used as mobile and satellite communication. High permittivity of dielectric ceramics leads to fabrication of compact device for electronic components. Dielectric ceramics which used for microwave applications required three important parameters such as high or appropriate permittivity (ε{sub r}), high quality factor (Q {sub f} ≥ 5000 GH z) and good temperature coefficient of resonant frequency (τ{sub f}). This paper review of various dielectric ceramic materials used as microwave dielectric materials and related parameters for antenna applications.
The numerical simulation of plasma flow in cylindrical resonant cavity of microwave plasma thruster
International Nuclear Information System (INIS)
Tang, J.-L.; He, H.-Q; Mao, G.-W.
2004-01-01
Microwave Plasma Thruster (MPT) is an electro-thermal propulsive device. MPT consists of microwave generator, gas storing and supplying system, resonant cavity and accelerative nozzle. It generates free-floating plasma brought by the microwave discharge breakdown gas in the resonant cavity, and the plasma exhausted from nozzle produces thrust. MPT has prospective application in spacecraft because of its advantages of high thrust, moderate specific impulse and high efficiency. In this paper, the numerical simulation of the coupling flow field of microwave plasma in resonant cavity under different frequencies will be discussed. The results of numerical simulation are as follows: 1) When the resonant model TM 011 was used, the higher the microwave frequency was, the smaller the size of MPT. The distribution of the electromagnetic field in small cavity, however, remain unchanged. 2) When the resonant model was used, the distribution of the temperature, the pressure and the electronic density in the resonant cavity remained unchanged under different resonant frequencies. 3) When the resonant frequency was increased with a fixed pressure distribution in a small cavity, compare to the MPT with lower frequency, the gas flow rate, the microwave power and the nozzle throat diameter of MPT all decreased. 4) The electromagnetic field in the cylindrical resonant cavity for all MPT with different frequencies was disturbed by the plasma formation. The strong disturbance happened in the region close to the plasma. (author)
CAMAC system for computer control of microwave spectrometers
International Nuclear Information System (INIS)
Zizka, G.; Turko, B.; Kolbe, B.
1979-01-01
An interface between a microwave spectrometer and a computer is described. It consists of three CAMAC modules and uses a standard CAMAC crate and controller. The hardware, in conjunction with appropriate software routines was designed to synchronize measurements, to collect data, and to control the microwave frequency and other experimental parameters
Microwave integrated circuits for space applications
Leonard, Regis F.; Romanofsky, Robert R.
1991-01-01
Monolithic microwave integrated circuits (MMIC), which incorporate all the elements of a microwave circuit on a single semiconductor substrate, offer the potential for drastic reductions in circuit weight and volume and increased reliability, all of which make many new concepts in electronic circuitry for space applications feasible, including phased array antennas. NASA has undertaken an extensive program aimed at development of MMICs for space applications. The first such circuits targeted for development were an extension of work in hybrid (discrete component) technology in support of the Advanced Communication Technology Satellite (ACTS). It focused on power amplifiers, receivers, and switches at ACTS frequencies. More recent work, however, focused on frequencies appropriate for other NASA programs and emphasizes advanced materials in an effort to enhance efficiency, power handling capability, and frequency of operation or noise figure to meet the requirements of space systems.
Remote transfer of ultrastable frequency references via fiber networks
International Nuclear Information System (INIS)
Foreman, Seth M.; Holman, Kevin W.; Hudson, Darren D.; Jones, David J.; Ye, Jun
2007-01-01
Three distinct techniques exist for distributing an ultrastable frequency reference over optical fibers. For the distribution of a microwave frequency reference, an amplitude-modulated continuous wave (cw) laser can be used. Over kilometer-scale lengths this approach provides an instability at 1 s of ∼3x10 -14 without stabilization of the fiber-induced noise and ∼1x10 -14 with active noise cancellation. An optical frequency reference can be transferred by directly transmitting a stabilized cw laser over fiber and then disseminated to other optical and microwave regions using an optical frequency comb. This provides an instability at 1 s of 2x10 -14 without active noise cancellation and 3x10 -15 with active noise cancellation [Recent results reduce the instability at 1 s to 6x10 -18 .] Finally, microwave and optical frequency references can be simultaneously transmitted using an optical frequency comb, and we expect the optical transfer to be similar in performance to the cw optical frequency transfer. The instability at 1 s for transfer of a microwave frequency reference with the comb is ∼3x10 -14 without active noise cancellation and -15 with active stabilization. The comb can also distribute a microwave frequency reference with root-mean-square timing jitter below 16 fs integrated over the Nyquist bandwidth of the pulse train (∼50 MHz) when high-bandwidth active noise cancellation is employed, which is important for remote synchronization applications
Soil moisture and temperature profile effects on microwave emission at low frequencies
International Nuclear Information System (INIS)
Raju, S.; Chanzy, A.; Wigneron, J.P.; Calvet, J.C.; Kerr, Y.; Laguerre, L.
1995-01-01
Soil moisture and temperature vertical profiles vary quickly during the day and may have a significant influence on the soil microwave emission. The objective of this work is to quantify such an influence and the consequences in soil moisture estimation from microwave radiometric information. The analysis is based on experimental data collected by the ground-based PORTOS radiometer at 1.4, 5.05, and 10.65 GHz and data simulated by a coherent model of microwave emission from layered media [Wilheit model (1978)]. In order to simulate diurnal variations of the brightness temperature (TB), the Wilheit model is coupled to a mechanistic model of heat and water flows in the soil. The Wilheit model is validated on experimental data and its performances for estimating TB are compared to those of a simpler approach based on a description of the soil media as a single layer (Fresnel model). When the depth of this single layer (hereafter referred to as the sampling depth) is determined to fit the experimental data, similar accuracy in TB estimation is found with both the Wilheit and Fresnel models. The soil microwave emission is found to be strongly affected by the diurnal variations of soil moisture and temperature profiles. Consequently, the TB sensitivity to soil moisture and temperature profiles has an influence on the estimation, from microwave observations, of the surface soil moisture in a surface layer with a fixed depth (05): the accuracy of θs retrievals and the optimal sampling depth depends both on the variation in soil moisture and temperature profile shape. (author)
The Python Sky Model: software for simulating the Galactic microwave sky
Thorne, B.; Dunkley, J.; Alonso, D.; Næss, S.
2017-08-01
We present a numerical code to simulate maps of Galactic emission in intensity and polarization at microwave frequencies, aiding in the design of cosmic microwave background experiments. This python code builds on existing efforts to simulate the sky by providing an easy-to-use interface and is based on publicly available data from the WMAP (Wilkinson Microwave Anisotropy Probe) and Planck satellite missions. We simulate synchrotron, thermal dust, free-free and anomalous microwave emission over the whole sky, in addition to the cosmic microwave background, and include a set of alternative prescriptions for the frequency dependence of each component, for example, polarized dust with multiple temperatures and a decorrelation of the signals with frequency, which introduce complexity that is consistent with current data. We also present a new prescription for adding small-scale realizations of these components at resolutions greater than current all-sky measurements. The usefulness of the code is demonstrated by forecasting the impact of varying foreground complexity on the recovered tensor-to-scalar ratio for the LiteBIRD satellite. The code is available at: https://github.com/bthorne93/PySM_public.
Passive microwave remote sensing of soil moisture
International Nuclear Information System (INIS)
Jackson, T.J.; Schmugge, T.J.
1986-01-01
Microwave remote sensing provides a unique capability for direct observation of soil moisture. Remote measurements from space afford the possibility of obtaining frequent, global sampling of soil moisture over a large fraction of the Earth's land surface. Microwave measurements have the benefit of being largely unaffected by cloud cover and variable surface solar illumination, but accurate soil moisture estimates are limited to regions that have either bare soil or low to moderate amounts of vegetation cover. A particular advantage of passive microwave sensors is that in the absence of significant vegetation cover soil moisture is the dominant effect on the received signal. The spatial resolutions of passive microwave soil moisture sensors currently considered for space operation are in the range 10–20 km. The most useful frequency range for soil moisture sensing is 1–5 GHz. System design considerations include optimum choice of frequencies, polarizations, and scanning configurations, based on trade-offs between requirements for high vegetation penetration capability, freedom from electromagnetic interference, manageable antenna size and complexity, and the requirement that a sufficient number of information channels be available to correct for perturbing geophysical effects. This paper outlines the basic principles of the passive microwave technique for soil moisture sensing, and reviews briefly the status of current retrieval methods. Particularly promising are methods for optimally assimilating passive microwave data into hydrologic models. Further studies are needed to investigate the effects on microwave observations of within-footprint spatial heterogeneity of vegetation cover and subsurface soil characteristics, and to assess the limitations imposed by heterogeneity on the retrievability of large-scale soil moisture information from remote observations
Dielectric Behavior of Low Microwave Loss Unit Cell for All Dielectric Metamaterial
Directory of Open Access Journals (Sweden)
Tianhuan Luo
2015-01-01
Full Text Available With a deep study of the metamaterial, its unit cells have been widely extended from metals to dielectrics. The dielectric based unit cells attract much attention because of the advantage of easy preparation, tunability, and higher frequency response, and so forth. Using the conventional solid state method, we prepared a kind of incipient ferroelectrics (calcium titanate, CaTiO3 with higher microwave permittivity and lower loss, which can be successfully used to construct metamaterials. The temperature and frequency dependence of dielectric constant are also measured under different sintering temperatures. The dielectric spectra showed a slight permittivity decrease with the increase of temperature and exhibited a loss of 0.0005, combined with a higher microwave dielectric constant of ~167 and quality factor Q of 2049. Therefore, CaTiO3 is a kind of versatile and potential metamaterial unit cell. The permittivity of CaTiO3 at higher microwave frequency was also examined in the rectangular waveguide and we got the permittivity of 165, creating a new method to test permittivity at higher microwave frequency.
Sorokin, B P; Kvashnin, G M; Novoselov, A S; Bormashov, V S; Golovanov, A V; Burkov, S I; Blank, V D
2017-07-01
First ultrahigh frequency (UHF) investigation of quality factor Q for the piezoelectric layered structure «Al/(001)AlN/Mo/(100) diamond» has been executed in a broad frequency band from 1 up to 20GHz. The record-breaking Q·f quality parameter up to 2.7·10 14 Hz has been obtained close to 20GHz. Frequency dependence of the form factor m correlated with quality factor has been analyzed by means of computer simulation, and non-monotonic frequency dependence can be explained by proper features of thin-film piezoelectric transducer (TFPT). Excluding the minimal Q magnitudes measured at the frequency points associated with minimal TFPT effectiveness, one can prove a rule of Qf∼f observed for diamond on the frequencies above 1GHz and defined by Landau-Rumer's acoustic attenuation mechanism. Synthetic IIa-type diamond single crystal as a substrate material for High-overtone Bulk Acoustic Resonator (HBAR) possesses some excellent acoustic properties in a wide microwave band and can be successfully applied for design of acoustoelectronic devices, especially the ones operating at a far UHF band. Copyright © 2017 Elsevier B.V. All rights reserved.
Steber, Amanda; Pate, Brooks
2014-06-01
Advances in chip-level microwave technology in the communications field have led to the possibilities of low cost alternatives for current Fourier transform microwave (FTMW) spectrometers. Many of the large, expensive microwave components in a traditional design can now be replaced by robust, mass market monolithic microwave integrated circuits (MMICs). "Spectrometer on a board" designs are now feasible that offer dramatic cost reduction for microwave spectroscopy. These chip-level components can be paired with miniature computers to produce compact instruments that are operable through USB. A FTMW spectrometer design using the key MMIC components that drive cost reduction will be presented. Two dual channel synthesizers (Valon Technology Model 5008), a digital pattern generator (Byte Paradigm Wav Gen Xpress), and a high-speed digitizer/arbitrary waveform generator combination unit (Tie Pie HS-5 530 XM) form the key components of the spectrometer for operation in the 18-26.5 GHz range. The design performance is illustrated using a spectrometer that is being incorporated into a museum display for astrochemistry. For this instrument a user interface, developed in Python, has been developed and will be shown.
Direct-reading type microwave interferometer
International Nuclear Information System (INIS)
Matsuura, Kiyokata; Fujita, Junji; Ogata, Atsushi; Haba, Kiichiro.
1977-10-01
A new microwave interferometer has been developed and applied to the electron density measurement on JIPP T-II plasma device. The interferometer generates an output voltage proportional to the number of fringe shifts and also output pulses which indicate the change of electron density for the convenience of data processing, where the resolution is a quarter of fringe shift. The principle is based on the digitization of fringe shifts utilizing the phase detection of microwave signals with two-level modulation of source frequency. With this system and 70 GHz microwave source, a change of electron density as rapid as about 2 x 10 13 cm -3 in 1 ms has been measured at the tokamak operation of JIPP T-II. (auth.)
Application of high power microwave vacuum electron devices
International Nuclear Information System (INIS)
Ding Yaogen; Liu Pukun; Zhang Zhaochuan; Wang Yong; Shen Bin
2011-01-01
High power microwave vacuum electron devices can work at high frequency, high peak and average power. They have been widely used in military and civil microwave electron systems, such as radar, communication,countermeasure, TV broadcast, particle accelerators, plasma heating devices of fusion, microwave sensing and microwave heating. In scientific research, high power microwave vacuum electron devices are used mainly on high energy particle accelerator and fusion research. The devices include high peak power klystron, CW and long pulse high power klystron, multi-beam klystron,and high power gyrotron. In national economy, high power microwave vacuum electron devices are used mainly on weather and navigation radar, medical and radiation accelerator, TV broadcast and communication system. The devices include high power pulse and CW klystron, extended interaction klystron, traveling wave tube (TWT), magnetron and induced output tube (IOT). The state of art, common technology problems and trends of high power microwave vacuum electron devices are introduced in this paper. (authors)
Tunable Magnetic Resonance in Microwave Spintronics Devices
Chen, Yunpeng; Fan, Xin; Xie, Yunsong; Zhou, Yang; Wang, Tao; Wilson, Jeffrey D.; Simons, Rainee N.; Chui, Sui-Tat; Xiao, John Q.
2015-01-01
Magnetic resonance is one of the key properties of magnetic materials for the application of microwave spintronics devices. The conventional method for tuning magnetic resonance is to use an electromagnet, which provides very limited tuning range. Hence, the quest for enhancing the magnetic resonance tuning range without using an electromagnet has attracted tremendous attention. In this paper, we exploit the huge exchange coupling field between magnetic interlayers, which is on the order of 4000 Oe and also the high frequency modes of coupled oscillators to enhance the tuning range. Furthermore, we demonstrate a new scheme to control the magnetic resonance frequency. Moreover, we report a shift in the magnetic resonance frequency as high as 20 GHz in CoFe based tunable microwave spintronics devices, which is 10X higher than conventional methods.
International Nuclear Information System (INIS)
Kuo, S.P.; Ren, A.
1993-01-01
The main concern of the propagation of high power microwave pulse is the energy loss of the pulse before reaching the destination. The loss is caused by self-generated plasma. There are two processes which are responsible for the energy loss (so called tail erosion). They are collisional damping and cutoff reflection. In very high power region, the cutoff reflection is much more severe than the collisional damping. A frequency up-conversion process may help to avoid the cutoff reflection of powerful electromagnetic pulse propagating in a self-generated plasma. Both chamber experiments and numerical simulation are performed. When the field amplitude only slightly exceeds the breakdown threshold field of the background gas, the result shows that the carrier frequency ω of the pulse shifts upward during the growth of local plasma frequency ωpe 2 . Thus, the self-generated plasma remains underdense to the pulse. However, the spectrum of the pulse starts to break up into two major peaks when the amplitude of the pulse is further increased. The frequency of one of the peaks is lower than the original carrier frequency and that of the other peak is higher than the original carrier frequency. These phenomena are observed both experimentally and numerically. The frequency down shift result is believed to be caused by damping mechanisms. Good agreement between the experimental results and the numerical simulation is obtained
Operational features and microwave characteristics of the Vircator II experiment
International Nuclear Information System (INIS)
Price, D.; Fittinghoff, O.; Benford, J.; Sze, H.; Woo, W.
1988-01-01
The Vircator II oscillating virtual-cathode microwave source operates with diode voltages between 600 and 800 kV and diode current between 50 and 120 kA. Maximal microwave output power between 200 and 500 MW is achieved when the diode aspect ratio, cathode surface, charge voltage, and extraction coupling are arranged to simultaneously 1) maximize diode voltage, 2) satisfy magnetic insulation criteria, 3) avoid nonuniform or unstable electron emission, and 4) optimize microwave transmission from the virtual cathode to the launching antenna. Broad-band radiation between 0.4 and 5.5 GHz is generated. The central frequency follows the beam plasma frequency. It is tuned by varying the current density with anode-cathode (A-K) gap adjustments
Fandiño, Javier S; Muñoz, Pascual
2013-11-01
A photonic system capable of estimating the unknown frequency of a CW microwave tone is presented. The core of the system is a complementary optical filter monolithically integrated in InP, consisting of a ring-assisted Mach-Zehnder interferometer with a second-order elliptic response. By simultaneously measuring the different optical powers produced by a double-sideband suppressed-carrier modulation at the outputs of the photonic integrated circuit, an amplitude comparison function that depends on the input tone frequency is obtained. Using this technique, a frequency measurement range of 10 GHz (5-15 GHz) with a root mean square value of frequency error lower than 200 MHz is experimentally demonstrated. Moreover, simulations showing the impact of a residual optical carrier on system performance are also provided.
K-Band Radio frequency Interference Survey of Southeastern Michigan
DEFF Research Database (Denmark)
Curry, Shannon; Ahlers, Michael Faursby; Elliot, Harvey
2010-01-01
The Radio frequency Interference Survey of Earth (RISE) is a new type of instrument used to survey and characterize the presence of Radio Frequency Interference (RFI) that can affect microwave radiometers. It consists of a combined microwave radiometer and kurtosis spectrometer with broad frequen...
A Novel Frequency Measurement Method Suitable for a Large Frequency Ratio Condition
Institute of Scientific and Technical Information of China (English)
ZHOU Wei; XUAN Zong-Qiang; YU Jian-Guo; WANG Hai; ZHOU Hui; LI Zhi-Qi
2004-01-01
@@ As for the obstacles to direct comparison between superhigh and lower frequencies, we accomplish the accurate comparison between low and microwave frequencies with the 105 ratios of the operating frequencies on the basis of phase comparison between the signals whose frequencies are related by an arbitrary integer. This method is simple and accurate, and will be widely used as a special frequency comparison approach.
Radio-frequency integrated-circuit engineering
Nguyen, Cam
2015-01-01
Radio-Frequency Integrated-Circuit Engineering addresses the theory, analysis and design of passive and active RFIC's using Si-based CMOS and Bi-CMOS technologies, and other non-silicon based technologies. The materials covered are self-contained and presented in such detail that allows readers with only undergraduate electrical engineering knowledge in EM, RF, and circuits to understand and design RFICs. Organized into sixteen chapters, blending analog and microwave engineering, Radio-Frequency Integrated-Circuit Engineering emphasizes the microwave engineering approach for RFICs. Provide
Reduction of Electromagnetic Interference Using ZnO-PCL Nanocomposites at Microwave Frequency
Directory of Open Access Journals (Sweden)
Abubakar Yakubu
2015-01-01
Full Text Available In industrial equipment and home appliance applications, the electromagnetic compatibility compliance directive (ECCD demands that electromagnetic interference side effects be eliminated or marginally minimized. The equipment must not disturb radio and telecommunication as well as other appliances. Additionally the ECCD also governs the immunity of such equipment to interference and seeks to ensure that this equipment is not disturbed by radio emissions when used as intended. Many types of absorbing materials are commercially available. However, many are expensive and not environmentally friendly. It is in the light of the above that we studied the electromagnetic absorption properties of ZnO-PCL nanocomposites prepared from cheap and abundant resources which are environmentally friendly (zinc and polycaprolactone. The test was carried out using a microstrip, open ended coaxial probe, and vector network analyzer. Amongst other findings, result showed that the ZnO-PCL nanocomposite has the capability of attenuating microwave frequency up to −18.2 dB due to their very high specific surface areas attributed to the nanofillers at 12 GHz.
Magnetic and microwave absorption properties of La-Nd-Fe alloys
Energy Technology Data Exchange (ETDEWEB)
Qiao, Ziqiang [School of Material Science and Engineering & Guangxi Key Laboratory of Information Materials, Guilin University of Electronic Technology, Guilin 541004 (China); Pan, Shunkang, E-mail: skpan88@163.com [School of Material Science and Engineering & Guangxi Key Laboratory of Information Materials, Guilin University of Electronic Technology, Guilin 541004 (China); Xiong, Jilei [Chinalco Guangxi Non Ferrous Jinyuan Rare Earth CO., LTD, Hezhou 542603 (China); Cheng, Lichun; Yao, Qingrong [School of Material Science and Engineering & Guangxi Key Laboratory of Information Materials, Guilin University of Electronic Technology, Guilin 541004 (China); School of Materials and Engineering, Central South University, Changsha 410083 (China); Lin, Peihao [School of Material Science and Engineering & Guangxi Key Laboratory of Information Materials, Guilin University of Electronic Technology, Guilin 541004 (China)
2017-02-01
Through arc smelting and high energy ball milling method to synthesized the powders of La{sub x}Nd{sub 2-x}Fe{sub 17} (x=0.0, 0.2, 0.4, 0.6). By x-ray diffraction (XRD), scanning electron microscopy (SEM) and laser particle analyzer (LPS) to study the structural, morphology, particle size distribution of the powders, respectively. The electromagnetic parameters and saturation magnetization of the powers were measured by a vector network analyzer (VNA) and vibrating sample magnetometer (VSM), respectively. The saturation magnetization decreases with the La increasing. The minimum absorption peak frequency shifts towards a lower frequency region with an increase of La concentration. The microwave absorbing properties of the composite with different ratios of La{sub 0.2}Nd{sub 1.8}Fe{sub 17}/Ni were studied. The microwave absorbing peaks of the composite shift to higher frequencies, and the microwave absorbing properties improved with the Ni content increase to 20%. The minimum reflection loss is −32.5 dB at 9.8 GHz and the bandwidth less than −10 dB (Microwave absorption rate 90%) reaches 3 GHz with a thickness of 1.8 mm.
Microwave SQUID Multiplexer Demonstration for Cosmic Microwave Background Imagers.
Dober, B; Becker, D T; Bennett, D A; Bryan, S A; Duff, S M; Gard, J D; Hays-Wehle, J P; Hilton, G C; Hubmayr, J; Mates, J A B; Reintsema, C D; Vale, L R; Ullom, J N
2017-12-01
Key performance characteristics are demonstrated for the microwave SQUID multiplexer (µmux) coupled to transition edge sensor (TES) bolometers that have been optimized for cosmic microwave background (CMB) observations. In a 64-channel demonstration, we show that the µmux produces a white, input referred current noise level of [Formula: see text] at -77 dB microwave probe tone power, which is well below expected fundamental detector and photon noise sources for a ground-based CMB-optimized bolometer. Operated with negligible photon loading, we measure [Formula: see text] in the TES-coupled channels biased at 65% of the sensor normal resistance. This noise level is consistent with that predicted from bolometer thermal fluctuation (i.e. phonon) noise. Furthermore, the power spectral density is white over a range of frequencies down to ~ 100 mHz, which enables CMB mapping on large angular scales that constrain the physics of inflation. Additionally, we report cross-talk measurements that indicate a level below 0.3%, which is less than the level of cross-talk from multiplexed readout systems in deployed CMB imagers. These measurements demonstrate the µmux as a viable readout technique for future CMB imaging instruments.
Measurements of nonionizing radiation emitted from microwave oven
International Nuclear Information System (INIS)
Elnour, Yassir Elnour Osman
2014-05-01
There is an increase in the usage of microwave oven which is used electromagnetic radiation in the microwave range, which believed to be harmful to human health. The measurements were taken at distance of range(0-100) cm from the microwave oven. The study concluded that the risk possibility of the radiation increases at high mode. We measured the power density, magnetic field and signal strength of microwave oven using the SPECTRAN high frequency (HF-6080) detector. The experimental results of power density were found to be (3.78-208000) nW/m 2 and magnetic field is (0.001-0.744) mA/m. These values are less than the exposure limits recommended. (author)
A feasibility study on the application of microwaves for online biofilm monitoring in the pipelines
International Nuclear Information System (INIS)
Saber, Nasser; Ju, Yang; Hsu, Hung-Yao; Lee, Sang-Heon
2013-01-01
This study investigates the potential of microwave technique for online monitoring and evaluation of biofilms in the pipelines. A microwave vector network analyser and an in-house built transmitting and receiving coaxial-line transducer were employed to transmit microwave signals in the pipe. The brass pipe specimen was tested by adhering different volumes of polymeric tape layers onto its internal surface simulating the biofilm build-up. By taking the pipe as a circular waveguide of microwave, the frequency domain measurements were conducted in the 45–47 GHz range with TM 01 dominant wave mode. The permittivity of the biofilm-contained area has been expressed as a function of the resonance frequency after establishing the resonance condition in the waveguide. It was realized that the resonance frequencies experience systematic shifts with the growth of biofilm layer length and thickness. The effects of dielectric material properties and the volume of the added biofilm layer on the resonance frequency records were then explained using the cavity perturbation theory which confirmed the experimental findings. Measurement results indicated a high degree of sensitivity to the small amounts of introduced biofilm which proves the potential of the microwave technique for online biofilm monitoring in both closed-end and open-end terminal conditions. -- Highlights: • An online biofilm monitoring method in pipelines using microwaves is reported. • Time and frequency domain measurements conducted in the pipe as a waveguide. • Resonance frequencies show systematic shifts with the growth of biofilm layer. • Relationship of the biofilm volume and the resonance frequency changes is expressed. • Perturbation theory is used to explain the results
A Microwave Tunable Bandpass Filter for Liquid Crystal Applications
Cao, Weiping; Jiang, Di; Liu, Yupeng; Yang, Yuanwang; Gan, Baichuan
2017-07-01
In this paper, a novel microwave continuously tunable band-pass filter, based on nematic liquid crystals (LCs), is proposed. It uses liquid crystal (LC) as the electro-optic material to mainly realize frequency shift at microwave band by changing the dielectric anisotropy, when applying the bias voltage. According to simulation results, it achieves 840 MHz offset. Comparing to the existing tunable filter, it has many advantages, such as continuously tunable, miniaturization, low processing costs, low tuning voltage, etc. Thus, it has shown great potentials in frequency domain and practical applications in modern communication.
Microwave based method of monitoring crack formation
International Nuclear Information System (INIS)
Aman, Sergej; Aman, Alexander; Majcherek, Soeren; Hirsch, Soeren; Schmidt, Bertram
2014-01-01
The formation of cracks in glass particles was monitored by application of linearly polarized microwaves. The breakage behavior of glass spheres coated with a thin gold layer of about 50 nm, i.e. a thickness that is lower than the microwave penetration depth, was tested. In this way the investigation of fracture behavior of electronic circuits was simulated. A shielding current was induced in the gold layer by the application of microwaves. During the crack formation the distribution of this current changed abruptly and a scattered microwave signal appeared at the frequency of the incident microwaves. The time behavior of the scattered signal reflects the microscopic processes occurring during the fracture of the specimen. The duration of the increasing signal corresponds to the crack formation time in the tested specimen. This time was estimated as particle size divided by crack development speed in glass. An intense emission of electrons occurs during the formation of cracks. Due to this, coherent Thomson scattering of microwaves by emitted electrons becomes significant with a delay of a few microseconds after the initial phase of crack formation. In this time the intensity of the microwave signal increases. (paper)
One-third (period three) harmonic generation in microwave-driven Josephson tunnel junctions
DEFF Research Database (Denmark)
Hansen, Jørn Bindslev; Clarke, J.; Mygind, Jesper
1986-01-01
One-third harmonic signals have been generated in the zero voltage state of a Josephson tunnel junction driven with a microwave current in the frequency range 8–20 GHz. The signal was as much as 50 dB above the noise level of the detector with a linewidth of less than 100 Hz. The junction...... parameters and microwave current were measured in situ in separate experiments. The subharmonic generation occurred for ranges of microwave current and frequency that were in reasonable agreement with the results of digital computer simulations. Applied Physics Letters is copyrighted by The American...
On-Chip Microwave Quantum Hall Circulator
Directory of Open Access Journals (Sweden)
A. C. Mahoney
2017-01-01
Full Text Available Circulators are nonreciprocal circuit elements that are integral to technologies including radar systems, microwave communication transceivers, and the readout of quantum information devices. Their nonreciprocity arises from the interference of microwaves over the centimeter scale of the signal wavelength, in the presence of bulky magnetic media that breaks time-reversal symmetry. Here, we realize a completely passive on-chip microwave circulator with size 1/1000th the wavelength by exploiting the chiral, “slow-light” response of a two-dimensional electron gas in the quantum Hall regime. For an integrated GaAs device with 330 μm diameter and about 1-GHz center frequency, a nonreciprocity of 25 dB is observed over a 50-MHz bandwidth. Furthermore, the nonreciprocity can be dynamically tuned by varying the voltage at the port, an aspect that may enable reconfigurable passive routing of microwave signals on chip.
Multifunctional fiber-optic microwave links based on remote heterodyne detection
DEFF Research Database (Denmark)
Gliese, Ulrik Bo; Nielsen, Torben Nørskov; Nielsen, Søren Nørskov
1998-01-01
The multifunctionality of microwave links based on remote heterodyne detection (RHD) of signals from a dual-frequency laser transmitter is discussed and experimentally demonstrated in this paper. Typically, direct detection (DD) in conjunction with optical intensity modulation is used to implement...... fiber-optic microwave links. The resulting links are inherently transparent. As opposed to DD links, RHD links can perform radio-system functionalities such as modulation and frequency conversion in addition to transparency. All of these three functionalities are presented and experimentally...
A Microwave Photonic Interference Canceller: Architectures, Systems, and Integration
Chang, Matthew P.
This thesis is a comprehensive portfolio of work on a Microwave Photonic Self-Interference Canceller (MPC), a specialized optical system designed to eliminate interference from radio-frequency (RF) receivers. The novelty and value of the microwave photonic system lies in its ability to operate over bandwidths and frequencies that are orders of magnitude larger than what is possible using existing RF technology. The work begins, in 2012, with a discrete fiber-optic microwave photonic canceller, which prior work had demonstrated as a proof-of-concept, and culminates, in 2017, with the first ever monolithically integrated microwave photonic canceller. With an eye towards practical implementation, the thesis establishes novelty through three major project thrusts. (Fig. 1): (1) Extensive RF and system analysis to develop a full understanding of how, and through what mechanisms, MPCs affect an RF receiver. The first investigations of how a microwave photonic canceller performs in an actual wireless environment and a digital radio are also presented. (2) New architectures to improve the performance and functionality of MPCs, based on the analysis performed in Thrust 1. A novel balanced microwave photonic canceller architecture is developed and experimentally demonstrated. The balanced architecture shows significant improvements in link gain, noise figure, and dynamic range. Its main advantage is its ability to suppress common-mode noise and reduce noise figure by increasing the optical power. (3) Monolithic integration of the microwave photonic canceller into a photonic integrated circuit. This thrust presents the progression of integrating individual discrete devices into their semiconductor equivalent, as well as a full functional and RF analysis of the first ever integrated microwave photonic canceller.
MEMS-based transmission lines for microwave applications
Wu, Qun; Fu, Jiahui; Gu, Xuemai; Shi, Huajuan; Lee, Jongchul
2003-04-01
This paper mainly presents a briefly review for recent progress in MEMS-based transmission lines for use in microwave and millimeterwave range. MEMS-based transmission lines including different transmission line structure such as membrane-supported microstrip line microstrip line, coplanar microshield transmission line, LIGA micromachined planar transmission line, micromachined waveguides and coplanar waveguide are discussed. MEMS-based transmission lines are characterized by low propagation loss, wide operation frequency band, low dispersion and high quality factor, in addition, the fabrication is compatible with traditional processing of integrated circuits (IC"s). The emergence of MEMS-based transmission lines provided a solution for miniaturizing microwave system and monolithic microwave integrated circuits.
International Nuclear Information System (INIS)
Gupta, K.K.; Abbas, S.M.; Goswami, T.H.; Abhyankar, A.C.
2014-01-01
The present study highlights various microwave properties, i.e. reflection, transmission, absorption and reflection loss, of the coated cotton fabric [formulation: Ni–Zn ferrite (Ni 0.5 Zn 0.5 Fe 2 O 4 ) and carbon black (acetylene black) at concentrations of 30, 40, 50, 60 and70 g of ferrite and 5 g carbon in each 100 ml polyurethane] evaluated at 8–18 GHz frequency. The uniform density of filling materials in coated fabrics (dotted marks in SEM micrograph) indicates homogeneous dispersion of conducting fillers in polyurethane and the density of filling material cluster increases with increase in ferrite concentration. SEM images also show uniform coating of conducting fillers/resin system over individual fibers and interweave spaces. The important parameters governing the microwave properties of coated fabrics i.e. permittivity and permeability, S-parameters, reflection loss, etc. were studied in a HVS free space microwave measurement system. The lossy character of coated fabric is found to increase with increase of ferrite content; the ferrite content decreases the impedance and increases the permittivity and permeability values. The 1.6–1.8 mm thick coated fabric sample (40 wt% ferrite, 3 wt% carbon and 57 wt% PU) has shown about 40% absorption, 20% transmission and 40% reflectance in X (8.2–12.4 GHz) and Ku (12–18 GHz) frequency bands. The reflection loss at 13.5 GHz has shown the highest peak value (22.5 dB) due to coated sample optical thickness equal to λ/4 and more than 7.5 dB in entire Ku band. Owing to its thin and flexible nature, the coated fabric can be used as apparel in protecting human being from hazardous microwaves and also as radar camouflage covering screen in defense. - Highlights: • Ni–Zn ferrite (Ni 0.5 Zn 0.5 Fe 2 O 4 ) with acetylene black found effective coating for microwave absorption. • Coating formulation containing 40 wt% ferrite, 3 wt% carbon and 57 wt% PU offered 40% absorption, 20% transmission and 40% reflection
Energy Technology Data Exchange (ETDEWEB)
Gupta, K.K., E-mail: krishna62@rediffmail.com [Defence Materials and Stores Research and Development Establishment, Kanpur PO, GT Road, Kanpur 208013 (India); Abbas, S.M.; Goswami, T.H. [Defence Materials and Stores Research and Development Establishment, Kanpur PO, GT Road, Kanpur 208013 (India); Abhyankar, A.C. [Defence Institute of Advanced Technology( DIAT), Giri Nagar, Pune 411025 (India)
2014-08-01
The present study highlights various microwave properties, i.e. reflection, transmission, absorption and reflection loss, of the coated cotton fabric [formulation: Ni–Zn ferrite (Ni {sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4}) and carbon black (acetylene black) at concentrations of 30, 40, 50, 60 and70 g of ferrite and 5 g carbon in each 100 ml polyurethane] evaluated at 8–18 GHz frequency. The uniform density of filling materials in coated fabrics (dotted marks in SEM micrograph) indicates homogeneous dispersion of conducting fillers in polyurethane and the density of filling material cluster increases with increase in ferrite concentration. SEM images also show uniform coating of conducting fillers/resin system over individual fibers and interweave spaces. The important parameters governing the microwave properties of coated fabrics i.e. permittivity and permeability, S-parameters, reflection loss, etc. were studied in a HVS free space microwave measurement system. The lossy character of coated fabric is found to increase with increase of ferrite content; the ferrite content decreases the impedance and increases the permittivity and permeability values. The 1.6–1.8 mm thick coated fabric sample (40 wt% ferrite, 3 wt% carbon and 57 wt% PU) has shown about 40% absorption, 20% transmission and 40% reflectance in X (8.2–12.4 GHz) and Ku (12–18 GHz) frequency bands. The reflection loss at 13.5 GHz has shown the highest peak value (22.5 dB) due to coated sample optical thickness equal to λ/4 and more than 7.5 dB in entire Ku band. Owing to its thin and flexible nature, the coated fabric can be used as apparel in protecting human being from hazardous microwaves and also as radar camouflage covering screen in defense. - Highlights: • Ni–Zn ferrite (Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4}) with acetylene black found effective coating for microwave absorption. • Coating formulation containing 40 wt% ferrite, 3 wt% carbon and 57 wt% PU offered 40% absorption, 20
Directory of Open Access Journals (Sweden)
Fuat Bayrakceken
2012-01-01
Full Text Available Microwave irradiation at GSM 900/1800 MHz mobile phone frequencies affects the electronic structure of cresyl violet in solution. These changes are important because laser-dye cresyl violet strongly bonds to DNA- and RNA-rich cell compounds in nerve tissues. The irradiation effects on the electronic structure of cresyl violet and its fluorescence data were all obtained experimentally at room temperature. For most laser dyes, this is not a trivial task because laser dye molecules possess a relatively complex structure. They usually consist of an extended system of conjugated double or aromatic π-bonds with attached auxochromic (electron donating groups shifting the absorption band further towards longer wavelength. Because of the intrinsically high degree of conjugation, the vibrational modes of the molecular units couple strongly with each other. We found that the fluorescence quantum yield was increased from to due to intramolecular energy hopping of cresyl violet in solution which is exposed to microwave irradiation at mobile phone frequencies, and the photonic product cannot be used as a laser dye anymore.
Microwave permeability of stripe patterned FeCoN thin film
Energy Technology Data Exchange (ETDEWEB)
Wu, Yuping [Temasek Laboratories, National University of Singapore, 5A Engineering Drive 1, Singapore 117411 (Singapore); Yang, Yong, E-mail: tslyayo@nus.edu.sg [Temasek Laboratories, National University of Singapore, 5A Engineering Drive 1, Singapore 117411 (Singapore); Ma, Fusheng; Zong, Baoyu; Yang, Zhihong [Temasek Laboratories, National University of Singapore, 5A Engineering Drive 1, Singapore 117411 (Singapore); Ding, Jun [Department of Materials Science and Engineering, National University of Singapore, Singapore 117574 (Singapore)
2017-03-15
Magnetic stripe patterns are of great importance for microwave applications owing to their highly tunable microwave permeability by adjusting the geometrical dimensions. In this work, stripe patterned FeCoN films with 160 nm thickness are fabricated by using standard UV photolithography. Their microwave permeability are investigated systematically via both experiment and micromagnetic simulation. The good agreement between experimental and simulation results suggests that stripe width is crucial for the microwave magnetic properties of the stripe pattern. It is demonstrated by simulation that with increasing stripe width from 1 to 80 µm the initial permeability shows a continuous growth from about 8–322, whiles the resonance frequency drops dramatically from 18.7 to 3.1 GHz at 4 µm gap size. Smaller gap size would result in slightly increased initial permeability due to larger magnetic volume ratio, accompanied by decreased resonance frequency because of stronger magnetostatic interaction. Moreover, the experimental investigation on stripe length effect indicates that the stripe length should be kept as long as possible to achieve uniform bulk resonance mode and high permeability value. Insufficient stripe length would result in low frequency edge mode and decayed bulk mode. This study could provide valuable guidelines on the selection of proper geometry dimensions of FeCoN stripe patterns for high frequency applications. - Highlights: • This work presents a systematic study on permeability of FeCoN stripe pattern. • Geometrical parameters of the stripe pattern are systematically optimized. • Several important conclusions has been obtained. • The results offer guideline on FeCoN stripe patterns for high frequency applications.
Microwave-Based Water Decontamination System
Arndt, G. Dickey (Inventor); Byerly, Diane (Inventor); Sognier, Marguerite (Inventor); Dusl, John (Inventor)
2016-01-01
A system for decontaminating a medium. The system can include a medium having one or more contaminants disposed therein. The contaminants can be or include bacteria, fungi, parasites, viruses, and combinations thereof. A microwave energy radiation device can be positioned proximate the medium. The microwave energy radiation device can be adapted to generate a signal having a frequency from about 10 GHz to about 100 GHz. The signal can be adapted to kill one or more of the contaminants disposed within the medium while increasing a temperature of the medium by less than about 10 C.
International Nuclear Information System (INIS)
Yang, Zhaoning; Luo, Fa; Hu, Yang; Duan, Shichang; Zhu, Dongmei; Zhou, Wancheng
2016-01-01
In this paper, TiO_2/Al_2O_3 ceramic coatings were prepared by atmospheric plasma spraying (APS) technique. The phase composition and morphological characterizations of the synthesized TiO_2/Al_2O_3 powders and coatings were performed by X-ray diffraction and scanning electron microscopy (SEM), respectively. The dielectric properties of these coatings were discussed in the frequency range from 8.2 to 12.4 GHz (X-band). By calculating the microwave-absorption as a single-layer absorber, their microwave absorption properties were investigated at different content and thickness in details. Furthermore, by combination of the Frequency selective surface (FSS) and ceramic coatings, a double absorption band of the reflection loss spectra had been observed. The microwave absorbing properties of coatings both in absorbing intensity and absorbing bandwidth were improved. The reflection loss values of TiO_2/Al_2O_3 coatings exceeding −10 dB (larger than 90% absorption) can be obtained in the whole frequency range of X-band with 17 wt% TiO_2 content when the coating thickness is 2.3 mm. - Highlights: • Dielectric properties of TiO_2/Al_2O_3 ceramics fabricated by APS technique are reported for the first time. • Microwave absorption properties of TiO_2/Al_2O_3 composites are improved by FSS. • Reflection loss values exceeding −10 dB can be obtained in the whole X-band when coating thickness is 2.3 mm.
Energy Technology Data Exchange (ETDEWEB)
Klingler, S., E-mail: stefan.klingler@wmi.badw.de; Maier-Flaig, H.; Weiler, M. [Walther-Meißner-Institut, Bayerische Akademie der Wissenschaften, Walther-Meißner-Straße 8, 85748 Garching (Germany); Physik-Department, Technische Universität München, 85748 Garching (Germany); Gross, R.; Huebl, H.; Goennenwein, S. T. B. [Walther-Meißner-Institut, Bayerische Akademie der Wissenschaften, Walther-Meißner-Straße 8, 85748 Garching (Germany); Physik-Department, Technische Universität München, 85748 Garching (Germany); Nanosystems Initiative Munich (NIM), 80799 Munich (Germany); Hu, C.-M. [Department of Physics and Astronomy, University of Manitoba, Winnipeg, Manitoba R3T2N2 (Canada)
2016-08-15
Microfocused Brillouin light scattering (BLS) and microwave absorption (MA) are used to study magnon-photon coupling in a system consisting of a split-ring microwave resonator and an yttrium iron garnet (YIG) film. The split-ring resonator is defined by optical lithography and loaded with a 1 μm-thick YIG film grown by liquid phase epitaxy. BLS and MA spectra of the hybrid system are simultaneously recorded as a function of the applied magnetic field magnitude and microwave excitation frequency. Strong coupling of the magnon and microwave resonator modes is found with a coupling strength of g{sub eff} /2π = 63 MHz. The combined BLS and MA data allow us to study the continuous transition of the hybridized modes from a purely magnonic to a purely photonic mode by varying the applied magnetic field and microwave frequency. Furthermore, the BLS data represent an up-conversion of the microwave frequency coupling to optical frequencies.
International Nuclear Information System (INIS)
Aguiar, F.M. de
2011-01-01
The Helmholtz equation describing transverse magnetic modes in a closed flat microwave resonator with 60 randomly distributed discs is numerically solved. At lower frequencies, the calculated wave intensity spatially distributed obeys the universal Porter-Thomas form if localized modes are excluded. A superposition of resonant modes is shown to lead to rare events of extreme intensities (freak waves) at localized 'hot spots'. The temporally distributed intensity of such a superposition at the center of a hot spot also follows the Porter-Thomas form. Branched modes are found at higher frequencies. The results bear resemblance to recent experiments reported in an open cavity.
A microwave window for K band electromagnetic systems
DEFF Research Database (Denmark)
Rybalko, Oleksandr
2017-01-01
This article proposes a solution for microwave window at K band. Properties of the window such as performance (transparency) at microwave frequencies, dimensions, and mounting place are discussed. The dimensions of the window were optimized in a full-wave simulator. To verify the design...... and simulation results the prototype of the window is realized by implementing into transition section and tested experimentally. The microwave window provides low return loss |S11| below −30 dB, low insertion loss |S21| below −0.5 dB and can be used for electromagnetic systems where vacuum sealing is required...
Microwave dielectric characterization of binary mixture of formamide ...
Indian Academy of Sciences (India)
The mixtures exhibit a principle dispersion of the Davidson–Cole relaxation type at microwave frequencies. Bilinear calibration method is used to obtain complex permittivity *() from complex reflection coefficient ρ*() over the frequency range of 10 MHz to 10 GHz. The excess permittivity (E), excessinverse relaxation ...
Microwave combustion and sintering without isostatic pressure
International Nuclear Information System (INIS)
Ebadian, M.A.
1998-01-01
In recent years interest has grown rapidly in the application of microwave energy to the processing of ceramics, composites, polymers, and other materials. Advances in the understanding of microwave/materials interactions will facilitate the production of new ceramic materials with superior mechanical properties. One application of particular interest is the use of microwave energy for the mobilization of uranium for subsequent redeposition. Phase III (FY98) will focus on the microwave assisted chemical vapor infiltration tests for mobilization and redeposition of radioactive species in the mixed sludge waste. Uranium hexachloride and uranium (IV) borohydride are volatile compounds for which the chemical vapor infiltration procedure might be developed for the separation of uranium. Microwave heating characterized by an inverse temperature profile within a preformed ceramic matrix will be utilized for CVI using a carrier gas. Matrix deposition is expected to commence from the inside of the sample where the highest temperature is present. The preform matrix materials, which include aluminosilicate based ceramics and silicon carbide based ceramics, are all amenable to extreme volume reduction, densification, and vitrification. Important parameters of microwave sintering such as frequency, power requirement, soaking temperature, and holding time will be investigated to optimize process conditions for the volatilization of uranyl species using a reactive carrier gas in a microwave chamber
Microwave reflection properties of planar anisotropy Fe50Ni50 powder/paraffin composites
International Nuclear Information System (INIS)
Wei Jian-Qiang; Zhang Zhao-Qi; Han Rui; Wang Tao; Li Fa-Shen
2012-01-01
The reflection properties of planar anisotropy Fe 50 Ni 50 powder/paraffin composites have been studied in the microwave frequency range. The permeability of Fe 50 Ni 50 powder/paraffin composites is greatly enhanced by introducing the planar anisotropy, and can be further enhanced by using a rotational orientation method. The complex permeability can be considered as the superposition of two types of magnetic resonance. The resonance peak at high frequency is attributed to the natural resonance, while the peak at low frequency is attributed to the domain-wall resonance. The simulated results of the microwave reflectivity show that the matching thickness, peak frequency, permeability, and permittivity are closely related to the quarter wavelength matching condition. The Fe 50 Ni 50 powder/paraffin composites can be attractive candidates for thinner microwave absorbers in the L-band (1–2 GHz). (condensed matter: electronic structure, electrical, magnetic, and optical properties)
Heterodyne detector for measuring the characteristic of elliptically polarized microwaves
DEFF Research Database (Denmark)
Leipold, Frank; Nielsen, Stefan Kragh; Michelsen, Susanne
2008-01-01
In the present paper, a device is introduced, which is capable of determining the three characteristic parameters of elliptically polarized light (ellipticity, angle of ellipticity, and direction of rotation) for microwave radiation at a frequency of 110 GHz. The device consists of two perpendicu......In the present paper, a device is introduced, which is capable of determining the three characteristic parameters of elliptically polarized light (ellipticity, angle of ellipticity, and direction of rotation) for microwave radiation at a frequency of 110 GHz. The device consists of two...... be calculated. Results from measured and calculated wave characteristics of an elliptically polarized 110 GHz microwave beam for plasma heating launched into the TEXTOR-tokamak experiment are presented. Measurement and calculation are in good agreement. ©2008 American Institute of Physics...
Microwave SQUID multiplexer demonstration for cosmic microwave background imagers
Dober, B.; Becker, D. T.; Bennett, D. A.; Bryan, S. A.; Duff, S. M.; Gard, J. D.; Hays-Wehle, J. P.; Hilton, G. C.; Hubmayr, J.; Mates, J. A. B.; Reintsema, C. D.; Vale, L. R.; Ullom, J. N.
2017-12-01
Key performance characteristics are demonstrated for the microwave superconducting quantum interference device (SQUID) multiplexer (μmux) coupled to transition edge sensor (TES) bolometers that have been optimized for cosmic microwave background (CMB) observations. In a 64-channel demonstration, we show that the μmux produces a white, input referred current noise level of 29 pA/ √{H z } at a microwave probe tone power of -77 dB, which is well below the expected fundamental detector and photon noise sources for a ground-based CMB-optimized bolometer. Operated with negligible photon loading, we measure 98 pA/ √{H z } in the TES-coupled channels biased at 65% of the sensor normal resistance. This noise level is consistent with that predicted from bolometer thermal fluctuation (i.e., phonon) noise. Furthermore, the power spectral density is white over a range of frequencies down to ˜100 mHz, which enables CMB mapping on large angular scales that constrain the physics of inflation. Additionally, we report cross-talk measurements that indicate a level below 0.3%, which is less than the level of cross-talk from multiplexed readout systems in deployed CMB imagers. These measurements demonstrate the μmux as a viable readout technique for future CMB imaging instruments.
International Nuclear Information System (INIS)
Nelson, S.O.
1994-01-01
The importance of moisture content in agricultural commodities, the usefulness of the dielectric properties of such products for sensing moisture content by radiofrequency and microwave measurements, and factors affecting these properties are briefly discussed. Recent developments in the understanding of principles for online moisture sensing and the sensing of individual kernel, seed, nut and fruit moisture contents by radiofrequency and microwave techniques are reviewed. A brief discussion is included on aspects of practical application
International Nuclear Information System (INIS)
Wanmode, Y.D.; Shrivastava, Purushottam; Hannurkar, P.R.
2003-01-01
A 20 MeV microtron was developed indigenously by CAT for pre-injection of 20 MeV electrons to the 450 MeV/700 MeV Booster Synchrotron for INDUS-I and INDUS-II Synchrotron Radiation Sources. The injector microtron uses a high Q microwave cavity for acceleration of electrons. The microwave power is fed to the microtron cavity through an iris type coupler whose dimensions are optimized for the coupling factor and resonant frequency for the accelerator. The present paper gives the procedure details for coupling factor optimization, tuning of the resonant frequency and results achieved. (author)
Optical Stabilization of a Microwave Oscillator for Fountain Clock Interrogation.
Lipphardt, Burghard; Gerginov, Vladislav; Weyers, Stefan
2017-04-01
We describe an optical frequency stabilization scheme of a microwave oscillator that is used for the interrogation of primary cesium fountain clocks. Because of its superior phase noise properties, this scheme, which is based on an ultrastable laser and a femtosecond laser frequency comb, overcomes the frequency instability limitations of fountain clocks given by the previously utilized quartz-oscillator-based frequency synthesis. The presented scheme combines the transfer of the short-term frequency instability of an optical cavity and the long-term frequency instability of a hydrogen maser to the microwave oscillator and is designed to provide continuous long-term operation for extended measurement periods of several weeks. The utilization of the twofold stabilization scheme on the one hand ensures the referencing of the fountain frequency to the hydrogen maser frequency and on the other hand results in a phase noise level of the fountain interrogation signal, which enables fountain frequency instabilities at the 2.5 ×10 -14 (τ/s) -1/2 level that are quantum projection noise limited.
GYRO-INTERACTION OF MICROWAVES IN MAGNETO PLASMAS IN ATMOSPHERIC GASES
Energy Technology Data Exchange (ETDEWEB)
Narasinga Rao, K. V.; Goldstein, L.
1963-05-15
Electron cyclotron resonance absorption of microwave energy by the electron gas in decaying magneto plasmas of oxygen and nitrogen gases is investigated. The technique of interaction of microwaves of diffent frequencies is utilized to measure the enhancement in electronic energy caused by resonance absorption. The results of these experiments show that the inelastic collisions of low energy electrons introduce a barrier for rapid heating of the electron gas. The implication of these results to the control of the ionospheric plasma parameters by radio frequency EM waves is discussed. (auth)
Combination microwave ovens: an innovative design strategy.
Tinga, Wayne R; Eke, Ken
2012-01-01
Reducing the sensitivity of microwave oven heating and cooking performance to load volume, load placement and load properties has been a long-standing challenge for microwave and microwave-convection oven designers. Conventional design problem and solution methods are reviewed to provide greater insight into the challenge and optimum operation of a microwave oven after which a new strategy is introduced. In this methodology, a special load isolating and energy modulating device called a transducer-exciter is used containing an iris, a launch box, a phase, amplitude and frequency modulator and a coupling plate designed to provide spatially distributed coupling to the oven. This system, when applied to a combined microwave-convection oven, gives astounding performance improvements to all kinds of baked and roasted foods including sensitive items such as cakes and pastries, with the only compromise being a reasonable reduction in the maximum available microwave power. Large and small metal utensils can be used in the oven with minimal or no performance penalty on energy uniformity and cooking results. Cooking times are greatly reduced from those in conventional ovens while maintaining excellent cooking performance.
Hung, Yu-Han; Yan, Jhih-Heng; Feng, Kai-Ming; Hwang, Sheng-Kwang
2017-06-15
This study investigates an all-optical scheme based on period-one (P1) nonlinear dynamics of semiconductor lasers, which regenerates the microwave carrier of an orthogonal frequency division multiplexing radio-over-fiber (OFDM-RoF) signal and uses it as a microwave local oscillator for coherent detection. Through the injection locking established between the OFDM-RoF signal and the P1 dynamics, frequency synchronization with highly preserved phase quality is inherently achieved between the recovered microwave carrier and the microwave carrier of the OFDM-RoF signal. A bit-error ratio down to 1.9×10-9 is achieved accordingly using the proposed scheme for coherent detection of a 32-GHz OFDM-RoF signal carrying 4 Gb/s 16-quadrature amplitude modulation data. No electronic microwave generators or electronic phase-locked loops are thus required. The proposed system can be operated up to at least 100 GHz and can be self-adapted to certain changes in the operating microwave frequency.
Widely Tunable On-Chip Microwave Circulator for Superconducting Quantum Circuits
Chapman, Benjamin J.; Rosenthal, Eric I.; Kerckhoff, Joseph; Moores, Bradley A.; Vale, Leila R.; Mates, J. A. B.; Hilton, Gene C.; Lalumière, Kevin; Blais, Alexandre; Lehnert, K. W.
2017-10-01
We report on the design and performance of an on-chip microwave circulator with a widely (GHz) tunable operation frequency. Nonreciprocity is created with a combination of frequency conversion and delay, and requires neither permanent magnets nor microwave bias tones, allowing on-chip integration with other superconducting circuits without the need for high-bandwidth control lines. Isolation in the device exceeds 20 dB over a bandwidth of tens of MHz, and its insertion loss is small, reaching as low as 0.9 dB at select operation frequencies. Furthermore, the device is linear with respect to input power for signal powers up to hundreds of fW (≈103 circulating photons), and the direction of circulation can be dynamically reconfigured. We demonstrate its operation at a selection of frequencies between 4 and 6 GHz.
Superconductor Microwave Kinetic Inductance Detectors: System Model of the Readout Electronics
Directory of Open Access Journals (Sweden)
F. Alimenti
2009-06-01
Full Text Available This paper deals with the readout electronics needed by superconductor Microwave Kinetic Inductance Detectors (MKIDs. MKIDs are typically implemented in the form of cryogenic-cooled high quality factor microwave resonator. The natural frequency of these resonators changes as a millimeter or sub-millimeter wave radiation impinges on the resonator itself. A quantitative system model of the readout electronics (very similar to that of a vector network analyzer has been implemented under ADS environment and tested by several simulation experiments. The developed model is a tool to further optimize the readout electronic and to design the frequency allocation of parallel-connected MKIDs resonators. The applications of MKIDs will be in microwave and millimeter-wave radiometric imaging as well as in radio-astronomy focal plane arrays.
High-frequency behavior of magnetic composites
International Nuclear Information System (INIS)
Lagarkov, Andrey N.; Rozanov, Konstantin N.
2009-01-01
The paper reviews recent progress in the field of microwave magnetic properties of composites. The problem under discussion is developing composites with high microwave permeability that are needed in many applications. The theory of magnetic composites is briefly sketched with the attention paid to the laws governing the magnetic frequency dispersion in magnetic materials and basic mixing rules for composites. Recent experimental reports on the microwave performance of magnetic composites, as well as data on the agreement of the mixing rules with the measured permeability of composites that are available from the literature are discussed. From the data, a conclusion is made that the validity of a mixing rule is determined by the permeability contrast in the composite, i.e., the difference between permeability of inclusions and that of the host matrix. When the contrast is low, the Maxwell Garnet mixing rule is frequently valid. When the contrast is high, which is of the most interest for obtaining high microwave permeability of a composite, no conventionally accepted theory is capable of accurately predicting the permeability of the composites. Therefore, the mixing rules do not allow the microwave properties of magnetic composites to be predicted when the permeability of inclusions is high, that is the case of the most interest. Because of that, general limitations to the microwave performance of composites are of importance. In particular, an important relation constraining the microwave permeability of composites follows from Kittel's theory of ferromagnetic resonance and analytical properties of frequency dependence of permeability. Another constraint concerning the bandwidth of electromagnetic wave absorbers follows from the Kramers-Kronig relations for the reflection coefficient. The constraints are of importance in design and analysis of electromagnetic wave absorbers and other devices that employ the microwave magnetic properties of composites, such as
Formation of virtual cathodes and microwave generation in relativistic electron beams
International Nuclear Information System (INIS)
Kwan, T.J.T.; Thode, L.E.
1984-01-01
Simulation of the generation of a relativistic electron beam in a foil diode configuration and the subsequent intense microwave generation resulting from the formation of the virtual cathode is presented. The oscillating virtual cathode and the trapped beam electrons between the real and the virtual cathodes were found to generate microwaves at two distinct frequencies. Generation of high-power microwaves with about 10% efficiency might reasonably be expected from such a virtual-cathode configuration
Microwave stability at transition
International Nuclear Information System (INIS)
Holt, J.A.; Colestock, P.L.
1995-05-01
The question of microwave stability at transition is revisited using a Vlasov approach retaining higher order terms in the particle dynamics near the transition energy. A dispersion relation is derived which can be solved numerically for the complex frequency in terms of the longitudinal impedance and other beam parameters. Stability near transition is examined and compared with simulation results
International Nuclear Information System (INIS)
Futch, A.H.; Mortensen, W.K.
1977-01-01
A 2-mm microwave interferometer has been developed, and phase shift measurements have been made on the Baseball II experiment. The interferometer system employs a 140-GHz receiver for double down conversion of the plasma signal to a 60-MHz, IF frequency. The 140-GHz references signal is also down-converted and compared with the plasma signal to provide the desired phase change of the signal passing through the plasma. A feedback voltage from a 60-MHz discriminator to a voltage-controlled oscillator in the receiver provides frequency stability of the 60-MHz IF signals
Frequency-agile gyrotron for electron decoupling and pulsed dynamic nuclear polarization
Scott, Faith J.; Saliba, Edward P.; Albert, Brice J.; Alaniva, Nicholas; Sesti, Erika L.; Gao, Chukun; Golota, Natalie C.; Choi, Eric J.; Jagtap, Anil P.; Wittmann, Johannes J.; Eckardt, Michael; Harneit, Wolfgang; Corzilius, Björn; Th. Sigurdsson, Snorri; Barnes, Alexander B.
2018-04-01
We describe a frequency-agile gyrotron which can generate frequency-chirped microwave pulses. An arbitrary waveform generator (AWG) within the NMR spectrometer controls the microwave frequency, enabling synchronized pulsed control of both electron and nuclear spins. We demonstrate that the acceleration of emitted electrons, and thus the microwave frequency, can be quickly changed by varying the anode voltage. This strategy results in much faster frequency response than can be achieved by changing the potential of the electron emitter, and does not require a custom triode electron gun. The gyrotron frequency can be swept with a rate of 20 MHz/μs over a 670 MHz bandwidth in a static magnetic field. We have already implemented time-domain electron decoupling with dynamic nuclear polarization (DNP) magic angle spinning (MAS) with this device. In this contribution, we show frequency-swept DNP enhancement profiles recorded without changing the NMR magnet or probe. The profile of endofullerenes exhibits a DNP profile with a <10 MHz linewidth, indicating that the device also has sufficient frequency stability, and therefore phase stability, to implement pulsed DNP mechanisms such as the frequency-swept solid effect. We describe schematics of the mechanical and vacuum construction of the device which includes a novel flanged sapphire window assembly. Finally, we discuss how commercially available continuous-wave gyrotrons can potentially be converted into similar frequency-agile high-power microwave sources.
Broadening microwave absorption via a multi-domain structure
Directory of Open Access Journals (Sweden)
Zhengwang Liu
2017-04-01
Full Text Available Materials with a high saturation magnetization have gained increasing attention in the field of microwave absorption; therefore, the magnetization value depends on the magnetic configuration inside them. However, the broad-band absorption in the range of microwave frequency (2-18 GHz is a great challenge. Herein, the three-dimensional (3D Fe/C hollow microspheres are constructed by iron nanocrystals permeating inside carbon matrix with a saturation magnetization of 340 emu/g, which is 1.55 times as that of bulk Fe, unexpectedly. Electron tomography, electron holography, and Lorentz transmission electron microscopy imaging provide the powerful testimony about Fe/C interpenetration and multi-domain state constructed by vortex and stripe domains. Benefiting from the unique chemical and magnetic microstructures, the microwave minimum absorption is as strong as −55 dB and the bandwidth (<−10 dB spans 12.5 GHz ranging from 5.5 to 18 GHz. Morphology and distribution of magnetic nano-domains can be facilely regulated by a controllable reduction sintering under H2/Ar gas and an optimized temperature over 450–850 °C. The findings might shed new light on the synthesis strategies of the materials with the broad-band frequency and understanding the association between multi-domain coupling and microwave absorption performance.
Design of a New ENG Metamaterial for S-Band Microwave Applications
Directory of Open Access Journals (Sweden)
ISLAM Sikder Sunbeam
2014-10-01
Full Text Available In this paper we propose a new metamaterial unit cell structure on FR-4 substrate material that shows resonance in the microwave S-Band frequency range and also shows negative permittivity at that frequency. The material shows better performances with two resonances and Double Negative characteristics if Rogers RT 6010 substrate material is used. In this design two separate split ring resonators is used. We have used the CST Microwave Studio simulation software to get the reflection and transmission parameters for this unit cell.
Microwave Triggered Laser Ionization of Air
Vadiee, Ehsan; Prasad, Sarita; Jerald Buchenauer, C.; Schamiloglu, Edl
2012-10-01
The goal of this work is to study the evolution and dynamics of plasma expansion when a high power microwave (HPM) pulse is overlapped in time and space on a very small, localized region of plasma formed by a high energy laser pulse. The pulsed Nd:YAG laser (8 ns, 600mJ, repetition rate 10 Hz) is focused to generate plasma filaments in air with electron density of 10^17/cm^3. When irradiated with a high power microwave pulse these electrons would gain enough kinetic energy and further escalate avalanche ionization of air due to elastic electron-neutral collisions thereby causing an increased volumetric discharge region. An X-band relativistic backward wave oscillator(RBWO) at the Pulsed Power,Beams and Microwaves laboratory at UNM is constructed as the microwave source. The RBWO produces a microwave pulse of maximum power 400 MW, frequency of 10.1 GHz, and energy of 6.8 Joules. Special care is being given to synchronize the RBWO and the pulsed laser system in order to achieve a high degree of spatial and temporal overlap. A photodiode and a microwave waveguide detector will be used to ensure the overlap. Also, a new shadowgraph technique with a nanosecond time resolution will be used to detect changes in the shock wave fronts when the HPM signal overlaps the laser pulse in time and space.
Consideration on the Mechanism of Microwave Emission Due to Rock Fracture
Takano, Tadashi; Sugita, Seiji; Yoshida, Shingo; Maeda, Takashi
2010-05-01
Microwave emission due to rock fracture was found at 300 MHz, 2 GHz, and 22 GHz, and its power was calibrated in laboratory for the first time in the world. The observed waveform is impulsive, and contains correspondent frequency component inside the envelope at each frequency band. At such high frequencies, the electro-magnetic signal power can be calibrated as a radiating wave with high accuracy. Accordingly, it was verified that a substantial power is emitted. The microwave emission phenomena were also observed on occasions of hypervelocity impact, and esteemed as phenomena generally associated with material destruction. Earthquakes and volcanic activities are association with rock fractures so that the microwave is expected to be emitted. Actually, the e emission was confirmed by the data analysis of the brightness temperature obtained by a remote sensing satellite, which flew over great earthquakes of Wuenchan and Sumatra, and great volcanic eruptions of Reventador and Chanten. It is important to show the microwave emission during rock fracture in natural phenomena. Therefore, the field test to detect the microwave due to the collapse of a crater cliff was planned and persecuted at the volcano of Miyake-jima about 100 km south of Tokyo. Volcanic activity may be more convenient than an earthquake because of the known location and time. As a result, they observed the microwave emission which was strongly correlated with the cliff collapses. Despite of the above-mentioned phenomenological fruits, the reason of the microwave emission is not fixed yet. We have investigated the mechanism of the emission in consideration of the obtained data in rock fracture experiments so far and the study results on material destruction by hypervelocity impact. This paper presents the proposal of the hypothesis and resultant discussions. The microwave sensors may be useful to monitor natural hazards such as an earthquake or a volcanic eruption, because the microwave due to rock
Multi-band microwave photonic satellite repeater scheme employing intensity Mach-Zehnder modulators
Institute of Scientific and Technical Information of China (English)
Yin Jie; Dong Tao; Zhang Bin; Hao Yan; Cao Guixing; Cheng Zijing; Xu Kun; Zhou Yue; Dai Jian
2017-01-01
To solve the satellite repeater's flexible and wideband frequency conversion problem,we propose a novel microwave photonic repeater system,which can convert the upload signal's carrier to six different frequencies.The scheme employs one 20 GHz bandwidth dual-drive Mach-Zehnder modulator (MZM) and two 10 GHz bandwidth MZMs.The basic principle of this scheme is filtering out two optical sidebands after the optical carrier suppression (OCS) modulation and combining two sidebands modulated by the input radio frequency (RF) signal.This structure can realize simultaneous multi-band frequency conversion with only one frequency-fixed microwave source and prevent generating harmful interference sidebands by using two corresponding optical filters after optical modulation.In the simulation,one C-band signal of 6 GHz carrier can be successfully converted to 12 GHz (Ku-band),28 GHz,34 GHz,40 GHz,46 GHz (Ka-band) and 52 GHz (V-band),which can be an attractive method to realize multi-band microwave photonic satellite repeater.Alternatively,the scheme can be configured to generate multi-band local oscillators (LOs) for widely satellite onboard clock distribution when the input RF signal is replaced by the internal clock source.
A Dual-Mode Microwave Applicator for Liver Tumor Thermotherapy
Reimann, Carolin; Schüßler, Martin; Jakoby, Rolf; Bazrafshan, Babak; Hübner, Frank; Vogl, Thomas
2018-03-01
The concept of a novel dual-mode microwave applicator for diagnosis and thermal ablation treatment of tumorous tissue is presented in this paper. This approach is realized by integrating a planar resonator array to, firstly, detect abnormalities by a relative dielectric analysis, and secondly, perform a highly localized thermal ablation. A further essential advantage is addressed by designing the applicator to be MRI compatible to provide a multimodal imaging procedure. Investigations for an appropriate frequency range lead to the use of much higher operating frequencies between 5 GHz and 10 GHz, providing a significantly lower power consumption for microwave ablation of only 20 W compared to commercial available applicators.
Enhanced microwave absorption properties in cobalt–zinc ferrite based nanocomposites
Energy Technology Data Exchange (ETDEWEB)
Poorbafrani, A., E-mail: a.poorbafrani@gmail.com; Kiani, E.
2016-10-15
In an attempt to find a solution to the problem of the traditional spinel ferrite used as the microwave absorber, the Co{sub 0.6}Zn{sub 0.4}Fe{sub 2}O{sub 4}–Paraffin nanocomposites were investigated. Cobalt–zinc ferrite powders, synthesized through PVA sol–gel method, were combined with differing concentrations of Paraffin wax. The nanocomposite samples were characterized employing various experimental techniques including X-Ray Diffraction (XRD), Field Emission Scanning Electron Microscopy (FESEM), Alternating Gradient Force Magnetometer (AGFM), and Vector Network Analyzer (VNA). The saturation magnetization and coercivity were enhanced utilizing appropriate stoichiometry, coordinate agent, and sintering temperature required for the preparation of cobalt–zinc ferrite. The complex permittivity and permeability spectra, and Reflection Loss (RL) of Co{sub 0.6}Zn{sub 0.4}Fe{sub 2}O{sub 4}–Paraffin nanocomposites were measured in the frequency range of 1–18 GHz. The microwave absorption properties of nanocomposites indicated that the absorbing composite containing 20 wt% of paraffin manifests the strongest microwave attenuation ability. The composite exhibited the reflection loss less than –10 dB in the whole C-band and 30% of the X-band frequencies. - Highlights: • We enhanced the magnetic properties of cobalt–zinc Ferrite nanocomposites. • The samples showed absorption in the whole C-band and 30% of the X-band frequencies. • We tried to solve the problem of the spinel ferrite utilized as efficient absorber. • We enhanced the microwave reflection loss over extended frequency ranges.
The removal of concrete layers from biological shields by microwaves
International Nuclear Information System (INIS)
Hills, D.L.
1989-01-01
Concrete blocks reinforced with steel bars have been subjected to microwave attack at a frequency of 896 MHz at power levels up to 25 kW. The surface concrete has been explosively removed to the depth of the reinforcement, 10 cm, at a rate of about 2 litres per kWh. Heating was localized around the point of attack, with temperatures up to 300 0 C at the fractured face being attained. A simple mathematical model of the propagation and absorption of micro-waves was used to estimate the temperature rise of concrete at microwave frequencies of 896 wand 2450 MHz, at different power levels with and without the presence of reinforcing bars. This demonstrated that reinforcement is expected to significantly increase the temperature rise in the concrete between the irradiated surface and the reinforcement, and that near-surface heating should be more rapid at the higher frequency. There was reasonable agreement between predicted and observed temperature at the higher power levels. Further desk and laboratory studies are proposed before proceeding to a fullscale practical demolition machine and the requirements for a prototype remotely-operated demonstration system have been identified. This consists of a static generator of high power (at least 50 kW) transmitting microwaves via a steerable waveguide to a remote applicator mounted on a simple three-axis manipulator capable of traversing realistically large concrete test panels
Formation of silicides in a cavity applicator microwave system
International Nuclear Information System (INIS)
Thompson, D.C.; Kim, H.C.; Alford, T.L.; Mayer, J.W.
2003-01-01
Metal silicides of nickel and cobalt are formed in a cavity applicator microwave system with a magnetron power of 1200 W and a frequency of 2.45 GHz. X-ray diffraction, Rutherford backscattering spectrometry, and four-point-probe measurements are used to identify the silicide phase present and layer thicknesses. Additional processing confirmed that the products attained from heating by microwaves do not differ appreciably from those attained in heating by thermal processes. Materials properties are used to explain microwave power absorption and demonstrate how to tailor a robust process in which thin film reactions can be attained and specific products isolated
FINGERPRINTS OF GALACTIC LOOP I ON THE COSMIC MICROWAVE BACKGROUND
International Nuclear Information System (INIS)
Liu, Hao; Mertsch, Philipp; Sarkar, Subir
2014-01-01
We investigate possible imprints of galactic foreground structures such as the ''radio loops'' in the derived maps of the cosmic microwave background. Surprisingly, there is evidence for these not only at radio frequencies through their synchrotron radiation, but also at microwave frequencies where emission by dust dominates. This suggests the mechanism is magnetic dipole radiation from dust grains enriched by metallic iron or ferrimagnetic molecules. This new foreground we have identified is present at high galactic latitudes, and potentially dominates over the expected B-mode polarization signal due to primordial gravitational waves from inflation
Microplasmas ignited and sustained by microwaves
Hopwood, Jeffrey; Hoskinson, Alan R.; Gregório, José
2014-12-01
The challenges and benefits of microwave-induced microdischarges are reviewed. Transmission lines, resonators and surface wave launchers may be used for coupling microwave power to very small plasmas. Fortunately, microplasmas are typically much smaller than the wavelength of microwaves, and the electromagnetic problem may be treated electrostatically within the plasma. It is possible to trap electrons within small discharge gaps if the amplitude of electron oscillation is smaller than the plasma size. Typically occurring above 0.3 GHz, this condition results in lower breakdown fields than are required by direct current or radio frequency systems. Trapping of electrons also decreases the electrode potential to only tens of volts and makes the plasma density invariant in time. The steady-state microplasma produces electron densities of up to 1015 cm-3 in argon but the electrons are not in equilibrium with the low gas temperatures (500-1000 K). Microwave discharges are compared with other forms of microplasma and guidelines for device selection are recommended. Scale-up of microplasmas using array concepts are presented followed by some exciting new applications.
Extended Special Sensor Microwave Imager (SSM/I) Temperature Data Record (TDR) in netCDF
National Oceanic and Atmospheric Administration, Department of Commerce — The Special Sensor Microwave Imager (SSM/I) is a seven-channel linearly polarized passive microwave radiometer that operates at frequencies of 19.36 (vertically and...
Extended Special Sensor Microwave Imager (SSM/I) Sensor Data Record (SDR) in netCDF
National Oceanic and Atmospheric Administration, Department of Commerce — The Special Sensor Microwave Imager (SSM/I) is a seven-channel linearly polarized passive microwave radiometer that operates at frequencies of 19.36 (vertically and...
Handbook on dielectric and thermal properties of microwaveable materials
Komarov, Vyacheslav V
2012-01-01
The application of microwave energy for thermal processing of different materials and substances is a rapidly growing trend in modern science and engineering. In fact, optimal design work involving microwaves is impossible without solid knowledge of the properties of these materials. Here s a practical reference that collects essential data on the dielectric and thermal properties of microwaveable materials, saving you countless hours on projects in a wide range of areas, including microwave design and heating, applied electrodynamics, food science, and medical technology. This unique book provides hard-to-find information on complex dielectric permittivity of media at industrial, scientific, and medical frequencies (430 MHz, 915MHz, 2.45GHz, 5.8 GHz, and 24.125GHz). Written by a leading expert in the field, this authoritative book does an exceptional job at presenting critical data on various materials and explaining what their key characteristics are concerning microwaves.
Experimental study of microwave-induced thermoacoustic imaging
Jacobs, Ryan T.
Microwave-Induced Thermoacoustic Imaging (TAI) is a noninvasive hybrid modality which improves contrast by using thermoelastic wave generation induced by microwave absorption. Ultrasonography is widely used in medical practice as a low-cost alternative and supplement to magnetic resonance imaging (MRI). Although ultrasonography has relatively high image resolution (depending on the ultrasonic wavelength at diagnostic frequencies), it suffers from low image contrast of soft tissues. In this work samples are irradiated with sub-microsecond electromagnetic pulses inducing acoustic waves in the sample that are then detected with an unfocused transducer. The advantage of this hybrid modality is the ability to take advantage of the microwave absorption coefficients which provide high contrast in tissue samples. This in combination with the superior spatial resolution of ultrasound waves is important to providing a low-cost alternative to MRI and early breast cancer detection methods. This work describes the implementation of a thermoacoustic experiment using a 5 kW peak power microwave source.
Influence of 2. 45 GHz microwave radiation on enzyme activity
Energy Technology Data Exchange (ETDEWEB)
Galvin, M J; Parks, D L; McRee, D I
1981-05-01
The in vitro activity of acetylcholinesterase and creatine phosphokinase was determined during in vitro exposure to 2.45 GHz microwave radiation. The enzyme activities were examined during exposure to microwave radiation at specific absorption rates (SAR) of 1, 10, 50, and 100 mW/g. These specific absorption rates had no effect on the activity of either enzyme when the temperature of the control and exposed samples were similar. These data demonstrate that the activity of these two enzymes is not affected by microwave radiation at the SARs and frequency employed in this study.
An RFI Detection Algorithm for Microwave Radiometers Using Sparse Component Analysis
Mohammed-Tano, Priscilla N.; Korde-Patel, Asmita; Gholian, Armen; Piepmeier, Jeffrey R.; Schoenwald, Adam; Bradley, Damon
2017-01-01
Radio Frequency Interference (RFI) is a threat to passive microwave measurements and if undetected, can corrupt science retrievals. The sparse component analysis (SCA) for blind source separation has been investigated to detect RFI in microwave radiometer data. Various techniques using SCA have been simulated to determine detection performance with continuous wave (CW) RFI.
Improvement of Frequency Locking Algorithm for Atomic Frequency Standards
Park, Young-Ho; Kang, Hoonsoo; Heyong Lee, Soo; Eon Park, Sang; Lee, Jong Koo; Lee, Ho Seong; Kwon, Taeg Yong
2010-09-01
The authors describe a novel method of frequency locking algorithm for atomic frequency standards. The new algorithm for locking the microwave frequency to the Ramsey resonance is compared with the old one that had been employed in the cesium atomic beam frequency standards such as NIST-7 and KRISS-1. Numerical simulations for testing the performance of the algorithm show that the new method has a noise filtering performance superior to the old one by a factor of 1.2 for the flicker signal noise and 1.4 for random-walk signal noise. The new algorithm can readily be used to enhance the frequency stability for a digital servo employing the slow square wave frequency modulation.
Directory of Open Access Journals (Sweden)
T. Y. Lakhankar
2013-02-01
Full Text Available The CREST-Snow Analysis and Field Experiment (CREST-SAFE was carried out during January–March 2011 at the research site of the National Weather Service office, Caribou, ME, USA. In this experiment dual-polarized microwave (37 and 89 GHz observations were accompanied by detailed synchronous observations of meteorology and snowpack physical properties. The objective of this long-term field experiment was to improve understanding of the effect of changing snow characteristics (grain size, density, temperature under various meteorological conditions on the microwave emission of snow and hence to improve retrievals of snow cover properties from satellite observations. In this paper we present an overview of the field experiment and comparative preliminary analysis of the continuous microwave and snowpack observations and simulations. The observations revealed a large difference between the brightness temperature of fresh and aged snowpack even when the snow depth was the same. This is indicative of a substantial impact of evolution of snowpack properties such as snow grain size, density and wetness on microwave observations. In the early spring we frequently observed a large diurnal variation in the 37 and 89 GHz brightness temperature with small depolarization corresponding to daytime snowmelt and nighttime refreeze events. SNTHERM (SNow THERmal Model and the HUT (Helsinki University of Technology snow emission model were used to simulate snowpack properties and microwave brightness temperatures, respectively. Simulated snow depth and snowpack temperature using SNTHERM were compared to in situ observations. Similarly, simulated microwave brightness temperatures using the HUT model were compared with the observed brightness temperatures under different snow conditions to identify different states of the snowpack that developed during the winter season.
Microwave Technologies as Part of an Integrated Weed Management Strategy: A Review
Directory of Open Access Journals (Sweden)
Graham Brodie
2012-01-01
Full Text Available Interest in controlling weed plants using radio frequency or microwave energy has been growing in recent years because of the growing concerns about herbicide resistance and chemical residues in the environment. This paper reviews the prospects of using microwave energy to manage weeds. Microwave energy effectively kills weed plants and their seeds; however, most studies have focused on applying the microwave energy over a sizable area, which requires about ten times the energy that is embodied in conventional chemical treatments to achieve effective weed control. A closer analysis of the microwave heating phenomenon suggests that thermal runaway can reduce microwave weed treatment time by at least one order of magnitude. If thermal runaway can be induced in weed plants, the energy costs associated with microwave weed management would be comparable with chemical weed control.
Nano-optomechanical system based on microwave frequency surface acoustic waves
Tadesse, Semere Ayalew
Cavity optomechnics studies the interaction of cavity confined photons with mechanical motion. The emergence of sophisticated nanofabrication technology has led to experimental demonstrations of a wide range of novel optomechanical systems that exhibit strong optomechanical coupling and allow exploration of interesting physical phenomena. Many of the studies reported so far are focused on interaction of photons with localized mechanical modes. For my doctoral research, I did experimental investigations to extend this study to propagating phonons. I used surface travelling acoustic waves as the mechanical element of my optomechanical system. The optical cavities constitute an optical racetrack resonator and photonic crystal nanocavity. This dissertation discusses implementation of this surface acoustic wave based optomechanical system and experimental demonstrations of important consequences of the optomechanical coupling. The discussion focuses on three important achievements of the research. First, microwave frequency surface acoustic wave transducers were co-integrated with an optical racetrack resonator on a piezoelectric aluminum nitride film deposited on an oxidized silicon substrate. Acousto-optic modulation of the resonance modes at above 10 GHz with the acoustic wavelength significantly below the optical wavelength was achieved. The phase and modal matching conditions in this paradigm were investigated for efficient optmechanical coupling. Second, the optomechanical coupling was pushed further into the sideband resolved regime by integrating the high frequency surface acoustic wave transducers with a photonic crystal nanocavity. This device was used to demonstrate optomecahnically induced transparency and absorption, one of the interesting consequences of cavity optomechanics. Phase coherent interaction of the acoustic wave with multiple nanocavities was also explored. In a related experiment, the photonic crystal nanoscavity was placed inside an acoustic
Microwave absorption properties of gold nanoparticle doped polymers
DEFF Research Database (Denmark)
Jiang, Chenhui; Ouattara, Lassana; Ingrosso, Chiara
2011-01-01
This paper presents a method for characterizing microwave absorption properties of gold nanoparticle doped polymers. The method is based on on-wafer measurements at the frequencies from 0.5GHz to 20GHz. The on-wafer measurement method makes it possible to characterize electromagnetic (EM) property...... of small volume samples. The epoxy based SU8 polymer and SU8 doped with gold nanoparticles are chosen as the samples under test. Two types of microwave test devices are designed for exciting the samples through electrical coupling and magnetic coupling, respectively. Measurement results demonstrate...... that the nanocomposites absorb a certain amount of microwave energy due to gold nanoparticles. Higher nanoparticle concentration results in more significant absorption effect....
Microwave absorption properties of gold nanoparticle doped polymers
Jiang, C.; Ouattara, L.; Ingrosso, C.; Curri, M. L.; Krozer, V.; Boisen, A.; Jakobsen, M. H.; Johansen, T. K.
2011-03-01
This paper presents a method for characterizing microwave absorption properties of gold nanoparticle doped polymers. The method is based on on-wafer measurements at the frequencies from 0.5 GHz to 20 GHz. The on-wafer measurement method makes it possible to characterize electromagnetic (EM) property of small volume samples. The epoxy based SU8 polymer and SU8 doped with gold nanoparticles are chosen as the samples under test. Two types of microwave test devices are designed for exciting the samples through electrical coupling and magnetic coupling, respectively. Measurement results demonstrate that the nanocomposites absorb a certain amount of microwave energy due to gold nanoparticles. Higher nanoparticle concentration results in more significant absorption effect.
International Nuclear Information System (INIS)
Li, D.J.; Luk, K.H.; Jiang, H.B.; Chou, C.K.; Hwang, G.Z.
1984-01-01
The construction of a modified coaxial cable as an intracavitary microwave applicator suitable for use in some vaginal and rectal cancers is presented. Thermometry is performed for microwave frequencies of 300, 400, 650, and 915 MHz. Temperature profiles in tissue phantoms were obtained with Vitek 101 temperature probes and thermography, and the data were compared with those obtained in dogs. The temperature profiles are dependent on the frequency of the microwaves and the insertion depth of the applicator. In addition, a lucite cylindrical spacer external to the applicator also altered the heating pattern. Therefore, with proper combinations of frequency, insertion depth, and spacer, the applicator can be used for heating tumors in some clinical situations. Two patients were treated with this intracavitary microwave applicator in conjunction with interstitial radiation therapy. Tolerance to such combined therapy was satisfactory in these preliminary trial treatments
Energy Technology Data Exchange (ETDEWEB)
Lung, Ildikó [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Soran, Maria-Loredana, E-mail: loredana.soran@itim-cj.ro [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Opriş, Ocsana; Truşcă, Mihail Radu Cătălin [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Niinemets, Ülo [Institute of Agricultural and Environmental Sciences, Estonian University of Life Sciences, 1 Kreutzwaldi Street, Tartu 51014 (Estonia); Copolovici, Lucian [Institute of Agricultural and Environmental Sciences, Estonian University of Life Sciences, 1 Kreutzwaldi Street, Tartu 51014 (Estonia); Institute of Technical and Natural Sciences Research-Development of “Aurel Vlaicu” University, 2 Elena Drăgoi Street, Arad 310330 (Romania)
2016-11-01
Exposure to sustained low intensity microwaves can constitute a stress for the plants, but its effects on plant secondary chemistry are poorly known. We studied the influence of GSM and WLAN-frequency microwaves on emissions of volatile organic compounds and content of essential oil in the aromatic plant Ocimum basilicum L. hypothesizing that microwave exposure leads to enhanced emissions of stress volatiles and overall greater investment in secondary compounds. Compared to the control plants, microwave irradiation led to decreased emissions of β-pinene, α-phellandrene, bornyl acetate, β-myrcene, α-caryophyllene and benzaldehyde, but increased emissions of eucalyptol, estragole, caryophyllene oxide, and α-bergamotene. The highest increase in emission, 21 times greater compared to control, was observed for caryophyllene oxide. The irradiation resulted in increases in the essential oil content, except for the content of phytol which decreased by 41% in the case of GSM-frequency, and 82% in the case of WLAN-frequency microwave irradiation. The strongest increase in response to WLAN irradiation, > 17 times greater, was observed for hexadecane and octane contents. Comparisons of volatile compositions by multivariate analyses demonstrated a clear separation of different irradiance treatments, and according to the changes in the volatile emissions, the WLAN-frequency irradiation represented a more severe stress than the GSM-frequency irradiation. Overall, these results demonstrating important modifications in the emission rates, essential oil content and composition indicate that microwave irradiation influences the quality of herbage of this economically important spice plant. - Highlights: • Microwave irradiation represents a stress for the plants. • Microwave exposure leads to enhanced emissions of stress volatiles. • O. basilicum irradiation with microwaves increases the essential oil content. • Microwave pollution can constitute a threat to the
International Nuclear Information System (INIS)
Lung, Ildikó; Soran, Maria-Loredana; Opriş, Ocsana; Truşcă, Mihail Radu Cătălin; Niinemets, Ülo; Copolovici, Lucian
2016-01-01
Exposure to sustained low intensity microwaves can constitute a stress for the plants, but its effects on plant secondary chemistry are poorly known. We studied the influence of GSM and WLAN-frequency microwaves on emissions of volatile organic compounds and content of essential oil in the aromatic plant Ocimum basilicum L. hypothesizing that microwave exposure leads to enhanced emissions of stress volatiles and overall greater investment in secondary compounds. Compared to the control plants, microwave irradiation led to decreased emissions of β-pinene, α-phellandrene, bornyl acetate, β-myrcene, α-caryophyllene and benzaldehyde, but increased emissions of eucalyptol, estragole, caryophyllene oxide, and α-bergamotene. The highest increase in emission, 21 times greater compared to control, was observed for caryophyllene oxide. The irradiation resulted in increases in the essential oil content, except for the content of phytol which decreased by 41% in the case of GSM-frequency, and 82% in the case of WLAN-frequency microwave irradiation. The strongest increase in response to WLAN irradiation, > 17 times greater, was observed for hexadecane and octane contents. Comparisons of volatile compositions by multivariate analyses demonstrated a clear separation of different irradiance treatments, and according to the changes in the volatile emissions, the WLAN-frequency irradiation represented a more severe stress than the GSM-frequency irradiation. Overall, these results demonstrating important modifications in the emission rates, essential oil content and composition indicate that microwave irradiation influences the quality of herbage of this economically important spice plant. - Highlights: • Microwave irradiation represents a stress for the plants. • Microwave exposure leads to enhanced emissions of stress volatiles. • O. basilicum irradiation with microwaves increases the essential oil content. • Microwave pollution can constitute a threat to the
Multiband rectenna for microwave applications
Okba, Abderrahim; Takacs, Alexandru; Aubert, Hervé; Charlot, Samuel; Calmon, Pierre-François
2017-02-01
This paper reports a multiband rectenna (rectifier + antenna) suitable for the electromagnetic energy harvesting of the spill-over loss of microwave antennas placed on board of geostationary satellites. Such rectenna is used for powering autonomous wireless sensors for satellite health monitoring. The topology of the rectenna is presented. The experimental results demonstrate that the proposed compact rectenna can harvest efficiently the incident electromagnetic energy at three different frequencies that are close to the resonant frequencies of the cross-dipoles implemented in the antenna array. xml:lang="fr"
Ceramic-glass-metal seal by microwave heating
Meek, Thomas T.; Blake, Rodger D.
1985-01-01
A method for producing a ceramic-glass-metal seal by microwaving mixes a slurry of glass sealing material and coupling agent and applies same to ceramic and metal workpieces. The slurry and workpieces are then insulated and microwaved at a power, time and frequency sufficient to cause a liquid phase reaction in the slurry. The reaction of the glass sealing material forms a chemically different seal than that which would be formed by conventional heating because it is formed by diffusion rather than by wetting of the reactants.
Breakdown simulations in a focused microwave beam within the simplified model
International Nuclear Information System (INIS)
Semenov, V. E.; Rakova, E. I.; Glyavin, M. Yu.; Nusinovich, G. S.
2016-01-01
The simplified model is proposed to simulate numerically air breakdown in a focused microwave beam. The model is 1D from the mathematical point of view, but it takes into account the spatial non-uniformity of microwave field amplitude along the beam axis. The simulations are completed for different frequencies and different focal lengths of microwave beams. The results demonstrate complicated regimes of the breakdown evolution which represents a series of repeated ionization waves. These waves start at the focal point and propagate towards incident microwave radiation. The ionization wave parameters vary during propagation. At relatively low frequencies, the propagation regime of subsequent waves can also change qualitatively. Each next ionization wave is less pronounced than the previous one, and the breakdown evolution approaches the steady state with relatively small plasma density. The ionization wave parameters are sensitive to the weak source of external ionization, but the steady state is independent on such a source. As the beam focal length decreases, the stationary plasma density increases and the onset of the steady state occurs faster.
Evaluation of DNA damage using microwave dielectric absorption spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Hirayama, Makoto; Matuo, Youichrou; Izumi, Yoshinobu [Research Institute of Nuclear Engineering, University of Fukui, Fukui (Japan); Sunagawa, Takeyoshi [Fukui University of Technology, Fukui (Japan)
2016-12-15
Evaluation of deoxyribonucleic acid (DNA)-strand break is important to elucidate the biological effect of ionizing radiations. The conventional methods for DNA-strand break evaluation have been achieved by Agarose gel electrophoresis and others using an electrical property of DNAs. Such kinds of DNA-strand break evaluation systems can estimate DNA-strand break, according to a molecular weight of DNAs. However, the conventional method needs pre-treatment of the sample and a relatively long period for analysis. They do not have enough sensitivity to detect the strand break products in the low-dose region. The sample is water, methanol and plasmid DNA solution. The plasmid DNA pUC118 was multiplied by using Escherichia coli JM109 competent cells. The resonance frequency and Q-value were measured by means of microwave dielectric absorption spectroscopy. When a sample is located at a center of the electric field, resonance curve of the frequency that existed as a standing wave is disturbed. As a result, the perturbation effect to perform a resonance with different frequency is adopted. The resonance frequency shifted to higher frequency with an increase in a concentration of methanol as the model of the biological material, and the Q-value decreased. The absorption peak in microwave power spectrum of the double-strand break plasmid DNA shifted from the non-damaged plasmid DNA. Moreover, the sharpness of absorption peak changed resulting in change in Q-value. We confirmed that a resonance frequency shifted to higher frequency with an increase in concentration of the plasmid DNA. We developed a new technique for an evaluation of DNA damage. In this paper, we report the evaluation method of DNA damage using microwave dielectric absorption spectroscopy.
Evaluation of DNA damage using microwave dielectric absorption spectroscopy
International Nuclear Information System (INIS)
Hirayama, Makoto; Matuo, Youichrou; Izumi, Yoshinobu; Sunagawa, Takeyoshi
2016-01-01
Evaluation of deoxyribonucleic acid (DNA)-strand break is important to elucidate the biological effect of ionizing radiations. The conventional methods for DNA-strand break evaluation have been achieved by Agarose gel electrophoresis and others using an electrical property of DNAs. Such kinds of DNA-strand break evaluation systems can estimate DNA-strand break, according to a molecular weight of DNAs. However, the conventional method needs pre-treatment of the sample and a relatively long period for analysis. They do not have enough sensitivity to detect the strand break products in the low-dose region. The sample is water, methanol and plasmid DNA solution. The plasmid DNA pUC118 was multiplied by using Escherichia coli JM109 competent cells. The resonance frequency and Q-value were measured by means of microwave dielectric absorption spectroscopy. When a sample is located at a center of the electric field, resonance curve of the frequency that existed as a standing wave is disturbed. As a result, the perturbation effect to perform a resonance with different frequency is adopted. The resonance frequency shifted to higher frequency with an increase in a concentration of methanol as the model of the biological material, and the Q-value decreased. The absorption peak in microwave power spectrum of the double-strand break plasmid DNA shifted from the non-damaged plasmid DNA. Moreover, the sharpness of absorption peak changed resulting in change in Q-value. We confirmed that a resonance frequency shifted to higher frequency with an increase in concentration of the plasmid DNA. We developed a new technique for an evaluation of DNA damage. In this paper, we report the evaluation method of DNA damage using microwave dielectric absorption spectroscopy
International Nuclear Information System (INIS)
Chen Yajie; Gao Jinsheng; Vittoria, C; Harris, V G; Heiman, D
2010-01-01
Microwave magnetoelectric coupling in a ferroelectric/ferromagnetic/semiconductor multiferroic (MF) heterostructure, consisting of a Co 2 MnAl epitaxial film grown on a GaAs substrate bonded to a lead magnesium niobate-lead titanate (PMN-PT) crystal, is reported. Ferromagnetic resonance measurements were carried out at X-band under the application of electric fields. Results indicate a frequency tuning of 125 MHz for electric field strength of 8 kV cm -1 resulting in a magnetoelectric coupling coefficient of 3.4 Oe cm kV -1 . This work explores the potential of electronically controlled MF devices for use in future monolithic microwave integrated circuits.
Valdez, A.
2000-01-01
This is the Engineering Test Report, Radiated Emissions and SARR, SARP, DCS Receivers, Link Frequencies EMI Sensitive Band Test Results, AMSU-A1, S/N 109, for the Integrated Advanced Microwave Sounding Unit-A (AMSU-A).
Cosmic microwave background science at commercial airline altitudes
Feeney, Stephen M.; Gudmundsson, Jon E.; Peiris, Hiranya V.; Verde, Licia; Errard, Josquin
2017-07-01
Obtaining high-sensitivity measurements of degree-scale cosmic microwave background (CMB) polarization is the most direct path to detecting primordial gravitational waves. Robustly recovering any primordial signal from the dominant foreground emission will require high-fidelity observations at multiple frequencies, with excellent control of systematics. We explore the potential for a new platform for CMB observations, the Airlander 10 hybrid air vehicle, to perform this task. We show that the Airlander 10 platform, operating at commercial airline altitudes, is well suited to mapping frequencies above 220 GHz, which are critical for cleaning CMB maps of dust emission. Optimizing the distribution of detectors across frequencies, we forecast the ability of Airlander 10 to clean foregrounds of varying complexity as a function of altitude, demonstrating its complementarity with both existing (Planck) and ongoing (C-BASS) foreground observations. This novel platform could play a key role in defining our ultimate view of the polarized microwave sky.
Cryogenic microwave channelized receiver
International Nuclear Information System (INIS)
Rauscher, C.; Pond, J.M.; Tait, G.B.
1996-01-01
The channelized receiver being presented demonstrates the use of high temperature superconductor technology in a microwave system setting where superconductor, microwave-monolithic-integrated-circuit, and hybrid-integrated-circuit components are united in one package and cooled to liquid-nitrogen temperatures. The receiver consists of a superconducting X-band four-channel demultiplexer with 100-MHz-wide channels, four commercial monolithically integrated mixers, and four custom-designed hybrid-circuit detectors containing heterostructure ramp diodes. The composite receiver unit has been integrated into the payload of the second-phase NRL high temperature superconductor space experiment (HTSSE-II). Prior to payload assembly, the response characteristics of the receiver were measured as functions of frequency, temperature, and drive levels. The article describes the circuitry, discusses the key issues related to design and implementation, and summarizes the experimental results
Removal of concrete layers from biological shields by microwaves
International Nuclear Information System (INIS)
Wace, P.F.; Harker, A.H.; Hills, D.L.
1990-01-01
A comprehensive literature review has been carried out, to provide information for an experimental programme and equipment design. Mathematical modelling of the microwave and power fields in a concrete block, both steel reinforced and unreinforced, subjected to a microwave attack at two frequencies, has been carried out and estimates of the likely temperature rise with time obtained. A method of launching microwaves into concrete has been established from theoretical considerations and from the findings of the literature review. Equipment for laboratory trials has been designed and assembled using an 896 MHz, 25 kW microwave generator. Reinforced concrete blocks, 0.6 m in dimension and representing the concrete in a Magnox reactor biological shield, have been attacked at different power levels and the surface removed to the depth of the reinforcing steel (100 mm). Outline proposals for the design of a remotely operated prototype microwave machine for stripping the surface of large concrete test panels have been prepared. (author)
Development of a long-slot microwave plasma source
Energy Technology Data Exchange (ETDEWEB)
Kuwata, Y., E-mail: euo1304@mail4.doshisha.ac.jp; Kasuya, T.; Miyamoto, N.; Wada, M. [Graduate School of Science and Engineering, Doshisha University, Kyotanabe, Kyoto 610-0321 (Japan)
2016-02-15
A 20 cm long 10 cm wide microwave plasma source was realized by inserting two 20 cm long 1.5 mm diameter rod antennas into the plasma. Plasma luminous distributions around the antennas were changed by magnetic field arrangement created by permanent magnets attached to the source. The distributions appeared homogeneous in one direction along the antenna when the spacing between the antenna and the source wall was 7.5 mm for the input microwave frequency of 2.45 GHz. Plasma density and temperature at a plane 20 cm downstream from the microwave shield were measured by a Langmuir probe array at 150 W microwave power input. The measured electron density and temperature varied over space from 3.0 × 10{sup 9} cm{sup −3} to 5.8 × 10{sup 9} cm{sup −3}, and from 1.1 eV to 2.1 eV, respectively.
Sideband-cooling of trapped ytterbium-ions in the microwave regime
International Nuclear Information System (INIS)
Scharfenberger, Benedikt J.
2012-01-01
Trapped ions in a Paul trap are at present one of the most promising candidates for Quantum Information Processing (QIP). The technique that is used for this purpose in this experiment was introduced in 2001 by F. Mintert and Ch. Wunderlich. The core of this method is the use of atomic transitions in the radio- or microwave region, while a magnetic field gradient along the trap axis (where the ion chain is situated) lifts the degeneracy of the transition frequencies, such that the ions can be distinguished in frequency space; it also serves for the coupling of internal and external degrees of freedom of the ion chain. This method is called MAGIC (MAgnetic Gradient Induced Coupling). The performance of the measurements required that the apparatus of the experiment, which consists of laser sources, lambdameter, vacuum- and microwave system as well as imaging- and detection-units, had to be assembled and tested, which was an important prerequisite for the successful performance of the here described experiments. For the experiments it is advantageous to prepare the ions in an energetic state close to the motional ground state, which contributes to a reduction of the dephasing of the system while manipulating it with microwaves. By using the sideband-cooling technique to the sub-Doppler regime it is taken advantage of the fact, that ions in a linear trap are in good approximation situated in a harmonic oscillator potential and can therefore only populate discrete vibrational energy levels, whose frequency difference is given by the axial trap frequency ω z . If the system is excited by a microwave, which frequency is detuned from resonance to lower energies by a vibrational quantum, the ion looses one such phonon within each cooling-cycle. When this cycle is driven several times, the average phonon number and thus the temperature of the ion can be reduced efficiently and the ion can be initialized in a state close to the motional ground state. As sideband
Megha, Kanu; Deshmukh, Pravin Suryakantrao; Banerjee, Basu Dev; Tripathi, Ashok Kumar; Ahmed, Rafat; Abegaonkar, Mahesh Pandurang
2015-12-01
Over the past decade people have been constantly exposed to microwave radiation mainly from wireless communication devices used in day to day life. Therefore, the concerns over potential adverse effects of microwave radiation on human health are increasing. Until now no study has been proposed to investigate the underlying causes of genotoxic effects induced by low intensity microwave exposure. Thus, the present study was undertaken to determine the influence of low intensity microwave radiation on oxidative stress, inflammatory response and DNA damage in rat brain. The study was carried out on 24 male Fischer 344 rats, randomly divided into four groups (n=6 in each group): group I consisted of sham exposed (control) rats, group II-IV consisted of rats exposed to microwave radiation at frequencies 900, 1800 and 2450 MHz, specific absorption rates (SARs) 0.59, 0.58 and 0.66 mW/kg, respectively in gigahertz transverse electromagnetic (GTEM) cell for 60 days (2h/day, 5 days/week). Rats were sacrificed and decapitated to isolate hippocampus at the end of the exposure duration. Low intensity microwave exposure resulted in a frequency dependent significant increase in oxidative stress markers viz. malondialdehyde (MDA), protein carbonyl (PCO) and catalase (CAT) in microwave exposed groups in comparison to sham exposed group (pmicrowave exposed groups (pmicrowave exposed animal (pmicrowave exposed groups as compared to their corresponding values in sham exposed group (pmicrowave radiation induces oxidative stress, inflammatory response and DNA damage in brain by exerting a frequency dependent effect. The study also indicates that increased oxidative stress and inflammatory response might be the factors involved in DNA damage following low intensity microwave exposure. Copyright © 2015 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Ting, T.H.; Jau, Y.N.; Yu, R.P.
2012-01-01
Polyaniline/multi-walled carbon nanotube (PANI/MWNT) composites were synthesized using in situ polymerization at different aniline/multi-walled carbon nanotube weight ratios (Ani/MWNT = 1/2, 1/1, 2/1 and 3/1) and introduced into an epoxy resin to act as a microwave absorber. The spectroscopic characterization of the process of formation of PANI/MWNT composites were studied using Fourier transform infrared spectroscopy, an ultraviolet-visible spectrophotometer, X-ray diffraction, scanning electron microscopy, transmission electron microscopy and electron spin resonance. The microwave absorbing properties were investigated by measuring complex permittivity, complex permeability and reflection loss in the 2-18 and 18-40 GHz microwave frequency range, using the free space method. The results showed that the addition of PANI was useful for achieving a large absorption over a wide frequency range, especially for higher frequency values.
International Nuclear Information System (INIS)
Tuca, Silviu-Sorin; Gramse, Georg; Kasper, Manuel; Oh, Yoo Jin; Zhu, Rong; Hinterdorfer, Peter; Badino, Giorgio; Brinciotti, Enrico; Rankl, Christian; Kienberger, Ferry
2016-01-01
The application of scanning microwave microscopy (SMM) to extract calibrated electrical properties of cells and bacteria in air is presented. From the S _1_1 images, after calibration, complex impedance and admittance images of Chinese hamster ovary cells and E. coli bacteria deposited on a silicon substrate have been obtained. The broadband capabilities of SMM have been used to characterize the bio-samples between 2 GHz and 20 GHz. The resulting calibrated cell and bacteria admittance at 19 GHz were Y _c_e_l_l = 185 μS + j285 μS and Y _b_a_c_t_e_r_i_a = 3 μS + j20 μS, respectively. A combined circuitry-3D finite element method EMPro model has been developed and used to investigate the frequency response of the complex impedance and admittance of the SMM setup. Based on a proposed parallel resistance–capacitance model, the equivalent conductance and parallel capacitance of the cells and bacteria were obtained from the SMM images. The influence of humidity and frequency on the cell conductance was experimentally studied. To compare the cell conductance with bulk water properties, we measured the imaginary part of the bulk water loss with a dielectric probe kit in the same frequency range resulting in a high level of agreement. (paper)
Walker, Samantha; Sierra, Carlos E.; Austermann, Jason Edward; Beall, James; Becker, Dan; Dober, Bradley; Duff, Shannon; Hilton, Gene; Hubmayr, Johannes; Van Lanen, Jeffrey L.; McMahon, Jeff; Simon, Sara M.; Ullom, Joel; Vissers, Michael R.; NIST Quantum Sensors Group
2018-06-01
Observations of the cosmic microwave background (CMB) provide a powerful tool for probing the earliest moments of the universe and therefore have the potential to transform our understanding of cosmology. In particular, precision measurements of its polarization can reveal the existence of gravitational waves produced during cosmic inflation. However, these observations are complicated by the presence of astrophysical foregrounds, which may be separated by using broad frequency coverage, as the spectral energy distribution between foregrounds and the CMB is distinct. For this purpose, we are developing large-bandwidth, feedhorn-coupled transition-edge-sensor (TES) arrays that couple polarized light from waveguide to superconducting microstrip by use of a symmetric, planar orthomode transducer (OMT). In this work, we describe two types of pixels, an ultra-high frequency (UHF) design, which operates from 195 GHz-315 GHz, and an extended ultra-high frequency (UHF++) design, which operates from 195 GHz-420 GHz, being developed for next generation CMB experiments that will come online in the next decade, such as CCAT-prime and the Simons Observatory. We present the designs, simulation results, fabrication, and preliminary measurements of these prototype pixels.
Critical current fluctuation in a microwave-driven Josephson junction
International Nuclear Information System (INIS)
Dong Ning; Sun Guozhu; Wang Yiwen; Cao Junyu; Yu Yang; Chen Jian; Kang Lin; Xu Weiwei; Han Siyuan; Wu Peiheng
2007-01-01
Josephson junction devices are good candidates for quantum computation. A large energy splitting was observed in the spectroscopy of a superconducting Josephson junction. The presence of the critical current fluctuation near the energy splitting indicated coupling between the junction and a two-level system. Furthermore, we find that this fluctuation is microwave dependent. It only appears at certain microwave frequency. This relation suggested that the decoherence of qubits is influenced by the necessary computing operations
Skin effect of microwaves and transverse pseudowaves in plasmas
International Nuclear Information System (INIS)
Minami, Kazuo
1977-09-01
Using linearized Vlasov-Maxwell equations, the skin effect of microwaves and transverse pseudowaves excited by an idealized grid antenna in plasmas are analyzed. It is shown that the latter is predominant over the former, in such a plasma that ω sub(p) v sub(t)/ωc >= 1, where ω sub(p) and ω are the plasma and microwave angular frequencies, v sub(t) and c are the electron thermal and light velocities, respectively. (auth.)
Trapped Ion Oscillation Frequencies as Sensors for Spectroscopy
Directory of Open Access Journals (Sweden)
Wilfried Nörtershäuser
2010-03-01
Full Text Available The oscillation frequencies of charged particles in a Penning trap can serve as sensors for spectroscopy when additional field components are introduced to the magnetic and electric fields used for confinement. The presence of so-called “magnetic bottles” and specific electric anharmonicities creates calculable energy-dependences of the oscillation frequencies in the radiofrequency domain which may be used to detect the absorption or emission of photons both in the microwave and optical frequency domains. The precise electronic measurement of these oscillation frequencies therefore represents an optical sensor for spectroscopy. We discuss possible applications for precision laser and microwave spectroscopy and their role in the determination of magnetic moments and excited state lifetimes. Also, the trap-assisted measurement of radiative nuclear de-excitations in the X-ray domain is discussed. This way, the different applications range over more than 12 orders of magnitude in the detectable photon energies, from below μeV in the microwave domain to beyond MeV in the X-ray domain.
Package Holds Five Monolithic Microwave Integrated Circuits
Mysoor, Narayan R.; Decker, D. Richard; Olson, Hilding M.
1996-01-01
Packages protect and hold monolithic microwave integrated circuit (MMIC) chips while providing dc and radio-frequency (RF) electrical connections for chips undergoing development. Required to be compact, lightweight, and rugged. Designed to minimize undesired resonances, reflections, losses, and impedance mismatches.
Energy Technology Data Exchange (ETDEWEB)
François, B. [FEMTO-ST, CNRS, Université de Franche-Comté, 26 chemin de l’Epitaphe, 25030 Besançon (France); INRIM, Strada delle Cacce 91, 10135 Torino (Italy); Calosso, C. E.; Micalizio, S. [INRIM, Strada delle Cacce 91, 10135 Torino (Italy); Abdel Hafiz, M.; Boudot, R. [FEMTO-ST, CNRS, Université de Franche-Comté, 26 chemin de l’Epitaphe, 25030 Besançon (France)
2015-09-15
We report on the development and characterization of novel 4.596 GHz and 6.834 GHz microwave frequency synthesizers devoted to be used as local oscillators in high-performance Cs and Rb vapor-cell atomic clocks. The key element of the synthesizers is a custom module that integrates a high spectral purity 100 MHz oven controlled quartz crystal oscillator frequency-multiplied to 1.6 GHz with minor excess noise. Frequency multiplication, division, and mixing stages are then implemented to generate the exact output atomic resonance frequencies. Absolute phase noise performances of the output 4.596 GHz signal are measured to be −109 and −141 dB rad{sup 2}/Hz at 100 Hz and 10 kHz Fourier frequencies, respectively. The phase noise of the 6.834 GHz signal is −105 and −138 dB rad{sup 2}/Hz at 100 Hz and 10 kHz offset frequencies, respectively. The performances of the synthesis chains contribute to the atomic clock short term fractional frequency stability at a level of 3.1 × 10{sup −14} for the Cs cell clock and 2 × 10{sup −14} for the Rb clock at 1 s averaging time. This value is comparable with the clock shot noise limit. We describe the residual phase noise measurements of key components and stages to identify the main limitations of the synthesis chains. The residual frequency stability of synthesis chains is measured to be at the 10{sup −15} level for 1 s integration time. Relevant advantages of the synthesis design, using only commercially available components, are to combine excellent phase noise performances, simple-architecture, low-cost, and to be easily customized for signal output generation at 4.596 GHz or 6.834 GHz for applications to Cs or Rb vapor-cell frequency standards.
Simplified atom trap using a single microwave modulated diode laser
International Nuclear Information System (INIS)
Newbury, N.R.; Myatt, C.J.; Wieman, C.E.
1993-01-01
We have demonstrated microwave modulation of a diode laser which is operated with optical feedback from a diffraction grating. By directly modulating the diode laser current at frequencies up to 6.8 GHz, we observed 2-30% of the laser power in a single sideband for 20mW of microwave power. Using such a diode laser modulated at 6.6GHz, we have trapped 87 Rb in a vapor cell. With 10mW of microwave power, the number of trapped atoms was only 15% smaller than the number obtained using two lasers in the conventional manner. A microwave modulated diode laser should also be useful for driving stimulated Raman transitions between the hyperfine levels of Rb or Cs
Spectrum of density turbulence measured by microwave reflectometer
International Nuclear Information System (INIS)
Ding Xuantong; Cao Janyong; Xu Deming; Zhang Hongying; Yang Qinwei
1993-01-01
The principle of measuring lower frequency density turbulence with microwave reflectometer is presented. Preliminary results from the HL-1 tokamak have been obtained and compared with the results measured by means of electrostatic probe
Influence of voltage rise time on microwave generation in relativistic backward wave oscillator
International Nuclear Information System (INIS)
Wu, Ping; Deng, Yuqun; Sun, Jun; Teng, Yan; Shi, Yanchao; Chen, Changhua
2015-01-01
In relativistic backward wave oscillators (RBWOs), although the slow wave structure (SWS) and electron beam determine the main characteristics of beam-wave interaction, many other factors can also significantly affect the microwave generation process. This paper investigates the influence of voltage rise time on beam-wave interaction in RBWOs. Preliminary analysis and PIC simulations demonstrate if the voltage rise time is moderately long, the microwave frequency will gradually increase during the startup process until the voltage reaches its amplitude, which can be explained by the dispersion relation. However, if the voltage rise time is long enough, the longitudinal resonance of the finitely-long SWS will force the RBWO to work with unwanted longitudinal modes for a while and then gradually hop to the wanted longitudinal mode, and this will lead to an impure microwave frequency spectrum. Besides, a longer voltage rise time will delay the startup process and thus lead to a longer microwave saturation time. And if unwanted longitudinal modes are excited due to long voltage rise time, the microwave saturation time will be further lengthened. Therefore, the voltage rise time of accelerators adopted in high power microwave technology should not be too long in case unwanted longitudinal modes are excited
RF Testing Of Microwave Integrated Circuits
Romanofsky, R. R.; Ponchak, G. E.; Shalkhauser, K. A.; Bhasin, K. B.
1988-01-01
Fixtures and techniques are undergoing development. Four test fixtures and two advanced techniques developed in continuing efforts to improve RF characterization of MMIC's. Finline/waveguide test fixture developed to test submodules of 30-GHz monolithic receiver. Universal commercially-manufactured coaxial test fixture modified to enable characterization of various microwave solid-state devices in frequency range of 26.5 to 40 GHz. Probe/waveguide fixture is compact, simple, and designed for non destructive testing of large number of MMIC's. Nondestructive-testing fixture includes cosine-tapered ridge, to match impedance wavequide to microstrip. Advanced technique is microwave-wafer probing. Second advanced technique is electro-optical sampling.
Photoinduced spin polarization and microwave technology
International Nuclear Information System (INIS)
Antipov, Sergey; Poluektov, Oleg; Schoessow, Paul; Kanareykin, Alexei; Jing, Chunguang
2013-01-01
We report here on studies of optically pumped active microwave media based on various fullerene derivatives, with an emphasis on the use of these materials in microwave electronics. We have investigated a class of optically excited paramagnetic materials that demonstrate activity in the X-band as candidate materials. We found that a particular fullerene derivative, Phenyl-C 61 -butyric acid methyl ester (PCBM), produced the largest electron paramagnetic resonance (EPR) emission signal compared to other organic compounds that have been suggested for use as microwave active materials. We also studied the effects of concentration, temperature, solvent etc. on the activity of the material. In these experiments, EPR studies using a commercial spectrometer were followed up by measurements of an RF signal reflected from a resonator loaded with the PCBM-based material. The activity was directly demonstrated through the change in the quality factor and RF coupling between the resonator and waveguide feed. At the inception of these experiments the primary interest was the development of a microwave PASER. The PASER (particle acceleration by stimulated emission of radiation [1]) is a novel acceleration concept that is based on the direct energy transfer from an active medium to a charged particle beam. While the previous work on the PASER has emphasized operations at infrared or visible wavelengths, operating in the microwave regime has significant advantages in terms of the less stringent quality requirements placed on the electron beam provided an appropriate microwave active medium can be found. This paper is focused on our investigation of the possibility of a PASER operating in the microwave frequency regime [2] using active paramagnetic materials. While a high level of gain for PCBM was demonstrated compared to other candidate materials, dielectric losses and quenching effects were found to negatively impact its performance for PASER applications. We present results on
Valdez, A.
2000-01-01
This is the Engineering Test Report, Radiated Emissions and SARR, SARP, DCS Receivers, Link Frequencies EMI Sensitive Band Test Results, AMSU-A1 SIN 108, for the Integrated Advanced Microwave Sounding Unit-A (AMSU-A).
International Nuclear Information System (INIS)
Costa, J.E.R.
1983-01-01
It has been made a theoretical development, sel-consistent with recent models for the explosive source, applied to time delays of peak emission at different microwave frequencies, and between microwaves and hard X-ray emission. A working hipothesis has been assumed with the adoption of a growing magnetic field during the solar flare explosion, and therefore contributing to a growth in microwave emission, differential in frequency, producing delays of maximum emission towards lower microwave frequencies, and delays of microwave maximum emission with respect to hard X-rays. It has been found that these delays are consistent with a growth in the magnetic field of about 14% by assuming both thermal and non-thermal models. This variation in magnetic field has been associated to movements of thermal sources downwards in the solar atmosphere, and it has been found that the estimated velocities of displacement were consistent compared to characteristic velocities of anomalous conduction fronts of thermal models. (Author) [pt
Development of low-power loss Mn–Zn ferrites using microwave ...
Indian Academy of Sciences (India)
Unknown
sinusoidal voltage of 25 V with frequency, 1 MHz. The efficiency and surface rise of temperature of trans- former were found to be high and low, respectively. Keywords. Ferrites; microwave sintering; conventional sintering; power loss; hysteresis loss; eddy current loss; transformer; high frequency applications. 1. Introduction.
Microplasmas ignited and sustained by microwaves
International Nuclear Information System (INIS)
Hopwood, Jeffrey; Hoskinson, Alan R; Gregório, José
2014-01-01
The challenges and benefits of microwave-induced microdischarges are reviewed. Transmission lines, resonators and surface wave launchers may be used for coupling microwave power to very small plasmas. Fortunately, microplasmas are typically much smaller than the wavelength of microwaves, and the electromagnetic problem may be treated electrostatically within the plasma. It is possible to trap electrons within small discharge gaps if the amplitude of electron oscillation is smaller than the plasma size. Typically occurring above 0.3 GHz, this condition results in lower breakdown fields than are required by direct current or radio frequency systems. Trapping of electrons also decreases the electrode potential to only tens of volts and makes the plasma density invariant in time. The steady-state microplasma produces electron densities of up to 10 15 cm −3 in argon but the electrons are not in equilibrium with the low gas temperatures (500–1000 K). Microwave discharges are compared with other forms of microplasma and guidelines for device selection are recommended. Scale-up of microplasmas using array concepts are presented followed by some exciting new applications. (paper)
Development of microwave-enhanced spark-induced breakdown spectroscopy
International Nuclear Information System (INIS)
Ikeda, Yuji; Moon, Ahsa; Kaneko, Masashi
2010-01-01
We propose microwave-enhanced spark-induced breakdown spectroscopy with the same measurement and analysis processes as in laser-induced breakdown spectroscopy, but with a different plasma generation mechanism. The size and lifetime of the plasma generated can contribute to increased measurement accuracy and expand its applicability to industrial measurement, such as an exhaust gas analyzer for automobile engine development and its regulation, which has been hard to operate by laser at an engineering evaluation site. The use of microwaves in this application helps lower the cost, reduce the system size, and increase the ease of operation to make it commercially viable. A microwave frequency of 2.45 GHz was used to enhance the volume and lifetime of the plasma at atmospheric condition even at elevated pressure.
Study of mode locking in a microwave-pumped diode laser close to the generation threshold
International Nuclear Information System (INIS)
Bagaev, Sergei N; Zakharyash, Valerii F; Kashirsky, Aleksandr V; Klementyev, Vasilii M; Kuznetsov, Sergei A; Pivtsov, V S
2004-01-01
Active mode locking is studied in a diode laser with a three-mirror resonator upon the microwave modulation of the pump current. The mode-locking region with the minimal width of the spectrum of intermode beats is found, when the microwave frequency is close to the intermode frequency of an external resonator. This region is shown to be located close to the threshold pump current. (lasers, active media)
Sato, Kiminori; Umeno, Hirohito; Nakashima, Tadashi
2010-01-01
This study aims to clarify the role of the maculae flavae (MFe) during growth and development of the human vocal fold mucosa (VFM). Our current results concerning the MFe in the human newborn, infant, and child VFM are summarized. Newborns already had immature MFe at the same sites as adults. They were composed of dense masses of vocal fold stellate cells (VFSCs), whereas extracellular matrix components were sparse. VFSCs in the newborn MFe had already started synthesizing extracellular matrices (EM). During infancy, the EM synthesized in the MFe appeared in the VFM to initiate the formation of the three-dimensional extracellular matrix structure of the human VFM. During childhood, MFe including VFSCs continued to synthesize EM such as collagenous, reticular, and elastic fibers, and hyaluronic acid (glycosaminoglycan), which are essential for the human VFM as a vibrating tissue. The MFe in newborns, infants and children were related to the growth and development of the human VFM. Human MFe including VFSCs were inferred to be involved in the metabolism of EM, essential for the viscoelasticity of the human VFM, and are considered to be an important structure in the growth and development of the human VFM. Copyright © 2010 S. Karger AG, Basel.
Valdez, A.
2000-01-01
This is the Engineering Test Report, Radiated Emissions and SARR, SARP, DCS Receivers, Link Frequencies EMI Sensitive Band Test Results, AMSU-A2, S/N 108, for the Integrated Advanced Microwave Sounding Unit-A (AMSU-A).
A measurement of the low frequency spectrum of the cosmic microwave background radiation
International Nuclear Information System (INIS)
Levin, S.M.
1987-04-01
As part of a larger effort to measure the spectrum of the Cosmic Background Radiation (CBR) at low frequencies, the intensity of the CBR has been measured at a frequency of 1.410 GHz. The measurement was made by comparing the power received from the sky with the power received from a specially designed cooled calibration target with known properties. Sources of radiation other than the CBR were then identified and subtracted to calculate the antenna temperature of the CBR at 1.410 GHz. The instrument used to measure the CBR was a total-power microwave radiometer with a 25 MHz bandwidth centered at 1.410 GHz. The radiometer had a noise temperature of 80 K, and sufficient data were taken that radiometer noise did not contribute significantly to the total measurement error. The sources of error were predominantly systematic in nature, and the largest error was due to uncertainty in the reflection characteristics of the cold-load calibrator. Identification and subtraction of signals from the Galaxy (0.7 K) and the Earth's atmosphere (0.8 K) were also significant parts of the data reduction and error analysis. The brightness temperature of the Cosmic Background Radiation at 1.410 GHz is 222. +- 0.55 Kelvin. The spectrum of the CBR, as determined by this measurement and other published results, is consistent with a blackbody spectrum of temperature 2.741 +- 0.016. Constraints on the amount by which the CBR spectrum deviates from Planck spectrum are used to place limits on energy releases early in the history of the universe. 55 refs., 25 figs., 8 tabs
Study of microwave emission from a dense plasma focus
International Nuclear Information System (INIS)
Gerdin, G.; Venneri, F.; Tanisi, M.
1985-01-01
Microwave emission was detected in a 12.5 kJ dense plasma focus, using microwave horns and detectors placed in various locations outside the device. The results show that the parallel plates connecting the focus to its capacitor banks act as antennas and transmission lines, rather than wave guides. Subsequent measurements were performed with a microwave detector (R-band) attached to the focus anode, directly looking into the coaxial gun region, allowing to restrict the microwave emitting region to the muzzle end of the focus. The microwave frequency spectrum, determined with a time of flight detection system, strongly suggests the lower hybrid instability as the driving mechanism of the emissions. Comparing the time sequence of the emissions with those of other observable phenomena in the focus, a model was developed, to explain the possible relationship between the generation of microwave radiation and turbulence induced resistivity in the focus pinch. According to the model, microwaves and enhanced resistivity are caused by current driven instabilities occurring in the current sheath produced at the outer boundary of the pinch during the initial compression phase. Comparisons of the model predictions with observed experimental results are presented, including time resolved measurements of the pinch resistivity
Application of Microwave Remote Sensing to Dynamic Testing of Stay-Cables
Directory of Open Access Journals (Sweden)
Carmelo Gentile
2009-12-01
Full Text Available Recent advances in radar techniques and systems have favoured the development of microwave interferometers, suitable for the non-contact vibration monitoring of large structures. The paper addresses the application of microwave remote sensing to the measurement of the vibration response in the stay-cables of cable-stayed bridges. The reliability and accuracy of the proposed technique were investigated by comparing the natural frequencies (and the cable tensions predicted from natural frequencies identified from radar data and the corresponding quantities obtained using more conventional techniques. The investigation, carried out on the cables of two different cable-stayed bridges, clearly highlights: (a the accuracy of the results provided by the microwave remote sensing; (b the simplicity of use of the radar technique (especially when compared with conventional approaches and its effectiveness to simultaneously measuring the dynamic response of all the stay-cables of an array.
Radiation-hardened microwave communications system
Smith, S. F.; Bible, D. W.; Crutcher, R. I.; Hannah, J. H.; Moore, J. A.; Nowlin, C. H.; Vandermolen, R. I.; Chagnot, D.; Leroy, A.
1993-03-01
To develop a wireless communication system to meet the stringent requirements for a nuclear hot cell and similar environments, including control of advanced servomanipulators, a microwave signal transmission system development program was established to produce a demonstration prototype for the Consolidated Fuel Reprocessing Program at Oak Ridge National Laboratory (ORNL). Proof-of-principle tests in a partially metal lined enclosure at ORNL successfully demonstrated the feasibility of directed microwave signal transmission techniques for remote systems applications. The potential for much more severe radio-frequency (RF) multipath propagation conditions in fully metal lined cells led to a programmatic decision to conduct additional testing in more typical hot-cell environments at other sites. Again, the test results were excellent. Based on the designs of the earlier systems, an advanced microwave signal transmission system configuration was subsequently developed that, in highly reflective environments, will support both high-performance video channels and high baud-rate digital data links at total gamma dose tolerance levels exceeding 10(exp 7) rads and at elevated ambient temperatures.
Radiation-hardened microwave communications system
International Nuclear Information System (INIS)
Smith, S.F.; Bible, D.W.; Crutcher, R.I.; Hannah, J.H.; Moore, J.A.; Nowlin, C.H.; Vandermolen, R.I.; Chagnot, D.; LeRoy, A.
1993-01-01
To develop a wireless communication system to meet the stringent requirements for a nuclear hot cell and similar environments, including control of advanced servomanipulators, a microwave signal transmission system development program was established to produce a demonstration prototype for the Consolidated Fuel Reprocessing Program at Oak Ridge National Laboratory (ORNL). Proof-of-principle tests in a partially metal lined enclosure at ORNL successfully demonstrated the feasibility of directed microwave signal transmission techniques for remote systems applications. The potential for much more severe radio-frequency (RF) multipath propagation conditions in fully metal lined cells led to a programmatic decision to conduct additional testing in more typical hot-cell environments at other sites. Again, the test results were excellent. Based on the designs of the earlier systems, an advanced microwave signal transmission system configuration was subsequently developed that, in highly reflective environments, will support both high-performance video channels and high baud-rate digital data links at total gamma dose tolerance levels exceeding 10 7 rads and at elevated ambient temperatures
Noise correlations in cosmic microwave background experiments
Dodelson, Scott; Kosowsky, Arthur; Myers, Steven T.
1995-01-01
Many analysis of microwave background experiments neglect the correlation of noise in different frequency of polarization channels. We show that these correlations, should they be present, can lead to serve misinterpretation of an experiment. In particular, correlated noise arising from either electronics or atmosphere may mimic a cosmic signal. We quantify how the likelihood function for a given experiment varies with noise correlation, using both simple analytic models and actual data. For a typical microwave background anisotropy experiment, noise correlations at the level of 1% of the overall noise can seriously reduce the significance of a given detection.
Dynamic Characterization of a Low Cost Microwave Water-Cut Sensor in a Flow Loop
Karimi, Muhammad Akram
2017-03-31
Inline precise measurement of water fraction in oil (i.e. water-cut [WC]) finds numerous applications in oil and gas industry. This paper presents the characterization of an extremely low cost, completely non-intrusive and full range microwave water-cut sensor based upon pipe conformable microwave T-resonator. A 10″ microwave stub based T-resonator has been implemented directly on the pipe surface whose resonance frequency changes in the frequency band of 90MHz–190MHz (111%) with changing water fraction in oil. The designed sensor is capable of detecting even small changes in WC with a resolution of 0.07% at low WC and 0.5% WC at high WC. The performance of the microwave WC sensor has been tested in an in-house flow loop. The proposed WC sensor has been characterized over full water-cut range (0%–100%) not only in vertical but also in horizontal orientation. The sensor has shown predictable response in both orientations with huge frequency shift. Moreover, flow rate effect has also been investigated on the proposed WC sensor’s performance and it has been found that the sensor’s repeatability is within 2.5% WC for variable flow rates.
Digital readouts for large microwave low-temperature detector arrays
International Nuclear Information System (INIS)
Mazin, Benjamin A.; Day, Peter K.; Irwin, Kent D.; Reintsema, Carl D.; Zmuidzinas, Jonas
2006-01-01
Over the last several years many different types of low-temperature detectors (LTDs) have been developed that use a microwave resonant circuit as part of their readout. These devices include microwave kinetic inductance detectors (MKID), microwave SQUID readouts for transition edge sensors (TES), and NIS bolometers. Current readout techniques for these devices use analog frequency synthesizers and IQ mixers. While these components are available as microwave integrated circuits, one set is required for each resonator. We are exploring a new readout technique for this class of detectors based on a commercial-off-the-shelf technology called software defined radio (SDR). In this method a fast digital to analog (D/A) converter creates as many tones as desired in the available bandwidth. Our prototype system employs a 100MS/s 16-bit D/A to generate an arbitrary number of tones in 50MHz of bandwidth. This signal is then mixed up to the desired detector resonant frequency (∼10GHz), sent through the detector, then mixed back down to baseband. The baseband signal is then digitized with a series of fast analog to digital converters (80MS/s, 14-bit). Next, a numerical mixer in a dedicated integrated circuit or FPGA mixes the resonant frequency of a specified detector to 0Hz, and sends the complex detector output over a computer bus for processing and storage. In this paper we will report on our results in using a prototype system to readout a MKID array, including system noise performance, X-ray pulse response, and cross-talk measurements. We will also discuss how this technique can be scaled to read out many thousands of detectors
Microwave photonics systems based on whispering-gallery-mode resonators.
Coillet, Aurélien; Henriet, Rémi; Phan Huy, Kien; Jacquot, Maxime; Furfaro, Luca; Balakireva, Irina; Larger, Laurent; Chembo, Yanne K
2013-08-05
Microwave photonics systems rely fundamentally on the interaction between microwave and optical signals. These systems are extremely promising for various areas of technology and applied science, such as aerospace and communication engineering, sensing, metrology, nonlinear photonics, and quantum optics. In this article, we present the principal techniques used in our lab to build microwave photonics systems based on ultra-high Q whispering gallery mode resonators. First detailed in this article is the protocol for resonator polishing, which is based on a grind-and-polish technique close to the ones used to polish optical components such as lenses or telescope mirrors. Then, a white light interferometric profilometer measures surface roughness, which is a key parameter to characterize the quality of the polishing. In order to launch light in the resonator, a tapered silica fiber with diameter in the micrometer range is used. To reach such small diameters, we adopt the "flame-brushing" technique, using simultaneously computer-controlled motors to pull the fiber apart, and a blowtorch to heat the fiber area to be tapered. The resonator and the tapered fiber are later approached to one another to visualize the resonance signal of the whispering gallery modes using a wavelength-scanning laser. By increasing the optical power in the resonator, nonlinear phenomena are triggered until the formation of a Kerr optical frequency comb is observed with a spectrum made of equidistant spectral lines. These Kerr comb spectra have exceptional characteristics that are suitable for several applications in science and technology. We consider the application related to ultra-stable microwave frequency synthesis and demonstrate the generation of a Kerr comb with GHz intermodal frequency.
Effects of Microwave Radiation on Oil Recovery
Esmaeili, Abdollah
2011-12-01
A variety of oil recovery methods have been developed and applied to mature and depleted reservoirs in order to improve the efficiency. Microwave radiation oil recovery method is a relatively new method and has been of great interest in the recent years. Crude oil is typically co-mingled with suspended solids and water. To increase oil recovery, it is necessary to remove these components. The separation of oil from water and solids using gravitational settling methods is typically incomplete. Oil-in-water and oil-water-solid emulsions can be demulsified and separated into their individual layers by microwave radiation. The data also show that microwave separation is faster than gravity separation and can be faster than conventional heating at many conditions. After separation of emulsion into water and oil layers, water can be discharged and oil is collected. High-frequency microwave recycling process can recover oil and gases from oil shale, residual oil, drill cuttings, tar sands oil, contaminated dredge/sediments, tires and plastics with significantly greater yields and lower costs than are available utilizing existing known technologies. This process is environmentally friendly, fuel-generating recycler to reduce waste, cut emissions, and save energy. This paper presents a critical review of Microwave radiation method for oil recovery.
Design of remote control alarm system by microwave detection
Wang, Junli
2018-04-01
A microwave detection remote control alarm system is designed, which is composed of a Microwave detectors, a radio receiving/transmitting module and a digital encoding/decoding IC. When some objects move into the surveillance area, microwave detectors will generate a control signal to start transmitting system. A radio control signal will be spread by the transmitting module, once the signal can be received, and it will be disposed by some circuits, arousing some voices that awake the watching people. The whole device is a modular configuration, it not only has some advantage of frequency stable, but also reliable and adjustment-free, and it is suitable for many kinds of demands within the distance of 100m.
Directory of Open Access Journals (Sweden)
V. B. Yurchenko
2015-08-01
Full Text Available We present experimental observations of light-controlled resonance effects in microwave whispering-gallery-mode quasi-optical dielectric-semiconductor disk resonators in the frequency band of 5 GHz to 20 GHz arising due to illumination from a light emitting diode (LED of 50W power range. We obtain huge enhancement of photo-sensitivity (growing with the resonator Q-factor that makes light-microwave interaction observable with an ordinary light (no laser at conventional brightness (like an office lighting in quasi-optical microwave structures at rather long (centimeter-scale wavelength. We also demonstrate non-conventional photo-response of Fano resonances when the light suppresses one group of resonances and enhances another group. The effects could be used for the optical control and quasi-optical switching of microwave propagation through either one or another frequency channel.
Shielding effectiveness research of window panes in microwave frequency range
Bilotas, Evaldas
2016-01-01
The purpose of this work is to investigate microwave shielding effectiveness (SE) of modern window panes. In addition, it will be made sure of what is the main mechanism behind the electromagnetic shielding by investigating three different glasses reflection coefficient. In order to achieve these goals, shielding effectiveness of window panes and their components will be measured in semi-anechoic and anechoic chambers. Furthermore, these measurements will be done in near and far field conditi...
Microwave moisture meter for in-shell almonds.
Determining almond kernel moisture content while still in the shell is important for both almond growers and processors. A dielectric method was developed for almond kernel moisture determination from dielectric measurements on in-shell almonds at a single microwave frequency. A sample holder was fi...
Axion searches with microwave filters: the RADES project
Álvarez Melcón, Alejandro; Arguedas Cuendis, Sergio; Cogollos, Cristian; Díaz-Morcillo, Alejandro; Döbrich, Babette; Gallego, Juan Daniel; Gimeno, Benito; Irastorza, Igor G.; José Lozano-Guerrero, Antonio; Malbrunot, Chloé; Navarro, Pablo; Peña Garay, Carlos; Redondo, Javier; Vafeiadis, Theodoros; Wuensch, Walter
2018-05-01
We propose, design and construct a variant of the conventional axion haloscope concept that could be competitive in the search for dark matter axions of masses in the decade 10–100 μeV. Theses masses are located somewhat above the mass range in which existing experiments have reached sensitivity to benchmark QCD axion models. Our haloscope consists of an array of small microwave cavities connected by rectangular irises, in an arrangement commonly used in radio-frequency filters. The size of the unit cavity determines the main resonant frequency, while the possibility to connect a large number of cavities allows to reach large detection volumes. We develop the theoretical framework of the detection concept, and present design prescriptions to optimize detection capabilities. We describe the design and realization of a first small-scale prototype of this concept, called Relic Axion Detector Exploratory Setup (RADES). It consists of a copper-coated stainless steel five-cavities microwave filter with the detecting mode operating at around 8.4 GHz. This structure has been electromagnetically characterized at 2 K and 298 K, and it is now placed in ultra-high vacuum in one of the twin-bores of the 9 T CAST dipole magnet at CERN. We describe the data acquisition system developed for relic axion detection, and present preliminary results of the electromagnetic properties of the microwave filter, which show the potential of filters to reach QCD axion window sensitivity at X-band frequencies.
Pozar, David M
2012-01-01
The 4th edition of this classic text provides a thorough coverage of RF and microwave engineering concepts, starting from fundamental principles of electrical engineering, with applications to microwave circuits and devices of practical importance. Coverage includes microwave network analysis, impedance matching, directional couplers and hybrids, microwave filters, ferrite devices, noise, nonlinear effects, and the design of microwave oscillators, amplifiers, and mixers. Material on microwave and RF systems includes wireless communications, radar, radiometry, and radiation hazards. A large
Frequency Hopping Transceiver Multiplexer
1983-03-01
ATC 17 ULR IHQ OCLI CPCTR ULTRA HIGH "OQS" UP TO 4X HIGHER THAN BEST INDUS- TRY STANDARD (ATC 100). MICROWAVE POWER, CURRENT. AND 0 RATINGS5...Q"W were assigned to element (FigC-2); which will be modelled into the transformer previously ment td . The center frequencies, "Q", frequency range...of the TD 1288 system. Temperature stability, change with time or storage. Flexure Frequency, or non-linear change over bandwidth. * Humidity
The microwave and H-alpha sources of the 1992 January 13 flare
Wang, H.; Gary, D. E.; Zirin, H.; Kosugi, T.; Schwartz, R. A.; Linford, G.
1995-01-01
We compare X-ray, microwave and H-alpha observations for the 1992 January 13 limb flare. The soft and hard X-ray images of the flare have been studied thoroughly by Masuda et al. (1994) with Yohkoh SXT and HXT images. We find that during the hard X-ray emission peak there is no H-alpha brightening on the disk nor at the limb, so the main ribbons of this flare must be beyond the limb. The microwave source maintains a fixed distance about 10 arcsecs from the optical limb in the frequency range 2.8-14.0 GHz. We interpret this limit in source position as due to the presence of a microwave limb that extends higher than the white-light limb -- to a height of 7300 +/- 1500 km. We believe that the high-frequency microwave emissions are occulted by this extended limb, while the soft and hard X-ray emissions are able to pass through largely unaffected. We also believe, however, that the hard X-ray footpoints are also partially occulted by the photospheric limb, despite the appearance of 'footpoint sources' in HXT data shown by Masuda et al. The smooth X-ray and microwave time profiles, microwave-rich emission relative to hard X-rays, and progressive hard X-ray spectral hardening through the flare peak are all characteristics that we interpret as being a direct result of the occultation of footpoint emission.
Ultra-Compact linear chirped microwave signal generator
DEFF Research Database (Denmark)
Yan, Siqi; Zhou, Feng; Dong, Jianji
2017-01-01
A novel concept to generate linear chirped microwave signal is proposed and experimentally verified. The frequency to time mapping method is used while the Mach-Zehnder interferometer based on the photonic crystal waveguide is employed as the key device with its significant advantages of the ultra...
Microwave power coupling with electron cyclotron resonance ...
Indian Academy of Sciences (India)
600 W microwave power with an average electron density of ∼ 6 × 1011 cm. −3 ... the angular frequency of the cyclotron motion, e is the electron charge, m is the mass of .... is also suitable for ECR plasma-based applications like high-quality ...
Experimental progress on virtual-cathode very high power microwave source development
International Nuclear Information System (INIS)
Fazio, M.V.; Hoeberling, R.F.
1987-01-01
The evolution of rf accelerator technology toward high-power, high-current, low-emittance beams produces an ever-increasing demand for efficient, very high power microwave sources. The present klystron technology has performed very well but is not expected to produce reliable gigawatt peak-power units in the 1- to 10-GHz regime. Further major advancements must involve other types of sources. The reflexing electron sources can produce microwave powers at the gigawatt level and have demonstrated operation from 800 MHz to 40 GHz. Pulse length appears to be limited by electron-beam diode closure, and reflexing electron devices have been operated in a repetitively pulsed mode. An experiment is under way to investigate concepts to stabilize the frequency of the virtual cathode source. If one can successfully frequency and phase lock this source to an external signal, then this source can operate as a very high power microwave amplifier making it practical for accelerator applications. The progress on an experiment to test these concepts will be discussed
Microwave-Induced Chemotoxicity of Polydopamine-Coated Magnetic Nanocubes
Julfakyan, Khachatur; Fatieiev, Yevhen; Alsaiari, Shahad K.; Deng, Lin; Ezzeddine, Alaa; Zhang, Dingyuan; Rotello, Vincent M.; Khashab, Niveen M.
2015-01-01
Polydopamine-coated FeCo nanocubes (PDFCs) were successfully synthesized and tested under microwave irradiation of 2.45 GHz frequency and 0.86 W/cm2 power. These particles were found to be non-toxic in the absence of irradiation, but gained
Parametric Amplifiers for Microwave Kinectic Inductance Detector (MKID) Readout
National Aeronautics and Space Administration — Build a microwave amplifier with near quantum-limited sensitivity, octave or greater bandwidth, gain > 20 dB for input signals in the frequency range 1 – 10 GHz,...
The 1988 IEEE MTT international microwave symposium (Digest of Papers). Volume I
International Nuclear Information System (INIS)
Anon.
1988-01-01
This book contains papers presented at a symposium on microwaves. Topics covered include: Radiation from open waveguides and leaky wave phenomena; Frequency-dependent and frequency-independent nonlinear characteristics of a high-speed laser diode; and Integrated circuit discontinuities and radiation
Katsaros, K. B.; Mcmurdie, L. A.
1983-01-01
Passive microwave measurements are used to study the distribution of atmospheric water in midlatitude cyclones. The integrated water vapor, integrated liquid water, and rainfall rate are deduced from the brightness temperatures at microwave frequencies measured by the Scanning Multichannel Microwave Radiometer (SMRR) flown on both the Seasat and Nimbus 7 satellites. The practical application of locating fronts by the cyclone moisture pattern over oceans is shown, and the relationship between the quantity of coastal rainfall and atmospheric water content is explored.
Investigation of rectenna for microwave power conversion
International Nuclear Information System (INIS)
Karimov, Kh S; Saleem, M; Shah, M; Shafique, S
2010-01-01
This paper presents the fabrication of organic semiconductor (OS) rectifiers and an investigation of rectifying antenna (rectenna) under the effect of microwave power. As a source of microwaves, a patch antenna fed by a generator was used. The rectenna contains a built-in rectifier. The surface-type Ag/NiPc/Au cell, with organic semiconductor nickel phthalocyanine (NiPc) as the active material, was used as a rectenna. The rectifier was fabricated by thermal deposition of Ag, Au and NiPc thin films on thoroughly cleaned glass substrate. The measured I–V characteristics of the cell showed rectifying behavior. The rectenna was tested at frequency ranges of 8–16 GHz at different intensities of radiation and vertical and horizontal positions of the rectenna's axes. Under the effect of microwave power at the output of the rectenna, the output dc voltage and current were detected
YIG based broad band microwave absorber: A perspective on synthesis methods
Sharma, Vinay; Saha, J.; Patnaik, S.; Kuanr, Bijoy K.
2017-10-01
The fabrication of a thin layer of microwave absorber that operates over a wide band of frequencies is still a challenging task. With recent advances in nanostructure synthesis techniques, considerable progress has been achieved in realizations of thin nanocomposite layer designed for full absorption of incident electromagnetic (EM) radiation covering S to K band frequencies. The primary objective of this investigation is to achieve best possible EM absorption with a wide bandwidth and attenuation >10 dB for a thin absorbing layer (few hundred of microns). Magnetic yttrium iron garnet (Y3Fe5O12; in short YIG) nanoparticles (NPs) were prepared by sol-gel (SG) as well as solid-state (SS) reaction methods to elucidate the effects of nanoscale finite size on the magnetic behavior of the particles and hence their microwave absorption capabilities. It is found that YIG prepared by these two methods are different in many ways. Magnetic properties investigated using vibrating sample magnetometry (VSM) exhibit that the coercivity (Hc) of solid-state NPs is much larger (72 Oe) than the sol-gel NPs (31 Oe). Microwave absorption properties were studied by ferromagnetic resonance (FMR) technique in field sweep mode at different fixed frequencies. A thin layer (∼300 μm) of YIG film was deposited using electrophoretic deposition (EPD) technique over a coplanar waveguide (CPW) transmission line made on copper coated RT/duroid® 5880 substrates. Temperature dependent magnetic properties were also investigated using VSM and FMR techniques. Microwave absorption properties were investigated at high temperatures (up to 300 °C) both for sol-gel and solid-state synthesized NPs and are related to skin depth of YIG films. It is observed that microwave absorption almost vanishes when the temperature reached the Néel temperature of YIG.
Coherent Microwave-to-Optical Conversion via Six-Wave Mixing in Rydberg Atoms
Han, Jingshan; Vogt, Thibault; Gross, Christian; Jaksch, Dieter; Kiffner, Martin; Li, Wenhui
2018-03-01
We present an experimental demonstration of converting a microwave field to an optical field via frequency mixing in a cloud of cold 87Rb atoms, where the microwave field strongly couples to an electric dipole transition between Rydberg states. We show that the conversion allows the phase information of the microwave field to be coherently transferred to the optical field. With the current energy level scheme and experimental geometry, we achieve a photon-conversion efficiency of ˜0.3 % at low microwave intensities and a broad conversion bandwidth of more than 4 MHz. Theoretical simulations agree well with the experimental data, and they indicate that near-unit efficiency is possible in future experiments.
Zhuang, Leimeng; Khan, Muhammad Rezaul; Beeker, Willem; Leinse, Arne; Heideman, René; Roeloffzen, Chris
2012-11-19
We propose and demonstrate a novel wideband microwave photonic fractional Hilbert transformer implemented using a ring resonator-based optical all-pass filter. The full programmability of the ring resonator allows variable and arbitrary fractional order of the Hilbert transformer. The performance analysis in both frequency and time domain validates that the proposed implementation provides a good approximation to an ideal fractional Hilbert transformer. This is also experimentally verified by an electrical S21 response characterization performed on a waveguide realization of a ring resonator. The waveguide-based structure allows the proposed Hilbert transformer to be integrated together with other building blocks on a photonic integrated circuit to create various system-level functionalities for on-chip microwave photonic signal processors. As an example, a circuit consisting of a splitter and a ring resonator has been realized which can perform on-chip phase control of microwave signals generated by means of optical heterodyning, and simultaneous generation of in-phase and quadrature microwave signals for a wide frequency range. For these functionalities, this simple and on-chip solution is considered to be practical, particularly when operating together with a dual-frequency laser. To our best knowledge, this is the first-time on-chip demonstration where ring resonators are employed to perform phase control functionalities for optical generation of microwave signals by means of optical heterodyning.
Equivalent Circuit Modeling of the Dielectric Loaded Microwave Biosensor
Directory of Open Access Journals (Sweden)
M. T. Jilani
2014-12-01
Full Text Available This article describes the modeling of biological tissues at microwave frequency using equivalent lumped elements. A microwave biosensor based on microstrip ring resonator (MRR, that has been utilized previously for meat quality evaluation is used for this purpose. For the first time, the ring-resonator loaded with the lossy and high permittivity dielectric material, such as; biological tissue, in a partial overlay configuration is analyzed. The equivalent circuit modeling of the structure is then performed to identify the effect of overlay thickness on the resonance frequency. Finally, the relationship of an overlay thickness with the corresponding RC values of the meat equivalent circuit is established. Simulated, calculated and measured results are then compared for validation. Results are well agreed while the observed discrepancy is in acceptable limit.
A low cost, printed microwave based level sensor with integrated oscillator readout circuitry
Karimi, Muhammad Akram; Arsalan, Muhammad; Shamim, Atif
2017-01-01
This paper presents an extremely low cost, tube conformable, printed T-resonator based microwave level sensor, whose resonance frequency shifts by changing the level of fluids inside the tube. Printed T-resonator forms the frequency selective
Detection of On-Chip Generated Weak Microwave Radiation Using Superconducting Normal-Metal SET
Directory of Open Access Journals (Sweden)
Behdad Jalali-Jafari
2016-01-01
Full Text Available The present work addresses quantum interaction phenomena of microwave radiation with a single-electron tunneling system. For this study, an integrated circuit is implemented, combining on the same chip a Josephson junction (Al/AlO x /Al oscillator and a single-electron transistor (SET with the superconducting island (Al and normal-conducting leads (AuPd. The transistor is demonstrated to operate as a very sensitive photon detector, sensing down to a few tens of photons per second in the microwave frequency range around f ∼ 100 GHz. On the other hand, the Josephson oscillator, realized as a two-junction SQUID and coupled to the detector via a coplanar transmission line (Al, is shown to provide a tunable source of microwave radiation: controllable variations in power or in frequency were accompanied by significant changes in the detector output, when applying magnetic flux or adjusting the voltage across the SQUID, respectively. It was also shown that the effect of substrate-mediated phonons, generated by our microwave source, on the detector output was negligibly small.
Microwave quantum logic gates for trapped ions.
Ospelkaus, C; Warring, U; Colombe, Y; Brown, K R; Amini, J M; Leibfried, D; Wineland, D J
2011-08-10
Control over physical systems at the quantum level is important in fields as diverse as metrology, information processing, simulation and chemistry. For trapped atomic ions, the quantized motional and internal degrees of freedom can be coherently manipulated with laser light. Similar control is difficult to achieve with radio-frequency or microwave radiation: the essential coupling between internal degrees of freedom and motion requires significant field changes over the extent of the atoms' motion, but such changes are negligible at these frequencies for freely propagating fields. An exception is in the near field of microwave currents in structures smaller than the free-space wavelength, where stronger gradients can be generated. Here we first manipulate coherently (on timescales of 20 nanoseconds) the internal quantum states of ions held in a microfabricated trap. The controlling magnetic fields are generated by microwave currents in electrodes that are integrated into the trap structure. We also generate entanglement between the internal degrees of freedom of two atoms with a gate operation suitable for general quantum computation; the entangled state has a fidelity of 0.76(3), where the uncertainty denotes standard error of the mean. Our approach, which involves integrating the quantum control mechanism into the trapping device in a scalable manner, could be applied to quantum information processing, simulation and spectroscopy.
Resonant and Ground Experimental Study on the Microwave Plasma Thruster
Yang, Juan; He, Hongqing; Mao, Genwang; Qu, Kun; Tang, Jinlan; Han, Xianwei
2002-01-01
chemistry. Therefore, the application of EP for the attitude control and station keeping of satellite, the propulsion of deep space exploration craft allows to reduce substantially the mass of on-board propellant and the launching cost. The EP research is now receiving high interest everywhere. microwave generating subsystem, the propellant supplying subsystem and the resonator (the thruster). Its principle is that the magnetron of the microwave generating subsystem transfers electric energy into microwave energy at given frequency which is introduced into a resonant cavity. Microwave will resonate within the cavity when it is adjusted. When the propellant gas (N2, Ar, He, NH3 or H2) is put into the cavity and coupled with microwave energy at the maximal electric intensity place, it will be broken down to form free-floating plasma, which flows from nozzle with high speed to produce thrust. Its characteristic is high efficiency, simple power supply and without electrode ablation, its specific impulse is greater than arcjet. 2450MHz, have been developed. The microwave generating subsystem and resonator of lower power MPT, 70-200W, are coaxial. The resonator with TEM resonating mode is section of coaxial wave-guide, of which one end is shorted, another is semi-opened. The maximal electric intensity field is in the lumped capacity formed between the end surface of inner conductor, retracting in the cavity, and the semi-opened surface of outer conductor. It provides favorable condition for gas breakdown. The microwave generating system and resonator of middle power MPT, 500-1,000W, are wave-guide cavity. The resonator with TM011 resonating mode is cylinder wave-guide cavity, of which two end surface are shorted. The distribution of electromagnetic field is axial symmetry, its maximal electric intensity field locates on the axis and closes to the exit of nozzle, where the propellant gas is breakdown to form free floating plasma. The plasma is free from the wall of
Energy Technology Data Exchange (ETDEWEB)
Arora, Amit [D.A.V. Institute of Engineering and Technology, Jalandhar (India); Narang, Sukhleen Bindra, E-mail: sukhleen2@yahoo.com [Department of Electronics Technology, Guru Nanak Dev University, Amritsar (India); Pubby, Kunal [Department of Electronics Technology, Guru Nanak Dev University, Amritsar (India)
2017-02-01
In this research, the microwave properties of Lanthanum-Sodium doped Cobalt-Zirconium barium hexaferrites, intended as microwave absorbers, are analyzed on Vector Network Analyzer in K-band. The results indicate that the doping has resulted in lowering of real permittivity and enhancement of dielectric losses. Real permeability has shown increase while magnetic losses have shown decrease in value with doping. All these four properties have shown very small variation with frequency in the scanned frequency range which indicates the relaxation type of behavior. Microwave absorption characteristics of these compositions are analyzed with change in sample thickness. The results demonstrate that the matching frequency of the microwave absorber shifts towards lower side of frequency band with increase in thickness. The complete analysis of the prepared microwave absorbers shows a striking achievement with very low reflection loss and wide absorption bandwidth for all the six compositions in 18–26.5 GHz frequency band. - Highlights: • Electromagnetic Characterization of M-hexaferrites in K-band (18–26.5 GHz) • Variation of absorption properties with thickness of sample. • Satisfaction of quarter-wavelength condition for absorption properties • Results of double-layer absorbers (not reports till day by anyone).
Testing Fixture For Microwave Integrated Circuits
Romanofsky, Robert; Shalkhauser, Kurt
1989-01-01
Testing fixture facilitates radio-frequency characterization of microwave and millimeter-wave integrated circuits. Includes base onto which two cosine-tapered ridge waveguide-to-microstrip transitions fastened. Length and profile of taper determined analytically to provide maximum bandwidth and minimum insertion loss. Each cosine taper provides transformation from high impedance of waveguide to characteristic impedance of microstrip. Used in conjunction with automatic network analyzer to provide user with deembedded scattering parameters of device under test. Operates from 26.5 to 40.0 GHz, but operation extends to much higher frequencies.
Microwave enhanced recovery of nickel-copper ore: communition and floatability aspects.
Henda, R; Hermas, A; Gedye, R; Islam, M R
2005-01-01
A study describing the effect of microwave radiation, at a frequency of 2450 MHz, on the processes of communication and flotation of a complex sulphide nickel-copper ore is presented. Ore communication has been investigated under standard radiation-free conditions and after ore treatment in a radiated environment as a function of ore size, exposure time to radiation, and microwave power. The findings show that communication is tremendously improved by microwave radiation with values of the relative work index as low as 23% at a microwave power of 1.406 kW and after 10 s of exposure time. Communication is affected by exposure time and microwave power in a nontrivial manner. In terms of ore floatability, the experimental tests have been carried out on a sample of 75 microm in size under different exposure times. The results show that both ore concentrate recoveries and grades of nickel and copper are significantly enhanced after microwave treatment of the ore with relative increases in recovered concentrate, grade of nickel, and grade of copper of 26 wt%, 15 wt%, and 27%, respectively, at a microwave power of 1330 kW and after 30 s of exposure time.
DEFF Research Database (Denmark)
Xue, Weiqi; Sales, Salvador; Mørk, Jesper
2009-01-01
We introduce a novel scheme based on slow and fast light effects in semiconductor optical amplifiers, to implement a microwave photonic notch filter with ~100% fractional tuning range at a microwave frequency of 30 GHz....
Choice of antenna geometry for microwave power transmission from solar power satellites
Potter, Seth D.
1992-01-01
A comparison is made between square and circular transmitting antennas for solar power satellite microwave power transmission. It is seen that the exclusion zone around the rectenna needed to protect populations from microwaves is smaller for a circular antenna operating at 2.45 GHz than it is for a square antenna at that frequency. If the frequency is increased, the exclusion zone size remains the same for a square antenna, but becomes even smaller for a circular antenna. Peak beam intensity is the same for both antennas if the frequency and antenna area are equal. The circular antenna puts a somewhat greater amount of power in the main lobe and somewhat less in the side lobes. Since rain attenuation and atmospheric heating remain problems above 10 GHz, it is recommended that future solar power satellite work concentrate on circular transmitting antennas at frequencies of roughly 10 GHz.
Low-loss negative index metamaterials for X, Ku, and K microwave bands
Directory of Open Access Journals (Sweden)
David A. Lee
2015-04-01
Full Text Available Low-loss, negative-index of refraction metamaterials were designed and tested for X, Ku, and K microwave frequency bands. An S-shaped, split-ring resonator was used as a unit cell to design homogeneous slabs of negative-index metamaterials. Then, the slabs of metamaterials were cut unto prisms to measure experimentally the negative index of refraction of a plane electromagnetic wave. Theoretical simulations using High-Frequency Structural Simulator, a finite element equation solver, were in good agreement with experimental measurements. The negative index of refraction was retrieved from the angle- and frequency-dependence of the transmitted intensity of the microwave beam through the metamaterial prism and compared well to simulations; in addition, near-field electromagnetic intensity mapping was conducted with an infrared camera, and there was also a good match with the simulations for expected frequency ranges for the negative index of refraction.
A micromachined inline type microwave power sensor with working state transfer switches
International Nuclear Information System (INIS)
Han Lei
2011-01-01
A wideband 8-12 GHz inline type microwave power sensor, which has both working and non-working states, is presented. The power sensor measures the microwave power coupled from a CPW line by a MEMS membrane. In order to reduce microwave losses during the non-working state, a new structure of working state transfer switches is proposed to realize the two working states. The fabrication of the power sensor with two working states is compatible with the GaAs MMIC (monolithic microwave integrated circuit) process. The experimental results show that the power sensor has an insertion loss of 0.18 dB during the non-working state and 0.24 dB during the working state at a frequency of 10 GHz. This means that no microwave power has been coupled from the CPW line during the non-working state. (semiconductor integrated circuits)
EDITORIAL: Microwave Moisture Measurements
Kaatze, Udo; Kupfer, Klaus; Hübner, Christof
2007-04-01
Microwave moisture measurements refer to a methodology by which the water content of materials is non-invasively determined using electromagnetic fields of radio and microwave frequencies. Being the omnipresent liquid on our planet, water occurs as a component in most materials and often exercises a significant influence on their properties. Precise measurements of the water content are thus extremely useful in pure sciences, particularly in biochemistry and biophysics. They are likewise important in many agricultural, technical and industrial fields. Applications are broad and diverse, and include the quality assessment of foodstuffs, the determination of water content in paper, cardboard and textile production, the monitoring of moisture in sands, gravels, soils and constructions, as well as the measurement of water admixtures to coal and crude oil in reservoirs and in pipelines. Microwave moisture measurements and evaluations require insights in various disciplines, such as materials science, dielectrics, the physical chemistry of water, electrodynamics and microwave techniques. The cooperation of experts from the different fields of science is thus necessary for the efficient development of this complex discipline. In order to advance cooperation the Workshop on Electromagnetic Wave Interaction with Water and Moist Substances was held in 1993 in Atlanta. It initiated a series of international conferences, of which the last one was held in 2005 in Weimar. The meeting brought together 130 scientists and engineers from all over the world. This special issue presents a collection of some selected papers that were given at the event. The papers cover most topics of the conference, featuring dielectric properties of aqueous materials, electromagnetic wave interactions, measurement methods and sensors, and various applications. The special issue is dedicated to Dr Andrzej W Kraszewski, who died in July 2006 after a distinguished career of 48 years in the research of
High-resolution gamma-ray spectroscopy with a microwave-multiplexed transition-edge sensor array
Energy Technology Data Exchange (ETDEWEB)
Noroozian, Omid [National Institute of Standards and Technology, Boulder, Colorado 80305 (United States); Center for Astrophysics and Space Astronomy, University of Colorado, Boulder, Colorado 80309 (United States); Mates, John A. B.; Bennett, Douglas A.; Brevik, Justus A.; Fowler, Joseph W.; Gao, Jiansong; Hilton, Gene C.; Horansky, Robert D.; Irwin, Kent D.; Schmidt, Daniel R.; Vale, Leila R.; Ullom, Joel N. [National Institute of Standards and Technology, Boulder, Colorado 80305 (United States); Kang, Zhao [Department of Physics, University of Colorado, Boulder, Colorado 80309 (United States)
2013-11-11
We demonstrate very high resolution photon spectroscopy with a microwave-multiplexed two-pixel transition-edge sensor (TES) array. We measured a {sup 153}Gd photon source and achieved an energy resolution of 63 eV full-width-at-half-maximum at 97 keV and an equivalent readout system noise of 86 pA/√(Hz) at the TES. The readout circuit consists of superconducting microwave resonators coupled to radio-frequency superconducting-quantum-interference-devices and transduces changes in input current to changes in phase of a microwave signal. We use flux-ramp modulation to linearize the response and evade low-frequency noise. This demonstration establishes one path for the readout of cryogenic X-ray and gamma-ray sensor arrays with more than 10{sup 3} elements and spectral resolving powers R=λ/Δλ>10{sup 3}.
Measuring the global distribution of intense convection over land with passive microwave radiometry
Spencer, R. W.; Santek, D. A.
1985-01-01
The global distribution of intense convective activity over land is shown to be measurable with satellite passive-microwave methods through a comparison of an empirical rain rate algorithm with a climatology of thunderstorm days for the months of June-August. With the 18 and 37 GHz channels of the Nimbus-7 Scanning Multichannel Microwave Radiometer (SMMR), the strong volume scattering effects of precipitation can be measured. Even though a single frequency (37 GHz) is responsive to the scattering signature, two frequencies are needed to remove most of the effect that variations in thermometric temperatures and soil moisture have on the brightness temperatures. Because snow cover is also a volume scatterer of microwave energy at these microwavelengths, a discrimination procedure involving four of the SMMR channels is employed to separate the rain and snow classes, based upon their differences in average thermometric temperature.
All-optical microwave signal processing based on optical phase modulation
Zeng, Fei
This thesis presents a theoretical and experimental study of optical phase modulation and its applications in all-optical microwave signal processing, which include all-optical microwave filtering, all-optical microwave mixing, optical code-division multiple-access (CDMA) coding, and ultrawideband (UWB) signal generation. All-optical microwave signal processing can be considered as the use of opto-electronic devices and systems to process microwave signals in the optical domain, which provides several significant advantages such as low loss, low dispersion, light weight, high time bandwidth products, and immunity to electromagnetic interference. In conventional approaches, the intensity of an optical carrier is modulated by a microwave signal based on direct modulation or external modulation. The intensity-modulated optical signal is then fed to a photonic circuit or system to achieve specific signal processing functionalities. The microwave signal being processed is usually obtained based on direct detection, i.e., an opto-electronic conversion by use of a photodiode. In this thesis, the research efforts are focused on the optical phase modulation and its applications in all-optical microwave signal processing. To avoid using coherent detection which is complicated and costly, simple and effective phase modulation to intensity modulation (PM-IM) conversion schemes are pursued. Based on a theoretical study of optical phase modulation, two approaches to achieving PM-IM conversions are proposed. In the first approach, the use of chromatic dispersion induced by a dispersive device to alter the phase relationships among the sidebands and the optical carrier of a phase-modulated optical signal to realize PM-IM conversion is investigated. In the second approach, instead of using a dispersive device, the PM-IM conversion is realized based on optical frequency discrimination implemented using an optical filter. We show that the proposed PM-IM conversion schemes can be
LEP Radio Frequency Copper Cavity
The pulse of a particle accelerator. 128 of these radio frequency cavities were positioned around CERN's 27-kilometre LEP ring to accelerate electrons and positrons. The acceleration was produced by microwave electric oscillations at 352 MHz. The electrons and positrons were grouped into bunches, like beads on a string, and the copper sphere at the top stored the microwave energy between the passage of individual bunches. This made for valuable energy savings as it reduced the heat generated in the cavity.
Wide-band analog frequency modulation of optic signals using indirect techniques
Fitzmartin, D. J.; Balboni, E. J.; Gels, R. G.
1991-01-01
The wideband frequency modulation (FM) of an optical carrier by a radio frequency (RF) or microwave signal can be accomplished independent of laser type when indirect modulation is employed. Indirect modulators exploit the integral relation of phase to frequency so that phase modulators can be used to impress frequency modulation on an optical carrier. The use of integrated optics phase modulators, which are highly linear, enables the generation of optical wideband FM signals with very low intermodulation distortion. This modulator can be used as part of an optical wideband FM link for RF and microwave signals. Experimental results from the test of an indirect frequency modulator for an optical carrier are discussed.
Burt, Eric; Gill, Patrick
2012-03-01
The 8 invited and 17 contributed papers in this special issue focus on the following topical areas covered at the 2011 Joint IEEE International Frequency Control Symposium and European Frequency and Time Forum, held in San Francisco, California: 1) Materials and Resonators; 2) Oscillators, Synthesizers, and Noise; 3) Microwave Frequency Standards; 4) Sensors and Transducers; 5) Timekeeping and Time and Frequency Transfer; and 6) Optical Frequency Standards.
Multiscale multichroic focal planes for measurements of the cosmic microwave background
Cukierman, Ari; Lee, Adrian T.; Raum, Christopher; Suzuki, Aritoki; Westbrook, Benjamin
2018-01-01
We report on the development of multiscale multichroic focal planes for measurements of the cosmic microwave background (CMB). A multichroic focal plane, i.e., one that consists of pixels that are simultaneously sensitive in multiple frequency bands, is an efficient architecture for increasing the sensitivity of an experiment as well as for disentangling the contamination due to galactic foregrounds, which is increasingly becoming the limiting factor in extracting cosmological information from CMB measurements. To achieve these goals, it is necessary to observe across a broad frequency range spanning roughly 30-350 GHz. For this purpose, the Berkeley CMB group has been developing multichroic pixels consisting of planar superconducting sinuous antennas coupled to extended hemispherical lenslets, which operate at sub-Kelvin temperatures. The sinuous antennas, microwave circuitry and the transition-edge-sensor (TES) bolometers to which they are coupled are integrated in a single lithographed wafer.We describe the design, fabrication, testing and performance of multichroic pixels with bandwidths of 3:1 and 4:1 across the entire frequency range of interest. Additionally, we report on a demonstration of multiscale pixels, i.e., pixels whose effective size changes as a function of frequency. This property keeps the beam width approximately constant across all frequencies, which in turn allows the sensitivity of the experiment to be optimal in every frequency band. We achieve this by creating phased arrays from neighboring lenslet-coupled sinuous antennas, where the size of each phased array is chosen independently for each frequency band. We describe the microwave circuitry in detail as well as the benefits of a multiscale architecture, e.g., mitigation of beam non-idealities, reduced readout requirements, etc. Finally, we discuss the design and fabrication of the detector modules and focal-plane structures including cryogenic readout components, which enable the
Advanced Drying Process for Lower Manufacturing Cost of Electrodes
Energy Technology Data Exchange (ETDEWEB)
Ahmad, Iftikhar [Lambda Technologies, Inc., Morrisville, NC (United States); Zhang, Pu [Lambda Technologies, Inc., Morrisville, NC (United States)
2016-11-30
For this Vehicle Technologies Incubator/Energy Storage R&D topic, Lambda Technologies teamed with Navitas Systems and proposed a new advanced drying process that promised a 5X reduction in electrode drying time and significant reduction in the cost of large format lithium batteries used in PEV's. The operating principle of the proposed process was to use penetrating radiant energy source Variable Frequency Microwaves (VFM), that are selectively absorbed by the polar water or solvent molecules instantly in the entire volume of the electrode. The solvent molecules are thus driven out of the electrode thickness making the process more efficient and much faster than convective drying method. To evaluate the Advanced Drying Process (ADP) a hybrid prototype system utilizing VFM and hot air flow was designed and fabricated. While VFM drives the solvent out of the electrode thickness, the hot air flow exhausts the solvent vapors out of the chamber. The drying results from this prototype were very encouraging. For water based anodes there is a 5X drying advantage (time & length of oven) in using ADP over standard drying system and for the NMP based cathodes the reduction in drying time has 3X benefit. For energy savings the power consumption measurements were performed to ADP prototype and compared with the convection standard drying oven. The data collected demonstrated over 40% saving in power consumption with ADP as compared to the convection drying systems. The energy savings are one of the operational cost benefits possible with ADP. To further speed up the drying process, the ADP prototype was explored as a booster module before the convection oven and for the electrode material being evaluated it was possible to increase the drying speed by a factor of 4, which could not be accomplished with the standard dryer without surface defects and cracks. The instantaneous penetration of microwave in the entire slurry thickness showed a major advantage in rapid drying of
Plasma wave excitation by intense microwave transmission from a space vehicle
Kimura, I.; Matsumoto, H.; Kaya, N.; Miyatake, S.
An impact of intense microwave upon the ionospheric plasma was empirically investigated by an active rocket experiment (MINIX). The rocket carried two high-power (830W) transmitters of 2.45 GHz microwave on the mother section of the rocket. The ionospheric plasma response to the intense microwave was measured by a diagnostic package installed on both mother and daughter sections. The daughter section was separated from the mother with a slow speed of 15 cm/sec. The plasma wave analyzers revealed that various plasma waves are nonlinearly excited by the microwave. Among them, the most intense are electron cyclotron waves, followed by electron plasma waves. Extremely low frequency waves (several tens of Hz) are also found. The results of the data analysis as well as comparative computer simulations are given in this paper.
TRANSMISSION AND ABSORPTION OF MICROWAVES BY AN INHOMOGENEOUS SPHERE PLASMA
Institute of Scientific and Technical Information of China (English)
SONG Falun; CAO Jinxiang; WANG Ge
2004-01-01
The numerical calculation of the transmission and absorption of microwaves at an arbitrarily incident angle to the inhomogeneous spherically symmetric plasma is presented.The nonuniform sphere is modeled by a series of concentric spherical shells, and the electron density is constant in each shell. The overall density profile follows any given distribution function. By using the geometrical optics approximation and considering the propagation coefficient is complex, as well as the attenuation and phase coefficients are vectors, the detailed evaluation shows that the transmission and absorption of microwaves in the inhomogeneous spherically symmetric plasma depend on the electron and neutral particle collision frequency, central density, incident angle of the microwaves and density distribution profiles.
Pastorino, Matteo
2010-01-01
An introduction to the most relevant theoretical and algorithmic aspects of modern microwave imaging approaches Microwave imaging-a technique used in sensing a given scene by means of interrogating microwaves-has recently proven its usefulness in providing excellent diagnostic capabilities in several areas, including civil and industrial engineering, nondestructive testing and evaluation, geophysical prospecting, and biomedical engineering. Microwave Imaging offers comprehensive descriptions of the most important techniques so far proposed for short-range microwave imaging-in
Low-frequency Landau-Zener-Stuckelberg interference in dissipative superconducting qubits
International Nuclear Information System (INIS)
Du-lingjie; Lan- Dong; Yu-Yang
2013-01-01
Landau-Zener-Stuckelberg (LZS) interference of continuously driven superconducting qubits is studied. Going beyond the second order perturbation expansion, we find a time dependent stationary population evolution as well as unsymmetrical microwave driven Landau-Zener transitions, resulting from the nonresonant terms which are neglected in rotating-wave approximation. For the low-frequency driving, the qubit population at equilibrium is a periodical function of time, owing to the contribution of the nonresonant terms. In order to obtain the average population, it is found that the average approximation based on the perturbation approach can be applied to the low-frequency region. For the extremely low frequency which is much smaller than the decoherence rate, we develop noncoherence approximation by dividing the evolution into discrete time steps during which the coherence is lost totally. These approximations present comprehensive analytical descriptions of LZS interference in most of parameter space of frequency and decoherence rate, agreeing well with those of the numerical simulations and providing a simple but integrated understanding to system dynamics. The application of our models to microwave cooling can obtain the minimal frequency to realize effective microwave cooling.
Microwave-Induced Chemotoxicity of Polydopamine-Coated Magnetic Nanocubes
Julfakyan, Khachatur
2015-08-06
Polydopamine-coated FeCo nanocubes (PDFCs) were successfully synthesized and tested under microwave irradiation of 2.45 GHz frequency and 0.86 W/cm2 power. These particles were found to be non-toxic in the absence of irradiation, but gained significant toxicity upon irradiation. Interestingly, no increase in relative heating rate was observed when the PDFCs were irradiated in solution, eliminating nanoparticle (NP)-induced thermal ablation as the source of toxicity. Based on these studies, we propose that microwave-induced redox processes generate the observed toxicity. © 2015 by the authors; licensee MDPI, Basel, Switzerland.
Design Concept for the Microwave Interrogation Structure in PARCS
National Research Council Canada - National Science Library
Dick, G. J; Klipstein, W. M; Heavner, T. P; Jefferts, S. R
2002-01-01
In this paper we will describe key aspects of the conceptual design of the microwave interrogation structure in the laser-cooled cesium frequency standard that is part of the Primary Atomic Reference Clock in Space (PARCS) experiment...
Removal of contaminated concrete surfaces by microwave heating: Phase 1 results
International Nuclear Information System (INIS)
White, T.L.; Grubb, R.G.; Pugh, L.P.; Foster, D. Jr.; Box, W.D.
1992-01-01
Oak Ridge National Laboratory (ORNL) is developing a microwave heating process to remove radiologically contaminated surface layers from concrete. The microwave energy is directed at the concrete surface and heats the concrete and free water present in the concrete matrix. Continued heating produces steam-pressure-induced mechanical stresses that cause the concrete surface to burst. The concrete particles from this steam explosion are small enough to be removed by a vacuum system, yet less than 1% of the debris is small enough to pose an airborne contamination hazard. The first phase of this program has demonstrated reliable removal of noncontaminated concrete surfaces at frequencies of 2.45 GHz and 10.6 GHz. Continuous concrete removal rates of 1.07 cm 3 /s with 5.2 kW of 2.45.-GHz power and 2.11 cm 3 /s with 3.6 kW of 10.6-GHz power have been demonstrated. Figures-of-merit for microwave removal of concrete have been calculated to be 0.21 cm 3 /s/kW at 2.45 GHz and 0.59 cm 3 /s/kW at 10.6 GHz. The amount of concrete removed in a single pass can be controlled by choosing the frequency and power of the microwave system
Petty, Grant W.; Katsaros, Kristina B.
1989-01-01
A closed-form mathematical model for the atmospheric contribution to microwave the absorption and emission at the SSM/I frequencies is developed in order to improve quantitative interpretation of microwave imagery from the Special Sensor Microwave Imager (SSM/I). The model is intended to accurately predict upwelling and downwelling atmospheric brightness temperatures at SSM/I frequencies, as functions of eight input parameters: the zenith (nadir) angle, the integrated water vapor and vapor scale height, the integrated cloud water and cloud height, the effective surface temperature, atmospheric lapse rate, and surface pressure. It is shown that the model accurately reproduces clear-sky brightness temperatures computed by explicit integration of a large number of radiosonde soundings representing all maritime climate zones and seasons.
Infrared and microwave properties of polypyrrole/multi-walled carbon nanotube composites
Energy Technology Data Exchange (ETDEWEB)
Gao, Qi; Wang, Yongsheng, E-mail: yshwang@bjtu.edu.cn; He, Dawei, E-mail: dwhe@bjtu.edu.cn; Gao, Lei; Zhou, Yikang; Fu, Ming
2014-08-01
This study analyses the formation of polypyrrole/multi-walled carbon nanotube (PPy/MWCNT) composite materials using chemical oxidation with varying amounts of MWCNTs added. The samples are characterized by scanning electron microscopy, Fourier transform infrared emission spectroscopy, a four-probe method, and infrared thermal imaging using electromagnetic parameters. According to the test results, it is seen that the formation of PPy with the addition of MWCNTs can affect the material’s infrared properties and increase the material’s microwave return losses (up to −19 dB). This production procedure can also make the peak frequency of the microwave return losses adjustable, and the composite’s infrared and microwave performance becomes compatible and adjustable. - Highlights: • A one step in-situ synthesis method of PPy/MWCNT polymerization is proposed. • The composites were used for infrared camouflage and for their microwave properties. • The microwave return losses and infrared emissivity of the composites are adjustable. • The mechanism relies on changes in the composites’ conductivity.
Infrared and microwave properties of polypyrrole/multi-walled carbon nanotube composites
International Nuclear Information System (INIS)
Gao, Qi; Wang, Yongsheng; He, Dawei; Gao, Lei; Zhou, Yikang; Fu, Ming
2014-01-01
This study analyses the formation of polypyrrole/multi-walled carbon nanotube (PPy/MWCNT) composite materials using chemical oxidation with varying amounts of MWCNTs added. The samples are characterized by scanning electron microscopy, Fourier transform infrared emission spectroscopy, a four-probe method, and infrared thermal imaging using electromagnetic parameters. According to the test results, it is seen that the formation of PPy with the addition of MWCNTs can affect the material’s infrared properties and increase the material’s microwave return losses (up to −19 dB). This production procedure can also make the peak frequency of the microwave return losses adjustable, and the composite’s infrared and microwave performance becomes compatible and adjustable. - Highlights: • A one step in-situ synthesis method of PPy/MWCNT polymerization is proposed. • The composites were used for infrared camouflage and for their microwave properties. • The microwave return losses and infrared emissivity of the composites are adjustable. • The mechanism relies on changes in the composites’ conductivity
Dielectric properties of Zea mays kernels - studies for microwave power processing applications
Energy Technology Data Exchange (ETDEWEB)
Surducan, Emanoil; Neamtu, Camelia; Surducan, Vasile, E-mail: emanoil.surducan@itim-cj.r [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania)
2009-08-01
Microwaves absorption in biological samples can be predicted by their specific dielectrical properties. In this paper, the dielectric properties ({epsilon}' and {epsilon}'') of corn (Zea mays) kernels in the 500 MHz - 20 GHz frequencies range are presented. A short analysis of the microwaves absorption process is also presented, in correlation with the specific thermal properties of the samples, measured by simultaneous TGA-DSC method.
Microwave pulse generation by photoconductive switching
Energy Technology Data Exchange (ETDEWEB)
Pocha, M.D.; Druce, R.L.
1989-03-14
Laser activated photoconductive semiconductor switching shows significant potential for application in high power microwave generation. Primary advantages of this concept are: small size, light weight, ruggedness, precise timing and phasing by optical control, and the potential for high peak power in short pulses. Several concepts have been suggested for microwave generation using this technology. They generally fall into two categories (1) the frozen wave generator or (2) tuned cavity modulation, both of which require only fast closing switches. We have been exploring a third possibility requiring fast closing and opening switches, that is the direct modulation of the switch at microwave frequencies. Switches have been fabricated at LLNL using neutron irradiated Gallium Arsenide which exhibit response times as short as 50 ps at low voltages. We are in the process of performing high voltage tests. So far, we have been able to generate 2.4 kV pulses with approximately 340 ps response time (FWHM) using approximately a 200..mu..J optical pulse. Experiments are continuing to increase the voltage and improve the switching efficiency. 3 refs., 6 figs.
Microwave pulse generation by photoconductive switching
Pocha, M. D.; Druce, R. L.
1989-03-01
Laser activated photoconductive semiconductor switching shows significant potential for application in high power microwave generation. Primary advantages of this concept are: small size, light weight, ruggedness, precise timing and phasing by optical control, and the potential for high peak power in short pulses. Several concepts have been suggested for microwave generation using this technology. They generally fall into two categories: (1) the frozen wave generator, or (2) tuned cavity modulation, both of which require only fast closing switches. We have been exploring a third possibility requiring fast closing and opening switches, that is the direct modulation of the switch at microwave frequencies. Switches have been fabricated at LLNL using neutron irradiated Gallium Arsenide which exhibit response times as short as 50 ps at low voltages. We are in the process of performing high voltage tests. So far, we have been able to generate 2.4 kV pulses with approximately 340 ps response time (FWHM) using approximately a 200 microJ optical pulse. Experiments are continuing to increase the voltage and improve the switching efficiency.
Joining of thermoplastic substrates by microwaves
Paulauskas, Felix L.; Meek, Thomas T.
1997-01-01
A method for joining two or more items having surfaces of thermoplastic material includes the steps of depositing an electrically-conductive material upon the thermoplastic surface of at least one of the items, and then placing the other of the two items adjacent the one item so that the deposited material is in intimate contact with the surfaces of both the one and the other items. The deposited material and the thermoplastic surfaces contacted thereby are then exposed to microwave radiation so that the thermoplastic surfaces in contact with the deposited material melt, and then pressure is applied to the two items so that the melted thermoplastic surfaces fuse to one another. Upon discontinuance of the exposure to the microwave energy, and after permitting the thermoplastic surfaces to cool from the melted condition, the two items are joined together by the fused thermoplastic surfaces. The deposited material has a thickness which is preferably no greater than a skin depth, .delta..sub.s, which is related to the frequency of the microwave radiation and characteristics of the deposited material in accordance with an equation.
Generalized model of the microwave auditory effect
International Nuclear Information System (INIS)
Yitzhak, N M; Ruppin, R; Hareuveny, R
2009-01-01
A generalized theoretical model for evaluating the amplitudes of the sound waves generated in a spherical head model, which is irradiated by microwave pulses, is developed. The thermoelastic equation of motion is solved for a spherically symmetric heating pattern of arbitrary form. For previously treated heating patterns that are peaked at the sphere centre, the results reduce to those presented before. The generalized model is applied to the case in which the microwave absorption is concentrated near the sphere surface. It is found that, for equal average specific absorption rates, the sound intensity generated by a surface localized heating pattern is comparable to that generated by a heating pattern that is peaked at the centre. The dependence of the induced sound pressure on the shape of the microwave pulse is explored. Another theoretical extension, to the case of repeated pulses, is developed and applied to the interpretation of existing experimental data on the dependence of the human hearing effect threshold on the pulse repetition frequency.
The combined effects of e-beam irradiation and microwaves on starch, flour and ingredients
International Nuclear Information System (INIS)
Ferdes, O.S.; Martin, D.; Minea, R.; Tirlea, A.; Badea, M.
1998-01-01
The influences of both microwave field and electron beam irradiation, separately and combined, mainly on physical parameters of corn starch, wheat flour and black pepper were studied. These treatments have been used to achieve the hygienic and microbiological quality requirements of these materials and for their dehydration. The electron-beam irradiation has been carried out by using an ALIN-7 linear accelerator with the following parameters: electron mean energy 6 MeV, mean bean current 10 μA, pulse period 3.5 μs. repetition frequency 100 Hz. For microwave experiments, a special designed microwave applicator consisting of a special cavity, a power controlled generator with a 2.45 GHz standard frequency CW magnetron of 850 W maximum output power was used. The experiments were carried out in 5 variants: microwave treatment solely; electron beam irradiation solely; microwave treatment followed by electron beam irradiation; electron beam irradiation followed by microwave treatment; simultaneous microwave and electron beam treatment. The samples were treated by microwaves at 4 different power values from 250 W to 550 W for 5 different exposure times. The electron beam irradiation took place within the dose range of 1 - 10 kGy, at the same dose rate of approximately 2 kGy/min. The influence of these two physical fields on some common properties (r.h., pH), spectrophotometric (UV-VIS spectra), viscometric (rheograms) and microbiological (CFU/g) properties of the food materials was evaluated. A direct relationship between the variables was observed. The microwave effects are mainly thermal effects, although a non-thermal effect was also observed. The main microbiocidal action is due to the electron beam effect, although the microwave treatment affects sometimes significantly both the microbial population and its sensitivity to irradiation. The combined treatment indicates the presence of a synergistic effect of microwaves and electron-beams, which is of non
Microwave monolithic filter and phase shifter using magnetic nanostructures
Aslam, Shehreen; Khanna, Manoj; Veenugopal, Veerakumar; Kuanr, Bijoy K.
2018-05-01
Monolithic Microwave Integrated Circuit (MMIC) have major impact on the development of microwave communication technology. Transition metal based ferromagnetic nano-wired (FMNWs) substrate are of special interest in order to fabricate these MMIC devices. Their saturation magnetization is comparatively higher than ferrites which makes them suitable for high frequency (>10 ˜ 40 GHz) operation at zero or a small applied magnetic field. The CoFeB nanowires in anodic alumina templates were synthesized using three-electrode electro-deposition system. After electro-deposition, 1μm thick Cu layer was sputtered on the top surface of FMNW substrate and lithography was done to design microstrip lines. These microstrip transmission lines were tested for band-stop filters and phase shifters based on ferromagnetic resonance (FMR) over a wide applied magnetic field (H) range. It was observed that attenuation and frequency increase with the increase of magnetic field (upto 5.3 kOe). For phase shifter, the influence of magnetic material was studied for two frequency regions: (i) below FMR and (ii) above FMR. These two frequency regions were suitable for many practical device applications as the insertion loss was very less in these regions in comparison to resonance frequency regions. In the high frequency region (at 35 GHz), the optimal differential phase shift increased significantly to ˜ 250 deg/cm and around low frequency region (at 24 GHz), the optimal differential phase shift is ˜175 deg/cm at the highest field (H) value.
Microwave monolithic filter and phase shifter using magnetic nanostructures
Directory of Open Access Journals (Sweden)
Shehreen Aslam
2018-05-01
Full Text Available Monolithic Microwave Integrated Circuit (MMIC have major impact on the development of microwave communication technology. Transition metal based ferromagnetic nano-wired (FMNWs substrate are of special interest in order to fabricate these MMIC devices. Their saturation magnetization is comparatively higher than ferrites which makes them suitable for high frequency (>10 ∼ 40 GHz operation at zero or a small applied magnetic field. The CoFeB nanowires in anodic alumina templates were synthesized using three-electrode electro-deposition system. After electro-deposition, 1μm thick Cu layer was sputtered on the top surface of FMNW substrate and lithography was done to design microstrip lines. These microstrip transmission lines were tested for band-stop filters and phase shifters based on ferromagnetic resonance (FMR over a wide applied magnetic field (H range. It was observed that attenuation and frequency increase with the increase of magnetic field (upto 5.3 kOe. For phase shifter, the influence of magnetic material was studied for two frequency regions: (i below FMR and (ii above FMR. These two frequency regions were suitable for many practical device applications as the insertion loss was very less in these regions in comparison to resonance frequency regions. In the high frequency region (at 35 GHz, the optimal differential phase shift increased significantly to ∼ 250 deg/cm and around low frequency region (at 24 GHz, the optimal differential phase shift is ∼175 deg/cm at the highest field (H value.
Sato, Kiminori; Umeno, Hirohito; Nakashima, Tadashi
2010-01-01
This study aims to clarify the role of the maculae flavae (MFe) in the human adult vocal fold mucosa (VFM). Our current results concerning MFe in the human adult VFM are summarized. MFe were found to be composed of dense masses of vocal fold stellate cells (VFSCs) and extracellular matrices (EM), such as fibrous proteins and glycosaminoglycans, which are essential for the EM in the human VFM. VFSCs in the MFe demonstrated marked morphologic differences from conventional fibroblasts. They were irregular and stellate in shape and possessed slender cytoplasmic processes. They had well-developed intracellular organelles. A number of vesicles were present at the periphery of the cytoplasm. They constantly synthesized EM. The VFSCs possessed lipid droplets and stored vitamin A. VFSCs formed an independent cell category of cells in the human VFM. The VFSCs in aged adult MFe decreased their activity, and had abnormal metabolism. Human MFe including VFSCs seem to be involved in the metabolism of EM which are essential for the viscoelasticity of the lamina propria of the VFM, and to be responsible for maintaining the characteristic layered structure of the human VFM. Age-related changes in VFSCs were found to influence the metabolism of EM in the VFM. (c) 2010 S. Karger AG, Basel.
International Nuclear Information System (INIS)
Lai, N.D.
2003-07-01
. Applications to the generation of microwaves and submillimeter waves using these two-frequency sources in the visible spectrum are discussed. (author)
International Nuclear Information System (INIS)
Datlov, J.; Klima, R.; Kopecky, V.; Musil, J.; Zacek, F.
1977-01-01
An invention is described concerning high-frequency plasma heating and confinement in toroidal magnetic vessels. Microwave energy is applied to the plasma via one or more slowing-down structures exciting low phase velocity waves whose energy may be efficiently absorbed by plasma electrons. The wave momentum transfer results in a toroidal electrical current whose magnetic field together with an external magnetic field ensure plasma confinement. The low-frequency modulation of microwave energy may also be used for heating the ion plasma component. (J.U.)
A finite element method based microwave heat transfer modeling of frozen multi-component foods
Pitchai, Krishnamoorthy
Microwave heating is fast and convenient, but is highly non-uniform. Non-uniform heating in microwave cooking affects not only food quality but also food safety. Most food industries develop microwavable food products based on "cook-and-look" approach. This approach is time-consuming, labor intensive and expensive and may not result in optimal food product design that assures food safety and quality. Design of microwavable food can be realized through a simulation model which describes the physical mechanisms of microwave heating in mathematical expressions. The objective of this study was to develop a microwave heat transfer model to predict spatial and temporal profiles of various heterogeneous foods such as multi-component meal (chicken nuggets and mashed potato), multi-component and multi-layered meal (lasagna), and multi-layered food with active packages (pizza) during microwave heating. A microwave heat transfer model was developed by solving electromagnetic and heat transfer equations using finite element method in commercially available COMSOL Multiphysics v4.4 software. The microwave heat transfer model included detailed geometry of the cavity, phase change, and rotation of the food on the turntable. The predicted spatial surface temperature patterns and temporal profiles were validated against the experimental temperature profiles obtained using a thermal imaging camera and fiber-optic sensors. The predicted spatial surface temperature profile of different multi-component foods was in good agreement with the corresponding experimental profiles in terms of hot and cold spot patterns. The root mean square error values of temporal profiles ranged from 5.8 °C to 26.2 °C in chicken nuggets as compared 4.3 °C to 4.7 °C in mashed potatoes. In frozen lasagna, root mean square error values at six locations ranged from 6.6 °C to 20.0 °C for 6 min of heating. A microwave heat transfer model was developed to include susceptor assisted microwave heating of a
Microwave Excitation In ECRIS plasmas
International Nuclear Information System (INIS)
Ciavola, G.; Celona, L.; Consoli, F.; Gammino, S.; Maimone, F.; Barbarino, S.; Catalano, R. S.; Mascali, D.; Tumino, L.
2007-01-01
A number of phenomena related to the electron cyclotron resonance ion sources (ECRIS) has been better understood recently by means of the improvement of comprehension of the coupling mechanism between microwave generators and ECR plasma. In particular, the two frequency heating and the frequency tuning effect, that permit a remarkable increase of the current for the highest charge states ions, can be explained in terms of modes excitation in the cylindrical cavity of the plasma chamber. Calculations based on this theoretical approach have been performed, and the major results will be presented. It will be shown that the electric field pattern completely changes for a few MHz frequency variations and the changes in ECRIS performances can be correlated to the efficiency of the power transfer between electromagnetic field and plasma
Soleimani, Hassan; Abbas, Zulkifly; Yahya, Noorhana; Shameli, Kamyar; Soleimani, Hojjatollah; Shabanzadeh, Parvaneh
2012-01-01
The sol-gel method was carried out to synthesize nanosized Yttrium Iron Garnet (YIG). The nanomaterials with ferrite structure were heat-treated at different temperatures from 500 to 1000 °C. The phase identification, morphology and functional groups of the prepared samples were characterized by powder X-ray diffraction (PXRD), scanning electron microscopy (SEM) and Fourier transform infrared spectroscopy (FT-IR), respectively. The YIG ferrite nanopowder was composited with polyvinylidene fluoride (PVDF) by a solution casting method. The magnitudes of reflection and transmission coefficients of PVDF/YIG containing 6, 10 and 13% YIG, respectively, were measured using rectangular waveguide in conjunction with a microwave vector network analyzer (VNA) in X-band frequencies. The results indicate that the presence of YIG in polymer composites causes an increase in reflection coefficient and decrease in transmission coefficient of the polymer. PMID:22942718
Measurement of high-power microwave pulse under intense ...
Indian Academy of Sciences (India)
Abstract. KALI-1000 pulse power system has been used to generate single pulse nanosecond duration high-power microwaves (HPM) from a virtual cathode oscillator. (VIRCATOR) device. HPM power measurements were carried out using a transmitting– receiving system in the presence of intense high frequency (a few ...
Effects of classical resonances on the chaotic microwave ionization of highly excited hydrogen atoms
Energy Technology Data Exchange (ETDEWEB)
Jensen, R V
1987-05-01
Experimental measurements of the microwave ionization of highly excited hydrogen atoms with principal quantum numbers ranging from n = 32 to 90 are well described by a classical treatment of the nonlinear electron dynamics. In particular, the measurements of the threshold field for the onset of significant ionization exhibits a curious dependence on the microwave frequency with distinct peaks at rational values of the scaled frequency, n/sup 3/..cap omega.. = 1, 2/3, 1/2, 2/5, 1/3, 1/4, 1/5, which is in excellent agreement with the predictions for the onset of classical chaos in a one-dimensional model of the experiment. In the classical theory this frequency dependence of the threshold fields is due to the stabilizing effect of nonlinear resonances (''islands'') in the classical phase space which is greatly enhanced when the microwave perturbation is turned on slowly (adiabatically) as in the experiments. Quantum calculations for this one-dimensional model also exhibit this stabilizing effect due to the preferential excitation of localized quasi-energy states.
New calibration algorithms for dielectric-based microwave moisture sensors
New calibration algorithms for determining moisture content in granular and particulate materials from measurement of the dielectric properties at a single microwave frequency are proposed. The algorithms are based on identifying empirically correlations between the dielectric properties and the par...
Application of Memristors in Microwave Passive Circuits
Directory of Open Access Journals (Sweden)
M.Potrebic
2015-06-01
Full Text Available The recent implementation of the fourth fundamental electric circuit element, the memristor, opened new vistas in many fields of engineering applications. In this paper, we explore several RF/microwave passive circuits that might benefit from the memristor salient characteristics. We consider a power divider, coupled resonator bandpass filters, and a low-reflection quasi-Gaussian lowpass filter with lossy elements. We utilize memristors as configurable linear resistors and we propose memristor-based bandpass filters that feature suppression of parasitic frequency pass bands and widening of the desired rejection band. The simulations are performed in the time domain, using LTspice, and the RF/microwave circuits under consideration are modeled by ideal elements available in LTspice.
Multifrequency passive microwave remote sensing of soil moisture and roughness
International Nuclear Information System (INIS)
Paloscia, S.; Pampaloni, P.; Chiarantini, L.; Coppo, P.; Gagliani, S.; Luzi, G.
1993-01-01
The accuracy achievable in the surface soil moisture measurement of rough bare and vegetated soils, typical of the Italian landscape, has been investigated by using microwave experimental data collected by means of a multi-band sensor package (L, X, Ka and infrared bands). The thickness of soil that mainly affects the emission at the three microwave frequencies has been assessed. The sensitivity of L band emission to the moisture content of a soil layer about 5 cm thick has been confirmed, as well as the attenuation effect due to the surface roughness and presence of vegetation. A correction criterion based on the sensitivity to roughness and crop parameters of the highest frequencies (X and Ka bands) is proposed in order to increase the precision in soil moisture measurements
Microwave dielectric absorption spectroscopy aiming at novel dosimetry using DNAs
Energy Technology Data Exchange (ETDEWEB)
Izumi, Yoshinobu; Hirayama, Makoto; Matuo, Youichirou [Research Institute of Nuclear Engineering, University of Fukui, Fukui (Japan); Sunagawa, Takeyoshi [Fukui University of Technology, Fukui (Japan)
2017-03-15
We are developing L-band and S-band microwave dielectric absorption systems aiming novel dosimetry using DNAs, such as plasmid DNA and genomic DNA, and microwave technology. Each system is composed of a cavity resonator, analog signal generator, circulator, power meter, and oscilloscope. Since the cavity resonator is sensitive to temperature change, we have made great efforts to prevent the fluctuation of temperature. We have developed software for controlling and measurement. By using this system, we can measure the resonance frequency, f, and ΔQ (Q is a dimensionless parameter that describes how under-damped an oscillator or resonator is, and characterizes a resonator’s bandwidth relative to its center frequency) within about 3 minutes with high accuracy. This system will be expected to be applicable to DNAs evaluations and to novel dosimetric system.
Rochblatt, David J.; Seidel, Boris L.
1992-01-01
This microwave holography technique utilizes the Fourier transform relation between the complex far field radiation pattern of an antenna and the complex aperture field distribution. Resulting aperture phase and amplitude distribution data can be used to precisely characterize various crucial performance parameters, including panel alignment, panel shaping, subreflector position, antenna aperture illumination, directivity at various frequencies, and gravity deformation effects. The methodology of data processing presented here was successfully applied to the Deep Space Network (DSN) 34-m beam waveguide antennas. The antenna performance was improved at all operating frequencies by reducing the main reflector mechanical surface rms error to 0.43 mm. At Ka-band (32 GHz), the estimated improvement is 4.1 dB, resulting in an aperture efficiency of 52 percent. The performance improvement was verified by efficiency measurements and additional holographic measurements.
Low-Temperature Dynamic Nuclear Polarization at 9.4 Tesla With a 30 Milliwatt Microwave Source
Thurber, Kent R.; Yau, Wai-Ming; Tycko, Robert
2010-01-01
Dynamic nuclear polarization (DNP) can provide large signal enhancements in nuclear magnetic resonance (NMR) by transfer of polarization from electron spins to nuclear spins. We discuss several aspects of DNP experiments at 9.4 Tesla (400 MHz resonant frequency for 1H, 264 GHz for electron spins in organic radicals) in the 7–80 K temperature range, using a 30 mW, frequency-tunable microwave source and a quasi-optical microwave bridge for polarization control and low-loss microwave transmission. In experiments on frozen glycerol/water doped with nitroxide radicals, DNP signal enhancements up to a factor of 80 are observed (relative to 1H NMR signals with thermal equilibrium spin polarization). The largest sensitivity enhancements are observed with a new triradical dopant, DOTOPA-TEMPO. Field modulation with a 10 G root-mean-squared amplitude during DNP increases the nuclear spin polarizations by up to 135%. Dependencies of 1H NMR signal amplitudes, nuclear spin relaxation times, and DNP build-up times on the dopant and its concentration, temperature, microwave power, and modulation frequency are reported and discussed. The benefits of low-temperature DNP can be dramatic: the 1H spin polarization is increased approximately 1000-fold at 7 K with DNP, relative to thermal polarization at 80 K. PMID:20392658
Microwave properties of Ni-based ferromagnetic inverse opals
Kostylev, M.; Stashkevich, A. A.; Roussigné, Y.; Grigoryeva, N. A.; Mistonov, A. A.; Menzel, D.; Sapoletova, N. A.; Napolskii, K. S.; Eliseev, A. A.; Lukashin, A. V.; Grigoriev, S. V.; Samarin, S. N.
2012-11-01
Investigations of microwave properties of Ni-based inverse ferromagnetic opal-like film with the [111] axis of the fcc structure along the normal direction to the film have been carried out in the 2-18 GHz frequency band. We observed multiple spin wave resonances for the magnetic field applied perpendicular to the film, i.e., along the [111] axis of this artificial crystal. For the field applied in the film plane, a broad band of microwave absorption is observed, which does not contain a fine structure. The field ranges of the responses observed are quite different for these two magnetization directions. This suggests a collective magnetic ground state or shape anisotropy and collective microwave dynamics for this foam-like material. This result is in agreement with SQUID measurements of hysteresis loops for the material. Two different models for this collective behavior are suggested that satisfactorily explain the major experimental results.
Polarization of a periodic solar microwave burst
Energy Technology Data Exchange (ETDEWEB)
Kaufmann, P [Universidade Mackenzie, Sao Paulo (Brazil). Centro de Radio-Astronomia e Astrofisica
1976-09-01
No fluctuations in polarization have been found during a 7 GHz solar burst showing 17s periodic pulses in intensity. Polarization effects can be produced by the propagation media in the active centre, which are not affected directly by the burst source, but situated more deeply than the observed heights at that microwave frequency.
International Nuclear Information System (INIS)
Tseng, Ching-Fang; Lu, Shu-Cheng
2013-01-01
Highlights: ► The microwave dielectric properties of (1−x)Mg(Zr 0.05 Ti 0.95 )O 3 –xSrTiO 3 system have been discussed. ► The dielectric constant and τ f increased; nevertheless, the Q × f decreased with an increase in x. ► Second phases were formed and affected the microwave dielectric properties of (1−x)MZT–xST system. ► ε r of 20.8, Q × f of 257,000, and τ f of 0.2 ppm/°C were obtained for the 0.06Mg(Zr 0.05 Ti 0.95 )O 3 –0.04SrTiO 3 ceramics. ► Due to high-quality factor and near-zero τ f , MZT–ST demonstrate a good potential for use in microwave devices. -- Abstract: The microwave dielectric properties and microstructures were investigated in the (1−x)Mg(Zr 0.05 Ti 0.95 )O 3 –xSrTiO 3 (hereafter referred to as (1−x)MZT–xST) system. The compounds were prepared via the conventional solid-state reaction. Compositions in the (1−x)Mg(Zr 0.05 Ti 0.95 )O 3 –xSrTiO 3 system were designed to compensate the negative temperature coefficient of the resonant frequency of Mg(Zr 0.05 Ti 0.95 )O 3 . The values displayed nonmonotonic mixture-like behavior, because the TiO 2 phase was formed in the MZT composite ceramics with increasing x. A close zero τ f of 0.2 ppm/°C could be achieved at 0.96MZT–0.04ST with ε r = 20.8 and Q × f = 257,000 GHz
Sources of type III solar microwave bursts
Directory of Open Access Journals (Sweden)
Zhdanov D.A.
2016-06-01
Full Text Available Microwave fine structures allow us to study plasma evolution in an energy release region. The Siberian Solar Radio Telescope (SSRT is a unique instrument designed to examine fine structures at 5.7 GHz. A complex analysis of data from RATAN-600, 4–8 GHz spectropolarimeter, and SSRT, simultaneously with EUV data, made it possible to localize sources of III type microwave bursts in August 10, 2011 event within the entire frequency band of burst occurrence, as well as to determine the most probable region of primary energy release. To localize sources of III type bursts from RATAN-600 data, an original method for data processing has been worked out. At 5.7 GHz, the source of bursts was determined along two coordinates, whereas at 4.5, 4.7, 4.9, 5.1, 5.3, 5.5, and 6.0 GHz, their locations were identified along one coordinate. The size of the burst source at 5.1 GHz was found to be maximum as compared to those at other frequencies.
Ultra High-Speed Radio Frequency Switch Based on Photonics.
Ge, Jia; Fok, Mable P
2015-11-26
Microwave switches, or Radio Frequency (RF) switches have been intensively used in microwave systems for signal routing. Compared with the fast development of microwave and wireless systems, RF switches have been underdeveloped particularly in terms of switching speed and operating bandwidth. In this paper, we propose a photonics based RF switch that is capable of switching at tens of picoseconds speed, which is hundreds of times faster than any existing RF switch technologies. The high-speed switching property is achieved with the use of a rapidly tunable microwave photonic filter with tens of gigahertz frequency tuning speed, where the tuning mechanism is based on the ultra-fast electro-optics Pockels effect. The RF switch has a wide operation bandwidth of 12 GHz and can go up to 40 GHz, depending on the bandwidth of the modulator used in the scheme. The proposed RF switch can either work as an ON/OFF switch or a two-channel switch, tens of picoseconds switching speed is experimentally observed for both type of switches.
Microwave plasma for hydrogen production from liquids
Directory of Open Access Journals (Sweden)
Czylkowski Dariusz
2016-06-01
Full Text Available The hydrogen production by conversion of liquid compounds containing hydrogen was investigated experimentally. The waveguide-supplied metal cylinder-based microwave plasma source (MPS operated at frequency of 915 MHz at atmospheric pressure was used. The decomposition of ethanol, isopropanol and kerosene was performed employing plasma dry reforming process. The liquid was introduced into the plasma in the form of vapour. The amount of vapour ranged from 0.4 to 2.4 kg/h. Carbon dioxide with the flow rate ranged from 1200 to 2700 NL/h was used as a working gas. The absorbed microwave power was up to 6 kW. The effect of absorbed microwave power, liquid composition, liquid flow rate and working gas fl ow rate was analysed. All these parameters have a clear influence on the hydrogen production efficiency, which was described with such parameters as the hydrogen production rate [NL(H2/h] and the energy yield of hydrogen production [NL(H2/kWh]. The best achieved experimental results showed that the hydrogen production rate was up to 1116 NL(H2/h and the energy yield was 223 NL(H2 per kWh of absorbed microwave energy. The results were obtained in the case of isopropanol dry reforming. The presented catalyst-free microwave plasma method can be adapted for hydrogen production not only from ethanol, isopropanol and kerosene, but also from different other liquid compounds containing hydrogen, like gasoline, heavy oils and biofuels.
... Products and Procedures Home, Business, and Entertainment Products Microwave Ovens Share Tweet Linkedin Pin it More sharing ... 1030.10 - Microwave Ovens Required Reports for the Microwave Oven Manufacturers or Industry Exemption from Certain Reporting ...
Microwave-assisted shingled magnetic recording simulations on an exchange-coupled composite medium
Energy Technology Data Exchange (ETDEWEB)
Tanaka, T., E-mail: t-tanaka@ed.kyushu-u.ac.jp [Department of Electronics, Graduate School of Information Science and Electrical Engineering, Kyushu University, Motoota 744, Nishi-ku, Fukuoka 819-0395 (Japan); Kashiwagi, S. [Department of Electronics, Graduate School of Information Science and Electrical Engineering, Kyushu University, Motoota 744, Nishi-ku, Fukuoka 819-0395 (Japan); Kanai, Y. [Department of Information and Electronics Engineering, Niigata Institute of Technology, Fujihashi 1719, Kashiwazaki, Niigata 945-1195 (Japan); Matsuyama, K. [Department of Electronics, Graduate School of Information Science and Electrical Engineering, Kyushu University, Motoota 744, Nishi-ku, Fukuoka 819-0395 (Japan)
2016-10-15
The potential of microwave-assisted magnetic recording combined with the shingled recording scheme has been studied by simulating read/write processes on exchange-coupled composite media focusing on recording characteristics in the cross-track direction. Microwave fields enhance writability, especially at the track edge, resulting in lower noise and higher signal-to-noise ratio (SNR), which enables higher track density in the shingled recording scheme. Read/write simulations of microwave-assisted shingled recording achieve 1.4 Mtracks/in. while retaining high SNR. Further increases in SNR and track density will require either a narrower reader or track edge noise reduction. - Highlights: • Signal recording of shingled magnetic recording using an asymmetric single pole type head combined with a microwave assistance was numerically demonstrated. • Writability is improved by microwave fields with a moderate frequency at the track edge of the shielded side, resulting in higher signal-to-noise ratio. • 1.41 Mtpi of track density is feasible for the recording scheme of shingled magnetic recording with microwave assistance.
Microwave-assisted shingled magnetic recording simulations on an exchange-coupled composite medium
International Nuclear Information System (INIS)
Tanaka, T.; Kashiwagi, S.; Kanai, Y.; Matsuyama, K.
2016-01-01
The potential of microwave-assisted magnetic recording combined with the shingled recording scheme has been studied by simulating read/write processes on exchange-coupled composite media focusing on recording characteristics in the cross-track direction. Microwave fields enhance writability, especially at the track edge, resulting in lower noise and higher signal-to-noise ratio (SNR), which enables higher track density in the shingled recording scheme. Read/write simulations of microwave-assisted shingled recording achieve 1.4 Mtracks/in. while retaining high SNR. Further increases in SNR and track density will require either a narrower reader or track edge noise reduction. - Highlights: • Signal recording of shingled magnetic recording using an asymmetric single pole type head combined with a microwave assistance was numerically demonstrated. • Writability is improved by microwave fields with a moderate frequency at the track edge of the shielded side, resulting in higher signal-to-noise ratio. • 1.41 Mtpi of track density is feasible for the recording scheme of shingled magnetic recording with microwave assistance.
In vivo microwave-based thermoacoustic tomography of rats (Conference Presentation)
Lin, Li; Zhou, Yong; Wang, Lihong V.
2016-03-01
Microwave-based thermoacoustic tomography (TAT), based on the measurement of ultrasonic waves induced by microwave pulses, can reveal tissue dielectric properties that may be closely related to the physiological and pathological status of the tissues. Using microwaves as the excitation source improved imaging depth because of their deep penetration into biological tissues. We demonstrate, for the first time, in vivo microwave-based thermoacoustic imaging in rats. The transducer is rotated around the rat in a full circle, providing a full two-dimensional view. Instead of a flat ultrasonic transducer, we used a virtual line detector based on a cylindrically focused transducer. A 3 GHz microwave source with 0.6 µs pulse width and an electromagnetically shielded transducer with 2.25 MHz central frequency provided clear cross-sectional images of the rat's body. The high imaging contrast, based on the tissue's rate of absorption, and the ultrasonically defined spatial resolution combine to reveal the spine, kidney, muscle, and other deeply seated anatomical features in the rat's abdominal cavity. This non-invasive and non-ionizing imaging modality achieved an imaging depth beyond 6 cm in the rat's tissue. Cancer diagnosis based on information about tissue properties from microwave band TAT can potentially be more accurate than has previously been achievable.
High-frequency applications of high-temperature superconductor thin films
Klein, N.
2002-10-01
High-temperature superconducting thin films offer unique properties which can be utilized for a variety of high-frequency device applications in many areas related to the strongly progressing market of information technology. One important property is an exceptionally low level of microwave absorption at temperatures attainable with low power cryocoolers. This unique property has initiated the development of various novel type of microwave devices and commercialized subsystems with special emphasis on application in advanced microwave communication systems. The second important achievement related to efforts in oxide thin and multilayer technology was the reproducible fabrication of low-noise Josephson junctions in high-temperature superconducting thin films. As a consequence of this achievement, several novel nonlinear high-frequency devices, most of them exploiting the unique features of the ac Josephson effect, have been developed and found to exhibit challenging properties to be utilized in basic metrology and Terahertz technology. On the longer timescale, the achievements in integrated high-temperature superconductor circuit technology may offer a strong potential for the development of digital devices with possible clock frequencies in the range of 100 GHz.
High-frequency applications of high-temperature superconductor thin films
International Nuclear Information System (INIS)
Klein, N.
2002-01-01
High-temperature superconducting thin films offer unique properties which can be utilized for a variety of high-frequency device applications in many areas related to the strongly progressing market of information technology. One important property is an exceptionally low level of microwave absorption at temperatures attainable with low power cryocoolers. This unique property has initiated the development of various novel type of microwave devices and commercialized subsystems with special emphasis on application in advanced microwave communication systems. The second important achievement related to efforts in oxide thin and multilayer technology was the reproducible fabrication of low-noise Josephson junctions in high-temperature superconducting thin films. As a consequence of this achievement, several novel nonlinear high-frequency devices, most of them exploiting the unique features of the ac Josephson effect, have been developed and found to exhibit challenging properties to be utilized in basic metrology and Terahertz technology. On the longer timescale, the achievements in integrated high-temperature superconductor circuit technology may offer a strong potential for the development of digital devices with possible clock frequencies in the range of 100 GHz. (author)
V-mode polarization of the cosmic microwave background
International Nuclear Information System (INIS)
Giovannini, Massimo
2009-01-01
The V-mode polarization of the cosmic microwave background is discussed in a weakly magnetized plasma. The VV and VT angular power spectra are computed for adiabatic initial conditions of the Einstein-Boltzmann hierarchy. Depending upon the frequency channel and upon the magnetic field intensity, the VT power spectra of the circular polarization can even be 7 orders of magnitude larger than a putative B-mode polarization stemming from the lensing of the primary anisotropies. Specific programs aimed at the direct detection of the V-mode polarization of the cosmic microwave background could provide a new observational tool for the scrutiny of predecoupling physics.
Johnson, B. T.; Olson, W. S.; Skofronick-Jackson, G.
2016-01-01
A simplified approach is presented for assessing the microwave response to the initial melting of realistically shaped ice particles. This paper is divided into two parts: (1) a description of the Single Particle Melting Model (SPMM), a heuristic melting simulation for ice-phase precipitation particles of any shape or size (SPMM is applied to two simulated aggregate snow particles, simulating melting up to 0.15 melt fraction by mass), and (2) the computation of the single-particle microwave scattering and extinction properties of these hydrometeors, using the discrete dipole approximation (via DDSCAT), at the following selected frequencies: 13.4, 35.6, and 94.0GHz for radar applications and 89, 165.0, and 183.31GHz for radiometer applications. These selected frequencies are consistent with current microwave remote-sensing platforms, such as CloudSat and the Global Precipitation Measurement (GPM) mission. Comparisons with calculations using variable-density spheres indicate significant deviations in scattering and extinction properties throughout the initial range of melting (liquid volume fractions less than 0.15). Integration of the single-particle properties over an exponential particle size distribution provides additional insight into idealized radar reflectivity and passive microwave brightness temperature sensitivity to variations in size/mass, shape, melt fraction, and particle orientation.
Cryogenic tunable microwave cavity at 13GHz for hyperfine spectroscopy of antiprotonic helium
International Nuclear Information System (INIS)
Sakaguchi, J.; Gilg, H.; Hayano, R.S.; Ishikawa, T.; Suzuki, K.; Widmann, E.; Yamaguchi, H.; Caspers, F.; Eades, J.; Hori, M.; Barna, D.; Horvath, D.; Juhasz, B.; Torii, H.A.; Yamazaki, T.
2004-01-01
For the precise measurement of the hyperfine structure of antiprotonic helium, microwave radiation of 12.9GHz frequency is needed, tunable over +/-100MHz. A cylindrical microwave cavity is used whose front and rear faces are meshed to allow the antiprotons and laser beams to enter. The cavity is embedded in a cryogenic helium gas target. Frequency tuning of ∼300MHz with Q values of 2700-3000 was achieved using over-coupling and an external triple stub tuner. We also present Monte-Carlo simulations of the stopping distribution of antiprotons in the low-density helium gas using the GEANT4 package with modified energy loss routines
Harrington, R. F.; Swift, C. T.; Fedors, J. C.
1980-01-01
Airborne stepped-frequency microwave radiometer (SFMR) observations of the Fabry-Perot interference fringes of ice-water systems are discussed. The microwave emissivity at normal incidence of a smooth layered dielectric medium over a semi-infinite dielectric medium is examined for the case of ice over water as a function of ice thickness and attenuation coefficient, and the presence of quarter-wavelength oscillations in emissivity as the ice thickness and frequency are varied is pointed out. Experimental observations of pronounced quarter-wavelength oscillations in radiometric brightness temperature due to the Fabry-Perot interference fringes over smooth sea ice and lake ice varying in roughness as the radiometer frequencies were scanned are then presented.
Microwave loss mechanisms in Ba0.25Sr0.75TiO3 films
International Nuclear Information System (INIS)
Vorobiev, A.; Rundqvist, P.; Gevorgian, S.
2005-01-01
Trilayer Au(Pt)/Ba 0.25 Sr 0.75 TiO 3 /(Pt)Au thin film varactors are fabricated on high resistive Si substrate and characterized at dc, rf and microwave frequencies. In the frequency range of 10-45 GHz the varactors reveal relatively low losses, the loss tangent is less than 0.025 at 45 GHz. Due to the thick and highly conductive Pt/Au electrodes the metal losses are less than 10%. However, the loss tangent of the ferroelectric film is still 3-5 times higher than that in Ba 0.27 Sr 0.73 TiO 3 single crystal. The analysis of the dc field dependent loss tangent and permittivity in a wide frequency range show that these additional losses are mainly due to the charged defects. Extrapolation of measured low frequency (1 MHz) loss tangents to the microwave region using the power law ω 1/3 is in good agreement with the experiment. We assume that the oxygen vacancies within the grain boundaries of ferroelectric film act as charged defects and cause extrinsic microwave losses. The knowledge of the extrinsic loss mechanism and corresponding microstructure defects is useful in optimization of the varactor design, deposition, and/or annealing process and further improvement of the varactor performance
Soft magnetism, magnetostriction, and microwave properties of FeGaB thin films
International Nuclear Information System (INIS)
Lou, J.; Insignares, R. E.; Cai, Z.; Ziemer, K. S.; Liu, M.; Sun, N. X.
2007-01-01
A series of (Fe 100-y Ga y ) 1-x B x (x=0-21 and y=9-17) films were deposited; their microstructure, soft magnetism, magnetostrictive behavior, and microwave properties were investigated. The addition of B changes the FeGaB films from polycrystalline to amorphous phase and leads to excellent magnetic softness with coercivity s , self-biased ferromagnetic resonance (FMR) frequency of 1.85 GHz, narrow FMR linewidth (X band) of 16-20 Oe, and a high saturation magnetostriction constant of 70 ppm. The combination of these properties makes the FeGaB films potential candidates for tunable magnetoelectric microwave devices and other rf/microwave magnetic device applications
Interstitial microwave hyperthermia treatment investigations
International Nuclear Information System (INIS)
Siauve, N; Lormel, C
2012-01-01
Microwave ablation also called interstitial hyperthermia is a medical procedure used in the treatment of many cancers, cardiac arrhythmias and other medical conditions. With this medical therapy, an electromagnetic source (antenna) is directly positioned in the target tissue and a sufficient power is injected to necrosis the tissue. The aim of this study is to propose a design procedure and develop the associated tools, for determining the optimal shape, dimensions, type and operating frequency of antenna according to the target volume. In this context, a 3D numerical predictive model of temperature elevation induced by the electric fields and two benches for thermal and electrical tissues properties characterization have been developed. To validate the procedure and the different tools, an experimental bench test which includes interstitial antenna, external microwave generator, phantom that represents the target tissue and measurement system of temperature and electric field has been elaborated.
Microwave Regenerable Air Purification Device
Atwater, James E.; Holtsnider, John T.; Wheeler, Richard R., Jr.
1996-01-01
The feasibility of using microwave power to thermally regenerate sorbents loaded with water vapor, CO2, and organic contaminants has been rigorously demonstrated. Sorbents challenged with air containing 0.5% CO2, 300 ppm acetone, 50 ppm trichloroethylene, and saturated with water vapor have been regenerated, singly and in combination. Microwave transmission, reflection, and phase shift has also been determined for a variety of sorbents over the frequency range between 1.3-2.7 GHz. This innovative technology offers the potential for significant energy savings in comparison to current resistive heating methods because energy is absorbed directly by the material to be heated. Conductive, convective and radiative losses are minimized. Extremely rapid heating is also possible, i.e., 1400 C in less than 60 seconds. Microwave powered thermal desorption is directly applicable to the needs of Advance Life Support in general, and of EVA in particular. Additionally, the applicability of two specific commercial applications arising from this technology have been demonstrated: the recovery for re-use of acetone (and similar solvents) from industrial waste streams using a carbon based molecular sieve; and the separation and destruction of trichloroethylene using ZSM-5 synthetic zeolite catalyst, a predominant halocarbon environmental contaminant. Based upon these results, Phase II development is strongly recommended.
Directory of Open Access Journals (Sweden)
S. Lalléchère
2017-05-01
Full Text Available The aim of this proposal is to demonstrate the ability of tridimensional (3-D electromagnetic modeling tool for the characterization of composite materials in microwave frequency band range. Indeed, an automated procedure is proposed to generate random materials, proceed to 3-D simulations, and compute shielding effectiveness (SE statistics with finite integration technique. In this context, 3-D electromagnetic models rely on random locations of conductive inclusions; results are compared with classical electromagnetic mixing theory (EMT approaches (e.g. Maxwell-Garnett formalism, and dynamic homogenization model (DHM. The article aims to demonstrate the interest of the proposed approach in various domains such as propagation and electromagnetic compatibility (EMC.
Eigenmodes of a microwave cavity partially filled with an anisotropic hot plasma
International Nuclear Information System (INIS)
Shoucri, M.M.; Gagne, R.R.J.
1978-01-01
The eigenmodes of a microwave cavity, which contains a uniform hot plasma with anisotropic temperature, are determined using the linearized fluid equations together with Maxwell's equations. Conditions are discussed under which hot plasma mode and the cold plasma mode are decoupled. The frequency shift of the microwave cavity is calculated and the theoretical results are shown to be in very good qualitative agreement with published experimental results obtained for the TM 010 mode. (author)
Zhang, Zhongya; Pan, Bing; Grédiac, Michel; Song, Weidong
2018-04-01
The virtual fields method (VFM) is generally used with two-dimensional digital image correlation (2D-DIC) or grid method (GM) for identifying constitutive parameters. However, when small out-of-plane translation/rotation occurs to the test specimen, 2D-DIC and GM are prone to yield inaccurate measurements, which further lessen the accuracy of the parameter identification using VFM. In this work, an easy-to-implement but effective "special" stereo-DIC (SS-DIC) method is proposed for accuracy-enhanced VFM identification. The SS-DIC can not only deliver accurate deformation measurement without being affected by unavoidable out-of-plane movement/rotation of a test specimen, but can also ensure evenly distributed calculation data in space, which leads to simple data processing. Based on the accurate kinematics fields with evenly distributed measured points determined by SS-DIC method, constitutive parameters can be identified by VFM with enhanced accuracy. Uniaxial tensile tests of a perforated aluminum plate and pure shear tests of a prismatic aluminum specimen verified the effectiveness and accuracy of the proposed method. Experimental results show that the constitutive parameters identified by VFM using SS-DIC are more accurate and stable than those identified by VFM using 2D-DIC. It is suggested that the proposed SS-DIC can be used as a standard measuring tool for mechanical identification using VFM.
International Nuclear Information System (INIS)
Nelson, G.J.; Stewart, R.T.
1979-01-01
In a previous paper the authors showed that for extended bursts a good correlation exists between the observed 100 keV X-ray flux density and the 3.75 or 9.4 GHz microwave flux density. They now propose a source model for the extended bursts in which the microwave emission comes from thin shells at increasing heights for decreasing frequencies. This model with reasonable parameter values gives the observed microwave spectral characteristics and also explains why the X-ray and microwave flux densities are so well correlated
GPM GROUND VALIDATION ADVANCED MICROWAVE RADIOMETER RAIN IDENTIFICATION (ADMIRARI) GCPEX V1
National Aeronautics and Space Administration — The GPM Ground Validation Advanced Microwave Radiometer Rain Identification (ADMIRARI) GCPEx dataset measures brightness temperature at three frequencies (10.7, 21.0...
Integration of semiconductor and ceramic superconductor devices for microwave applications
International Nuclear Information System (INIS)
Klopman, B.B.G.; Weijers, H.W.; Gao, J.; Gerritsma, G.J.; Rogalla, H.
1991-01-01
Due to the very low-loss properties of ceramic superconductors high-performance microwave resonators and filters can be realized. The fact that these devices may be operated at liquid nitrogen temperature, facilitates the integration with semiconductor devices. Examples are bandpass amplifiers, microwave-operated SQUIDs combined with GaAs preamplifiers, detectors, and MOSFET low-frequency amplifiers. This paper discusses the design of such circuits on a single one inch alumina substrate using surface mount techniques. Furthermore data on circuits that have been realized in our laboratory will be presented
Microwave absorbing property and complex permittivity and permeability of graphene–CdS nanocomposite
International Nuclear Information System (INIS)
Zhang, Dong-Dong; Zhao, Dong-Lin; Zhang, Ji-Ming; Bai, Li-Zhong
2014-01-01
Graphical abstract: Graphene–CdS (G–CdS) nanocomposite with a good structural interface and enhanced microwave absorption has been successfully and directly synthesized from graphene oxide via a facile hydrothermal approach. The permittivity of G–CdS nanocomposite presents triple dielectric relaxations by constructing a good structural G–CdS interface. The triple dielectric relaxations are critical to improve the microwave absorption of the G–CdS nanocomposite. Highlights: • Graphene–CdS (G–CdS) nanocomposite was directly synthesized from graphene oxide. • The G–CdS nanocomposite exhibits enhanced microwave absorption. • The permittivity of G–CdS nanocomposite presents triple dielectric relaxations. -- Abstract: The graphene–CdS (G–CdS) nanocomposite with enhanced microwave absorption was directly synthesized from graphene oxide (GO) via a facile hydrothermal approach, during which the formation of CdS nanoparticles and the reduction of GO occured simultaneously. The morphology, structure, microwave absorbing property, complex permittivity and permeability of G–CdS nanocomposite were systematically investigated by transmission electron microscope, X-ray diffraction and the coaxial line method. The complex permittivity of G–CdS nanocomposite presents triple dielectric relaxations with constructing a good structural graphene–CdS interface. The triple dielectric relaxations were critical to improve the microwave absorption of G–CdS nanocomposite. The G–CdS nanocomposite achieved a reflection loss below –10 dB in the frequency range of 5.2–18 GHz when adjusting the thicknesses from 2 to 5 mm, which was mainly ascribed to the proper electromagnetic matching of the CdS nanoparticles and graphene sheets, and the triple dielectric relaxations. The G–CdS nanocomposite is promising as a lightweight and wide-frequency microwave absorber
An investigation into the use of large area silicon semiconductors in microwave systems
International Nuclear Information System (INIS)
Holliday, H.R.
1999-09-01
Semiconductor microwave devices are usually manufactured using micron or sub-micron geometries. The equipment needed for these techniques has a high capital cost and demands high overheads. The material traditionally processed for microwave applications is gallium arsenide but during the period of this investigation a move towards the use of silicon and silicon germanium has emerged. This study, which is essentially practical, covers a range of new ideas for components using large area silicon devices. In the course of the study considerable progress has also been made in the understanding of the behaviour of silicon at microwave frequencies, and some of the initial Concepts were shown to be invalid. An accurate determination of the dielectric constant of silicon has been made using quasi optical techniques at microwave frequencies. The fabrication techniques described originate from methods used at Q-par Angus to manufacture large area silicon nuclear radiation detectors. Developed at the University of Birmingham, these are 'wet chemistry' methods that preclude the need for diffusion or other conventional semiconductor processing techniques. Novel microwave components have been developed using these techniques. These include an optically controlled attenuator with multioctave bandwidth and good dynamic range; window devices to reduce the radar cross section of microwave antennas; and microwave cavity devices including a variable-Q cavity. Concepts for millimeter wave filters are discussed, as are areas for further research. During the attenuator study Wheeler's equations have been extended to cover truncated microstrip. It was observed at an early stage in the work that optical excitation was very effective as a method of controlling the devices. This fits well with current trends in electro-optical devices. The piezo resistance effect in silicon has been briefly investigated and a mechanical attenuator exploiting this effect has been developed. (author)
The AMY experiment: Microwave emission from air shower plasmas
Directory of Open Access Journals (Sweden)
Alvarez-Muñiz J.
2016-01-01
Full Text Available You The Air Microwave Yield (AMY experiment investigate the molecular bremsstrahlung radiation emitted in the GHz frequency range from an electron beam induced air-shower. The measurements have been performed at the Beam Test Facility (BTF of Frascati INFN National Laboratories with a 510 MeV electron beam in a wide frequency range between 1 and 20 GHz. We present the apparatus and the results of the tests performed.
Optimization of the imaging response of scanning microwave microscopy measurements
Energy Technology Data Exchange (ETDEWEB)
Sardi, G. M.; Lucibello, A.; Proietti, E.; Marcelli, R., E-mail: romolo.marcelli@imm.cnr.it [National Research Council, Institute for Microelectronics and Microsystems, Via del Fosso del Cavaliere 100, 00133 Rome (Italy); Kasper, M.; Gramse, G. [Biophysics Institute, Johannes Kepler University, Gruberstrasse 40, 4020 Linz (Austria); Kienberger, F. [Keysight Technologies Austria GmbH, Gruberstrasse 40, 4020 Linz (Austria)
2015-07-20
In this work, we present the analytical modeling and preliminary experimental results for the choice of the optimal frequencies when performing amplitude and phase measurements with a scanning microwave microscope. In particular, the analysis is related to the reflection mode operation of the instrument, i.e., the acquisition of the complex reflection coefficient data, usually referred as S{sub 11}. The studied configuration is composed of an atomic force microscope with a microwave matched nanometric cantilever probe tip, connected by a λ/2 coaxial cable resonator to a vector network analyzer. The set-up is provided by Keysight Technologies. As a peculiar result, the optimal frequencies, where the maximum sensitivity is achieved, are different for the amplitude and for the phase signals. The analysis is focused on measurements of dielectric samples, like semiconductor devices, textile pieces, and biological specimens.
Microwave transmission measurements through a magnetic photonic crystal
Radwan, Mohamed Zein; Dewar, Graeme
We have measured the 12 - 18 GHz microwave transmission through, and the reflection from, a nickel zinc ferrite penetrated by a wire lattice. The metamaterial efficiently transmitted microwaves under conditions for which the index of refraction was negative. The wires, 0.29 mm in diameter, were threaded through Teflon tubes and centered in holes 1.7 mm in diameter drilled through the ferrite. The holes formed a square array with a lattice constant of 3.0 mm. A ferrite sample containing the wire array filled a length of 3.0 cm inside standard WR-62 waveguide and a static magnetic field between 0.042 and 13.0 kOe was applied parallel to the wires. We measured the transmission relative to an open waveguide and the reflection relative to a reflective metal plate across the waveguide face. We observed transmission modes at combinations of magnetic field and microwave frequency for which both the permeability of the ferrite and permittivity of the wire array were negative.
A microwave resonance dew-point hygrometer
Underwood, R. J.; Cuccaro, R.; Bell, S.; Gavioso, R. M.; Madonna Ripa, D.; Stevens, M.; de Podesta, M.
2012-08-01
We report the first measurements of a quasi-spherical microwave resonator used as a dew-point hygrometer. In conventional dew-point hygrometers, the condensation of water from humid gas flowing over a mirror is detected optically, and the mirror surface is then temperature-controlled to yield a stable condensed layer. In our experiments we flowed moist air from a humidity generator through a quasi-spherical resonator and detected the onset of condensation by measuring the frequency ratio of selected microwave modes. We verified the basic operation of the device over the dew-point range 9.5-13.5 °C by comparison with calibrated chilled-mirror hygrometers. These tests indicate that the microwave method may allow a quantitative estimation of the volume and thickness of the water layer which is condensed on the inner surface of the resonator. The experiments reported here are preliminary due to the limited time available for the work, but show the potential of the method for detecting not only water but a variety of other liquid or solid condensates. The robust all-metal construction should make the device appropriate for use in industrial applications over a wide range of temperatures and pressures.
A microwave resonance dew-point hygrometer
International Nuclear Information System (INIS)
Underwood, R J; Bell, S; Stevens, M; De Podesta, M; Cuccaro, R; Gavioso, R M; Ripa, D Madonna
2012-01-01
We report the first measurements of a quasi-spherical microwave resonator used as a dew-point hygrometer. In conventional dew-point hygrometers, the condensation of water from humid gas flowing over a mirror is detected optically, and the mirror surface is then temperature-controlled to yield a stable condensed layer. In our experiments we flowed moist air from a humidity generator through a quasi-spherical resonator and detected the onset of condensation by measuring the frequency ratio of selected microwave modes. We verified the basic operation of the device over the dew-point range 9.5–13.5 °C by comparison with calibrated chilled-mirror hygrometers. These tests indicate that the microwave method may allow a quantitative estimation of the volume and thickness of the water layer which is condensed on the inner surface of the resonator. The experiments reported here are preliminary due to the limited time available for the work, but show the potential of the method for detecting not only water but a variety of other liquid or solid condensates. The robust all-metal construction should make the device appropriate for use in industrial applications over a wide range of temperatures and pressures. (paper)
High frequency electromagnetic dosimetry
Sánchez-Hernández, David A
2009-01-01
Along with the growth of RF and microwave technology applications, there is a mounting concern about the possible adverse effects over human health from electromagnetic radiation. Addressing this issue and putting it into perspective, this groundbreaking resource provides critical details on the latest advances in high frequency electromagnetic dosimetry.
de Graaf, S E; Danilov, A V; Adamyan, A; Kubatkin, S E
2013-02-01
We report on the design and performance of a cryogenic (300 mK) near-field scanning microwave microscope. It uses a microwave resonator as the near-field sensor, operating at a frequency of 6 GHz and microwave probing amplitudes down to 100 μV, approaching low enough photon population (N ∼ 1000) of the resonator such that coherent quantum manipulation becomes feasible. The resonator is made out of a miniaturized distributed fractal superconducting circuit that is integrated with the probing tip, micromachined to be compact enough such that it can be mounted directly on a quartz tuning-fork, and used for parallel operation as an atomic force microscope (AFM). The resonator is magnetically coupled to a transmission line for readout, and to achieve enhanced sensitivity we employ a Pound-Drever-Hall measurement scheme to lock to the resonance frequency. We achieve a well localized near-field around the tip such that the microwave resolution is comparable to the AFM resolution, and a capacitive sensitivity down to 6.4 × 10(-20) F/Hz, limited by mechanical noise. We believe that the results presented here are a significant step towards probing quantum systems at the nanoscale using near-field scanning microwave microscopy.
Bayesian Analysis of the Cosmic Microwave Background
Jewell, Jeffrey
2007-01-01
There is a wealth of cosmological information encoded in the spatial power spectrum of temperature anisotropies of the cosmic microwave background! Experiments designed to map the microwave sky are returning a flood of data (time streams of instrument response as a beam is swept over the sky) at several different frequencies (from 30 to 900 GHz), all with different resolutions and noise properties. The resulting analysis challenge is to estimate, and quantify our uncertainty in, the spatial power spectrum of the cosmic microwave background given the complexities of "missing data", foreground emission, and complicated instrumental noise. Bayesian formulation of this problem allows consistent treatment of many complexities including complicated instrumental noise and foregrounds, and can be numerically implemented with Gibbs sampling. Gibbs sampling has now been validated as an efficient, statistically exact, and practically useful method for low-resolution (as demonstrated on WMAP 1 and 3 year temperature and polarization data). Continuing development for Planck - the goal is to exploit the unique capabilities of Gibbs sampling to directly propagate uncertainties in both foreground and instrument models to total uncertainty in cosmological parameters.
Zhang, Yachun; He, Xiang; Chen, Jianping; Chen, Hongqing; Chen, Li; Zhang, Hongchao; Ni, Xiaowu; Lu, Jian; Shen, Zhonghua
2018-03-01
The relationships between return losses of the cylindrical inlet and plasma discharge parameters are investigated experimentally and numerically. The return losses are measured using a high dynamic range measurement system and simulated by COMSOL Multiphysics when the frequency band of the microwaves is in the range 1-4 GHz. The profiles of the plasma density are estimated using Epstein and Bessel functions. Results show that the incident microwaves can be absorbed by plasma efficaciously. The maximal return loss can reach -13.84 dB when the microwave frequency is 2.3 GHz. The increase of applied power implies augmentation of the return loss, which behaves conversely for gas pressure. The experimental and numerical results display reasonable agreement on return loss, suggesting that the use of plasma is effective in the radar cross section reduction of aircraft inlets.
Microwave radiation mechanism in a pulse-laser-irradiated Cu foil target revisited
International Nuclear Information System (INIS)
Chen Ziyu; Li Jianfeng; Li Jun; Peng Qixian
2011-01-01
The microwave radiation mechanism in a Cu-based foil target irradiated by an intense laser pulse has been investigated. Microwave emission in the frequency range 0.5-4 GHz has been observed from a 200 ps laser pulse of intensity about 10 12 W cm -2 normally incident on the target surface. The total microwave power and energy emitted from the interaction were found to be about 0.4 W and 2 nJ, respectively, corresponding to an efficiency of coupling laser energy to microwave energy of 2x10 -8 . The result agrees well with quadrupole radiation calculated based on a circuit model of a laser plasma, which indicates that the radiative process can be explained by magnetic dipole or electric quadrupole radiation from the laser-produced symmetric poloidal current distribution at the plasma-target interface.
Microwave radiation mechanism in a pulse-laser-irradiated Cu foil target revisited
Energy Technology Data Exchange (ETDEWEB)
Chen Ziyu; Li Jianfeng; Li Jun; Peng Qixian, E-mail: ziyuch@gmail.com [Institute of Fluid Physics, China Academy of Engineering Physics, Mianyang 621900 (China)
2011-05-01
The microwave radiation mechanism in a Cu-based foil target irradiated by an intense laser pulse has been investigated. Microwave emission in the frequency range 0.5-4 GHz has been observed from a 200 ps laser pulse of intensity about 10{sup 12} W cm{sup -2} normally incident on the target surface. The total microwave power and energy emitted from the interaction were found to be about 0.4 W and 2 nJ, respectively, corresponding to an efficiency of coupling laser energy to microwave energy of 2x10{sup -8}. The result agrees well with quadrupole radiation calculated based on a circuit model of a laser plasma, which indicates that the radiative process can be explained by magnetic dipole or electric quadrupole radiation from the laser-produced symmetric poloidal current distribution at the plasma-target interface.
Anomalous non-resonant microwave absorption in SmFeAs(O,F) polycrystalline sample
Energy Technology Data Exchange (ETDEWEB)
Onyancha, R.B., E-mail: 08muma@gmail.com [Department of Physics, College of Science, Engineering and Technology, University of South Africa, Johannesburg, 1710 (South Africa); Shimoyama, J. [Department of Applied Chemistry, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo (Japan); Singh, S.J. [Leibniz-Institute for Solid State and Materials Research, IFW-Dresden, D-01171 Dresden (Germany); Hayashi, K.; Ogino, H. [Department of Applied Chemistry, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo (Japan); Srinivasu, V.V. [Department of Physics, College of Science, Engineering and Technology, University of South Africa, Johannesburg, 1710 (South Africa)
2017-02-15
Highlights: • The non-resonant microwave absorption (NRMA) line shape in evolved with microwave power. • Observed a cross over from ‘normal’ absorption to ‘anomalous’ absorption as a function of microwave power. • The anomalous absorption has been explained in the context of non-hysteretic Josephson junction. - Abstract: Here we present the non-resonant microwave absorption (NRMA) studies on SmFeAsO{sub 0.88}F{sub 0.12} polycrystalline sample measured at 6.06 K with the magnetic field swept from −250 G to +250 G at a frequency of 9.45 GHz. It was observed that the (NRMA) line shape evolves as a function of microwave power. Again, the signal intensity increases from 22.83 µW to 0.710 mW where it reaches a maximum and quite remarkably it changed from ‘normal’ absorption to ‘anomalous’ absorption at 2.247 mW, then the intensity decreases with further increase of microwave power. The crossover from ‘normal’ to ‘anomalous’ NRMA absorption and its dependence on microwave power is a new phenomenon in iron pnictides superconductors and we have attributed this anomaly to come from non-hysteretic Josephson junction.
Thermometric consideration for RF and microwave research in food engineering.
Ofoli, R Y
1986-01-01
A review of thermometric methods for the processing of food materials at RF and microwave frequencies is presented. Some areas of needed food engineering research are discussed, as well as factors of importance in the selection of temperature monitoring systems.
Energy Technology Data Exchange (ETDEWEB)
Matsumoto, Hiroshi [Kyoto Univ. (Japan)
1989-03-05
Laying stress on the technological problems and effect on the environment of microwave energy transmission, recent scientific and engineering problems and related subjects are described. Because no fuel is required for the solar power generation, the power generation system can not be considered as an expensive one when the unit cost of energy is taken into consideration. Some of the important technological problems in the microwave energy transmission are accurate microwave beam control technology to receiving stations and improvement in the efficiency of transmission system. Microwave energy beam has effects on living bodies, communication, and plasma atmosphere of the earth. Microwave energy transmission using a space flyer unit is scheduled. Its objective is the development of microwave wireless transmission technology and the study of the correlation between high power microwave and ionosphere plasma. Experiments on such a small scale application as a microwave driven space ship to bring results seem also important. 12 refs., 13 figs.
Microwave attenuation with composite of copper microwires
International Nuclear Information System (INIS)
Gorriti, A.G.; Marin, P.; Cortina, D.; Hernando, A.
2010-01-01
It is shown that copper microwires composite media attenuates microwave reflection of metallic surfaces. We show how the distance to the metallic surface, as well as the length and volume fraction of microwires, determine the frequency of maximum absorption and the return loss level. Furthermore, we were able to fit the experimental results with a theoretical model based on Maxwell-Garnett mixing formula.
Microwave attenuation with composite of copper microwires
Energy Technology Data Exchange (ETDEWEB)
Gorriti, A.G.; Marin, P. [Instituto de Magnetismo Aplicado, (UCM-ADIF-CSIC) and Departamento de Fisica de Materiales (UCM). P.O. Box 155, Las Rozas, Madrid 28230 (Spain); Cortina, D. [Micromag S.L., Las Rozas, Madrid 28230 (Spain); Hernando, A., E-mail: antonio.hernando@adif.e [Instituto de Magnetismo Aplicado, (UCM-ADIF-CSIC) and Departamento de Fisica de Materiales (UCM). P.O. Box 155, Las Rozas, Madrid 28230 (Spain); Micromag S.L., Las Rozas, Madrid 28230 (Spain)
2010-05-15
It is shown that copper microwires composite media attenuates microwave reflection of metallic surfaces. We show how the distance to the metallic surface, as well as the length and volume fraction of microwires, determine the frequency of maximum absorption and the return loss level. Furthermore, we were able to fit the experimental results with a theoretical model based on Maxwell-Garnett mixing formula.
Superconducting Microwave Resonator Arrays for Submillimeter/Far-Infrared Imaging
Noroozian, Omid
Superconducting microwave resonators have the potential to revolutionize submillimeter and far-infrared astronomy, and with it our understanding of the universe. The field of low-temperature detector technology has reached a point where extremely sensitive devices like transition-edge sensors are now capable of detecting radiation limited by the background noise of the universe. However, the size of these detector arrays are limited to only a few thousand pixels. This is because of the cost and complexity of fabricating large-scale arrays of these detectors that can reach up to 10 lithographic levels on chip, and the complicated SQUID-based multiplexing circuitry and wiring for readout of each detector. In order to make substantial progress, next-generation ground-based telescopes such as CCAT or future space telescopes require focal planes with large-scale detector arrays of 104--10 6 pixels. Arrays using microwave kinetic inductance detectors (MKID) are a potential solution. These arrays can be easily made with a single layer of superconducting metal film deposited on a silicon substrate and pattered using conventional optical lithography. Furthermore, MKIDs are inherently multiplexable in the frequency domain, allowing ˜ 10 3 detectors to be read out using a single coaxial transmission line and cryogenic amplifier, drastically reducing cost and complexity. An MKID uses the change in the microwave surface impedance of a superconducting thin-film microresonator to detect photons. Absorption of photons in the superconductor breaks Cooper pairs into quasiparticles, changing the complex surface impedance, which results in a perturbation of resonator frequency and quality factor. For excitation and readout, the resonator is weakly coupled to a transmission line. The complex amplitude of a microwave probe signal tuned on-resonance and transmitted on the feedline past the resonator is perturbed as photons are absorbed in the superconductor. The perturbation can be
Self-biased cobalt ferrite nanocomposites for microwave applications
International Nuclear Information System (INIS)
Hannour, Abdelkrim; Vincent, Didier; Kahlouche, Faouzi; Tchangoulian, Ardaches; Neveu, Sophie; Dupuis, Vincent
2014-01-01
Oriented CoFe 2 O 4 nanoparticles, dispersed in polymethyl methacrylate (PMMA) matrix, were fabricated by magnetophoretic deposition of functionalized nanocolloidal cobalt ferrite particles into porous alumina membrane. Their magnetic behavior exhibits an out-of-plane easy axis with a large remanent magnetization and coercitivity. This orientation allows high effective internal magnetic anisotropy that contributes to the permanent bias along the wire axis. The microwave studies reveal a ferromagnetic resonance at 46.5 and 49.5 GHz, depending on the filling ratio of the membrane. Ansoft High Frequency Structure Simulator (Ansoft HFSS) simulations are in good agreement with experimental results. Such nanocomposite is presented as one of the promising candidates for microwave devices (circulators, isolators, noise suppressors etc.). - Highlights: • Oriented magnetic CoFe 2 O 4 nanoparticles were fabricated by magnetophoretic deposition of functionalized cobalt ferrite particles into porous alumina membrane. • The nanocomposite obtained presents an out-of-plane easy axis with a large remanent magnetization and coercitivity. • The high effective internal magnetic anisotropy contributes to the permanent bias along the wire axis. • The frequency ferromagnetic resonance ranges from 46.5 to 49.5 GHz, depending on the filling ratio of the membrane. • We have obtained a good agreement between Ansoft High Frequency Structure Simulator simulations and experimental results
Dielectric measurements on PWB materials at microwave frequencies
Indian Academy of Sciences (India)
Unknown
the angular frequency and c0 the velocity of light, c the thickness of the ... Dielectric parameters, absorption index and refractive index for pure PSF and pure PMMA at 8⋅92 GHz frequency and at 35°C temperature. Dielectric. Dielectric. Loss. Relaxation. Conductivity Absorption. Refractive. Thickness, constant loss tangent.
On Frequency Combs in Monolithic Resonators
Savchenkov, A. A.; Matsko, A. B.; Maleki, L.
2016-06-01
Optical frequency combs have become indispensable in astronomical measurements, biological fingerprinting, optical metrology, and radio frequency photonic signal generation. Recently demonstrated microring resonator-based Kerr frequency combs point the way towards chip scale optical frequency comb generator retaining major properties of the lab scale devices. This technique is promising for integrated miniature radiofrequency and microwave sources, atomic clocks, optical references and femtosecond pulse generators. Here we present Kerr frequency comb development in a historical perspective emphasizing its similarities and differences with other physical phenomena. We elucidate fundamental principles and describe practical implementations of Kerr comb oscillators, highlighting associated solved and unsolved problems.
Directory of Open Access Journals (Sweden)
Juha Lemmetyinen
2018-01-01
Full Text Available Current methods for retrieving SWE (snow water equivalent from space rely on passive microwave sensors. Observations are limited by poor spatial resolution, ambiguities related to separation of snow microstructural properties from the total snow mass, and signal saturation when snow is deep (~>80 cm. The use of SAR (Synthetic Aperture Radar at suitable frequencies has been suggested as a potential observation method to overcome the coarse resolution of passive microwave sensors. Nevertheless, suitable sensors operating from space are, up to now, unavailable. Active microwave retrievals suffer, however, from the same difficulties as the passive case in separating impacts of scattering efficiency from those of snow mass. In this study, we explore the potential of applying active (radar and passive (radiometer microwave observations in tandem, by using a dataset of co-incident tower-based active and passive microwave observations and detailed in situ data from a test site in Northern Finland. The dataset spans four winter seasons with daily coverage. In order to quantify the temporal variability of snow microstructure, we derive an effective correlation length for the snowpack (treated as a single layer, which matches the simulated microwave response of a semi-empirical radiative transfer model to observations. This effective parameter is derived from radiometer and radar observations at different frequencies and frequency combinations (10.2, 13.3 and 16.7 GHz for radar; 10.65, 18.7 and 37 GHz for radiometer. Under dry snow conditions, correlations are found between the effective correlation length retrieved from active and passive measurements. Consequently, the derived effective correlation length from passive microwave observations is applied to parameterize the retrieval of SWE using radar, improving retrieval skill compared to a case with no prior knowledge of snow-scattering efficiency. The same concept can be applied to future radar
An introduction to microwave imaging for breast cancer detection
Conceição, Raquel Cruz; O'Halloran, Martin
2016-01-01
This book collates past and current research on one of the most promising emerging modalities for breast cancer detection. Readers will discover how, as a standalone technology or in conjunction with another modality, microwave imaging has the potential to provide reliable, safe and comfortable breast exams at low cost. Current breast imaging modalities include X- ray, Ultrasound, Magnetic Resonance Imaging, and Positron Emission Tomography. Each of these methods suffers from limitations, including poor sensitivity or specificity, high cost, patient discomfort, and exposure to potentially harmful ionising radiation. Microwave breast imaging is based on a contrast in the dielectric properties of breast tissue that exists at microwave frequencies. The book begins by considering the anatomy and dielectric properties of the breast, contrasting historical and recent studies. Next, radar-based breast imaging algorithms are discussed, encompassing both early-stage artefact removal, and data independent and adaptive ...
Sun, Jing; Wang, Wenlong; Yue, Qinyan
2016-01-01
Microwave heating is rapidly emerging as an effective and efficient tool in various technological and scientific fields. A comprehensive understanding of the fundamentals of microwave–matter interactions is the precondition for better utilization of microwave technology. However, microwave heating is usually only known as dielectric heating, and the contribution of the magnetic field component of microwaves is often ignored, which, in fact, contributes greatly to microwave heating of some aqueous electrolyte solutions, magnetic dielectric materials and certain conductive powder materials, etc. This paper focuses on this point and presents a careful review of microwave heating mechanisms in a comprehensive manner. Moreover, in addition to the acknowledged conventional microwave heating mechanisms, the special interaction mechanisms between microwave and metal-based materials are attracting increasing interest for a variety of metallurgical, plasma and discharge applications, and therefore are reviewed particularly regarding the aspects of the reflection, heating and discharge effects. Finally, several distinct strategies to improve microwave energy utilization efficiencies are proposed and discussed with the aim of tackling the energy-efficiency-related issues arising from the application of microwave heating. This work can present a strategic guideline for the developed understanding and utilization of the microwave heating technology. PMID:28773355
Yao, Shi-Kay
Consideration is given to light modulation technologies, wideband optical links, phased array antenna applications, radar and EW applications, and novel optoelectronic devices and technologies. Particular attention is given to wideband nonlinear optical organic external modulators, ultra-linear electrooptic modulators for microwave fiber-optic communications, coherent optical modulation for antenna remoting, a hybrid optical transmitter for microwave communication, a direct optical phase shifter for phased array systems, acoustooptic architectures for multidimensional phased-array antenna processing, generalized phased-array Bragg interaction in anisotropic crystals, analog optical processing of radio frequency signals, a wideband acoustooptic spectrometer, ring resonators for microwave optoelectronics, optical techniques for microwave monolithic circuit characterization, microwave control using a high-gain bias-free optoelectronic switch, and A/D conversion of microwave signals using a hybrid optical-electronic technique. (For individual items see A93-25727 to A93-25758)
A flat Universe from high-resolution maps of the cosmic microwave background radiation
de Bernardis P; Ade; Bock; Bond; Borrill; Boscaleri; Coble; Crill; De Gasperis G; Farese; Ferreira; Ganga; Giacometti; Hivon; Hristov; Iacoangeli; Jaffe; Lange; Martinis; Masi; Mason; Mauskopf; Melchiorri; Miglio; Montroy; Netterfield
2000-04-27
The blackbody radiation left over from the Big Bang has been transformed by the expansion of the Universe into the nearly isotropic 2.73 K cosmic microwave background. Tiny inhomogeneities in the early Universe left their imprint on the microwave background in the form of small anisotropies in its temperature. These anisotropies contain information about basic cosmological parameters, particularly the total energy density and curvature of the Universe. Here we report the first images of resolved structure in the microwave background anisotropies over a significant part of the sky. Maps at four frequencies clearly distinguish the microwave background from foreground emission. We compute the angular power spectrum of the microwave background, and find a peak at Legendre multipole Ipeak = (197 +/- 6), with an amplitude delta T200 = (69 +/- 8) microK. This is consistent with that expected for cold dark matter models in a flat (euclidean) Universe, as favoured by standard inflationary models.
Burns, B. A.; Cavalieri, D. J.; Keller, M. R.
1986-01-01
Active and passive microwave data collected during the 1984 summer Marginal Ice Zone Experiment in the Fram Strait (MIZEX 84) are used to compare ice concentration estimates derived from synthetic aperture radar (SAR) data to those obtained from passive microwave imagery at several frequencies. The comparison is carried out to evaluate SAR performance against the more established passive microwave technique, and to investigate discrepancies in terms of how ice surface conditions, imaging geometry, and choice of algorithm parameters affect each sensor. Active and passive estimates of ice concentration agree on average to within 12%. Estimates from the multichannel passive microwave data show best agreement with the SAR estimates because the multichannel algorithm effectively accounts for the range in ice floe brightness temperatures observed in the MIZ.
Iwamaru, T.; Katsumata, H.; Uekusa, S.; Ooyagi, H.; Ishimura, T.; Miyakoshi, T.
Microwave absorption composites were synthesized from a poly urushiol epoxy resin (PUE) mixed with one of microwave absorbing materials; Ni-Zn ferrite, Soot, Black lead, and carbon nano tube (CNT) to investigate their microwave absorption properties. PUE binders were specially made from Japanese lacquer and epoxy resin, where Japanese lacquer has been traditionally used for bond and paint because it has excellent beauty. Japanese lacquer solidifies with oxygen contained in air's moisture, which has difficulty in making composite, but we improved Japanese lacquer's solidification properties by use of epoxy resin. We made 10 mm thickness composite samples and cut them into toroidal shape to measure permittivity, permeability, and reflection loss in frequencies ranging from 50 Hz to 20 GHz. Electric magnetic absorber's composites synthesized from a PUE binders mixed either with Soot or CNT showed significantly higher wave absorption over -27 dB than the others at frequencies around 18 GHz, although Japanese lacquer itself doesn't affect absorption. This means Japanese lacquer can be used as binder materials for microwave absorbers.
Effects of 415 MHz frequency on human lymphocyte genome
International Nuclear Information System (INIS)
Garaj-Vrhovac, V.; Fucic, A.; Kubelka, D.; Vojvodic, S.
1996-01-01
The continuously increasing use of artificial sources of electromagnetic radiation in industry and medicine has been accompanied in everyday life with telecommunication systems which is followed with great interest in possible hazardous effects of this type of radiation. The interesting applications of mobile telecommunications and the use of cellular phones are of topic interest. Numerous cytogenetic investigations are focused on the effects of microwave radiation from mobile communications frequency of 450 and 950 MHz on isolated cells in vitro. The aim of this work was to investigate the effects of microwaves from mobile telephone frequencies on human peripheral blood lymphocytes cultured in vitro. (author)
An amplitude modulated radio frequency plasma generator
Lei, Fan; Li, Xiaoping; Liu, Yanming; Liu, Donglin; Yang, Min; Xie, Kai; Yao, Bo
2017-04-01
A glow discharge plasma generator and diagnostic system has been developed to study the effects of rapidly variable plasmas on electromagnetic wave propagation, mimicking the plasma sheath conditions encountered in space vehicle reentry. The plasma chamber is 400 mm in diameter and 240 mm in length, with a 300-mm-diameter unobstructed clear aperture. Electron densities produced are in the mid 1010 electrons/cm3. An 800 W radio frequency (RF) generator is capacitively coupled through an RF matcher to an internally cooled stainless steel electrode to form the plasma. The RF power is amplitude modulated by a waveform generator that operates at different frequencies. The resulting plasma contains electron density modulations caused by the varying power levels. A 10 GHz microwave horn antenna pair situated on opposite sides of the chamber serves as the source and detector of probe radiation. The microwave power feed to the source horn is split and one portion is sent directly to a high-speed recording oscilloscope. On mixing this with the signal from the pickup horn antenna, the plasma-induced phase shift between the two signals gives the path-integrated electron density with its complete time dependent variation. Care is taken to avoid microwave reflections and extensive shielding is in place to minimize electronic pickup. Data clearly show the low frequency modulation of the electron density as well as higher harmonics and plasma fluctuations.
Influence of fast waves on the collective scattering of microwaves in fusion plasmas
International Nuclear Information System (INIS)
Chiu, S.C.
1992-01-01
Microwave scattering by the fluctuations of fusion plasmas is one of the most promising α-diagnostic techniques. Previous investigations have concentrated on the fluctuations near the slow wave branch in the lower hybrid range of frequencies. The small signal and the lack of sensitivity to the contribution of α-particles to the total cross-section near the slow branch severely limits the effectiveness of this technique. In this paper, we report results of investigations of scattering by fluctuations in the lower hybrid range of frequencies near the fast branch. Surprisingly, when both fast and slow branches exist, the scattering amplitudes are comparable. More important, the α-contribution is larger for the fast branch and the fast branch has a larger parameter space where it exists. Specifically, the slow branch exists only above the lower hybrid frequency, while the fast branch can exist at all frequencies up to the electron cyclotron range of frequencies. We find numerically that the scattering amplitudes near the fast branch below the lower hybrid frequency are several orders of magnitude larger than those near the slow branch above that frequency where it can exist. This may make microwave scattering by fast waves a more attractive α-diagnostic technique. (orig.)
Bragg scattering of electromagnetic waves by microwave-produced plasma layers
Kuo, S. P.; Zhang, Y. S.
1990-01-01
A set of parallel plasma layers is generated by two intersecting microwave pulses in a chamber containing dry air at a pressure comparable to the upper atmosphere. The dependencies of breakdown conditions on the pressure and pulse length are examined. The results are shown to be consistent with the appearance of tail erosion of the microwave pulse caused by air breakdown. A Bragg scattering experiment, using the plasma layers as a Bragg reflector, is then performed. Both time domain and frequency domain measurements of wave scattering are conducted. The experimental results are found to agree very well with the theory.
International Nuclear Information System (INIS)
Ramanayaka, A.N.; Ye, Tianyu; Liu, H.-C.; Wegscheider, W.; Mani, R.G.
2014-01-01
The influence of microwave excitation on the magnetotransport properties of the high mobility two-dimensional electron system (2DES) in the GaAs/AlGaAs heterostructure system is investigated by exploring (a) the dependence of the amplitude of the microwave-induced magnetoresistance-oscillations on the polarization direction of the linearly polarized microwaves and (b) the microwave reflection from the 2DES. The polarization study indicates that the amplitude of the magnetoresistance oscillations is remarkably responsive to the relative orientation between the linearly polarized microwaves and the current-axis in the specimen. At low microwave power, P, experiments indicate a strong sinusoidal variation in the diagonal resistance R xx vs. θ at the oscillatory extrema of the microwave-induced magnetoresistance oscillations. The reflection study indicates strong correlations between the microwave induced magnetoresistance oscillations and oscillatory features in the microwave reflection in a concurrent measurement of the magnetoresistance and the microwave magnetoreflection from the 2DES. The correlations are followed as a function of the microwave frequency and the microwave power, and the results are reported
Energy Technology Data Exchange (ETDEWEB)
Ramanayaka, A.N.; Ye, Tianyu; Liu, H.-C. [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30303 (United States); Wegscheider, W. [Laboratorium fuer Festkoerperphysik, ETH Zurich, 8093 Zurich (Switzerland); Mani, R.G., E-mail: rmani@gsu.edu [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30303 (United States)
2014-11-15
The influence of microwave excitation on the magnetotransport properties of the high mobility two-dimensional electron system (2DES) in the GaAs/AlGaAs heterostructure system is investigated by exploring (a) the dependence of the amplitude of the microwave-induced magnetoresistance-oscillations on the polarization direction of the linearly polarized microwaves and (b) the microwave reflection from the 2DES. The polarization study indicates that the amplitude of the magnetoresistance oscillations is remarkably responsive to the relative orientation between the linearly polarized microwaves and the current-axis in the specimen. At low microwave power, P, experiments indicate a strong sinusoidal variation in the diagonal resistance R{sub xx} vs. θ at the oscillatory extrema of the microwave-induced magnetoresistance oscillations. The reflection study indicates strong correlations between the microwave induced magnetoresistance oscillations and oscillatory features in the microwave reflection in a concurrent measurement of the magnetoresistance and the microwave magnetoreflection from the 2DES. The correlations are followed as a function of the microwave frequency and the microwave power, and the results are reported.
Miller, Renee; Kolipaka, Arunark; Nash, Martyn P; Young, Alistair A
2018-03-12
Magnetic resonance elastography (MRE) has been used to estimate isotropic myocardial stiffness. However, anisotropic stiffness estimates may give insight into structural changes that occur in the myocardium as a result of pathologies such as diastolic heart failure. The virtual fields method (VFM) has been proposed for estimating material stiffness from image data. This study applied the optimised VFM to identify transversely isotropic material properties from both simulated harmonic displacements in a left ventricular (LV) model with a fibre field measured from histology as well as isotropic phantom MRE data. Two material model formulations were implemented, estimating either 3 or 5 material properties. The 3-parameter formulation writes the transversely isotropic constitutive relation in a way that dissociates the bulk modulus from other parameters. Accurate identification of transversely isotropic material properties in the LV model was shown to be dependent on the loading condition applied, amount of Gaussian noise in the signal, and frequency of excitation. Parameter sensitivity values showed that shear moduli are less sensitive to noise than the other parameters. This preliminary investigation showed the feasibility and limitations of using the VFM to identify transversely isotropic material properties from MRE images of a phantom as well as simulated harmonic displacements in an LV geometry. Copyright © 2018 John Wiley & Sons, Ltd.
Leem, Dohyun; Kim, Jin-Hwan; Barlat, Frédéric; Song, Jung Han; Lee, Myoung-Gyu
2018-03-01
An inverse approach based on the virtual fields method (VFM) is presented to identify the material hardening parameters under dynamic deformation. This dynamic-VFM (D-VFM) method does not require load information for the parameter identification. Instead, it utilizes acceleration fields in a specimen's gage region. To investigate the feasibility of the proposed inverse approach for dynamic deformation, the virtual experiments using dynamic finite element simulations were conducted. The simulation could provide all the necessary data for the identification such as displacement, strain, and acceleration fields. The accuracy of the identification results was evaluated by changing several parameters such as specimen geometry, velocity, and traction boundary conditions. The analysis clearly shows that the D-VFM which utilizes acceleration fields can be a good alternative to the conventional identification procedure that uses load information. Also, it was found that proper deformation conditions are required for generating sufficient acceleration fields during dynamic deformation to enhance the identification accuracy with the D-VFM.
Myelination Is Associated with Processing Speed in Early Childhood: Preliminary Insights.
Directory of Open Access Journals (Sweden)
Nicolas Chevalier
Full Text Available Processing speed is an important contributor to working memory performance and fluid intelligence in young children. Myelinated white matter plays a central role in brain messaging, and likely mediates processing speed, but little is known about the relationship between myelination and processing speed in young children. In the present study, processing speed was measured through inspection times, and myelin volume fraction (VFM was quantified using a multicomponent magnetic resonance imaging (MRI approach in 2- to 5-years of age. Both inspection times and VFM were found to increase with age. Greater VFM in the right and left occipital lobes, the body of the corpus callosum, and the right cerebellum was significantly associated with shorter inspection times, after controlling for age. A hierarchical regression showed that VFM in the left occipital lobe predicted inspection times over and beyond the effects of age and the VFM in the other brain regions. These findings are consistent with the hypothesis that myelin supports processing speed in early childhood.
International Nuclear Information System (INIS)
Avitzour, Yoav; Shvets, Gennady
2008-01-01
A new approach to manipulating the duration and frequency of microwave pulses using magnetized plasmas is demonstrated. The plasma accomplishes two functions: (i) slowing down and spatially compressing the incident wave, and (ii) modifying the propagation properties (group velocity and frequency) of the wave in the plasma during a uniform in space adiabatic in time variation of the magnitude and/or direction of the magnetic field. The increase in the group velocity results in the shortening of the temporal pulse duration. Depending on the plasma parameters, the frequency of the outgoing compressed pulse can either change or remain unchanged. Such dynamic manipulation of radiation in plasma opens new avenues for manipulating high power microwave pulses
Improved method for measuring the electric fields in microwave cavity resonators
International Nuclear Information System (INIS)
Amato, J.C.; Herrmann, H.
1985-01-01
The electric field distribution in microwave cavities is commonly measured by frequency perturbation techniques. For many cavity modes which are important in accelerator applications, the standard bead-pulling technique cannot provide adequate discrimination between fields parallel and perpendicular to the particle trajectory, leading to inaccurate and ambiguous results. A method is described which substantially increases the directivity of the measurements. The method has been successfully used to determine the accelerator-related cavity parameters at frequencies up to three times the fundamental resonant frequency
MICROWAVE MEASUREMENT OF REFRACTORY MATERIALS AT HIGH-TEMPERATURE
International Nuclear Information System (INIS)
Kharkovsky, S.; Zoughi, R.; Smith, J.; Davis, B.; Limmer, R.
2009-01-01
Knowledge of the electrical behavior of refractory materials may enable the development and optimization of microwave nondestructive techniques to detect and evaluate changes in their physical properties while the materials are in service. This paper presents the results of a limited and preliminary investigation in which two refractory materials (dense chrome and dense zircon) were subjected to increasing temperature in a furnace and in which a frequency-modulated continuous-wave radar operating in the frequency range of 8-18 GHz radar was used to evaluate their attenuation properties.
Microwave Measurement of Refractory Materials at High-Temperature
Kharkovsky, S.; Zoughi, R.; Smith, J.; Davis, B.; Limmer, R.
2009-03-01
Knowledge of the electrical behavior of refractory materials may enable the development and optimization of microwave nondestructive techniques to detect and evaluate changes in their physical properties while the materials are in service. This paper presents the results of a limited and preliminary investigation in which two refractory materials (dense chrome and dense zircon) were subjected to increasing temperature in a furnace and in which a frequency-modulated continuous-wave radar operating in the frequency range of 8-18 GHz radar was used to evaluate their attenuation properties.
Electrically Tuned Microwave Devices Using Liquid Crystal Technology
Directory of Open Access Journals (Sweden)
Pouria Yaghmaee
2013-01-01
Full Text Available An overview of liquid crystal technology for microwave and millimeter-wave frequencies is presented. The potential of liquid crystals as reconfigurable materials arises from their ability for continuous tuning with low power consumption, transparency, and possible integration with printed and flexible circuit technologies. This paper describes physical theory and fundamental electrical properties arising from the anisotropy of liquid crystals and overviews selected realized liquid crystal devices, throughout four main categories: resonators and filters, phase shifters and delay lines, antennas, and, finally, frequency-selective surfaces and metamaterials.
Fast microwave assisted pyrolysis of biomass using microwave absorbent.
Borges, Fernanda Cabral; Du, Zhenyi; Xie, Qinglong; Trierweiler, Jorge Otávio; Cheng, Yanling; Wan, Yiqin; Liu, Yuhuan; Zhu, Rongbi; Lin, Xiangyang; Chen, Paul; Ruan, Roger
2014-03-01
A novel concept of fast microwave assisted pyrolysis (fMAP) in the presence of microwave absorbents was presented and examined. Wood sawdust and corn stover were pyrolyzed by means of microwave heating and silicon carbide (SiC) as microwave absorbent. The bio-oil was characterized, and the effects of temperature, feedstock loading, particle sizes, and vacuum degree were analyzed. For wood sawdust, a temperature of 480°C, 50 grit SiC, with 2g/min of biomass feeding, were the optimal conditions, with a maximum bio-oil yield of 65 wt.%. For corn stover, temperatures ranging from 490°C to 560°C, biomass particle sizes from 0.9mm to 1.9mm, and vacuum degree lower than 100mmHg obtained a maximum bio-oil yield of 64 wt.%. This study shows that the use of microwave absorbents for fMAP is feasible and a promising technology to improve the practical values and commercial application outlook of microwave based pyrolysis. Copyright © 2014 Elsevier Ltd. All rights reserved.
Design and development of ITER high-frequency magnetic sensor
Energy Technology Data Exchange (ETDEWEB)
Ma, Y., E-mail: Yunxing.Ma@iter.org [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); Fircroft Engineering, Lingley House, 120 Birchwood Point, Birchwood Boulevard, Warrington, WA3 7QH (United Kingdom); Vayakis, G. [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); Begrambekov, L.B. [National Research Nuclear University (MEPhI), 115409, Moscow, Kashirskoe shosse 31 (Russian Federation); Cooper, J.-J. [Culham Centre for Fusion Energy (CCFE), Abingdon, Oxfordshire OX14 3DB (United Kingdom); Duran, I. [IPP Prague, Za Slovankou 1782/3, 182 00 Prague 8 (Czech Republic); Hirsch, M.; Laqua, H.P. [Max-Planck-Institut für Plasmaphysik, Teilinstitut Greifswald, Wendelsteinstraße 1, D-17491 Greifswald (Germany); Moreau, Ph. [CEA Cadarache, 13108 Saint Paul lez Durance Cedex (France); Oosterbeek, J.W. [Eindhoven University of Technology (TU/e), PO Box 513, 5600 MB Eindhoven (Netherlands); Spuig, P. [CEA Cadarache, 13108 Saint Paul lez Durance Cedex (France); Stange, T. [Max-Planck-Institut für Plasmaphysik, Teilinstitut Greifswald, Wendelsteinstraße 1, D-17491 Greifswald (Germany); Walsh, M. [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France)
2016-11-15
Highlights: • ITER high-frequency magnetic sensor system has been designed. • Prototypes have been successfully manufactured. • Manufactured prototypes have been tested in various labs. • Test results experimentally validated the design. - Abstract: High-frequency (HF) inductive magnetic sensors are the primary ITER diagnostic set for Toroidal Alfvén Eigenmodes (TAE) detection, while they also supplement low-frequency MHD and plasma equilibrium measurements. These sensors will be installed on the inner surface of ITER vacuum vessel, operated in a harsh environment with considerable neutron/nuclear radiation and high thermal load. Essential components of the HF sensor system, including inductive coil, electron cyclotron heating (ECH) shield, electrical cabling and termination load, have been designed to meet ITER measurement requirements. System performance (e.g. frequency response, thermal conduction) has been assessed. A prototyping campaign was initiated to demonstrate the manufacturability of the designed components. Prototypes have been produced according to the specifications. A series of lab tests have been performed to examine assembly issues and validate electrical and thermo-mechanical aspects of the design. In-situ microwave radiation test has been conducted in the MISTRAL test facility at IPP-Greifswald to experimentally examine the microwave shielding efficiency and structural integrity of the ECH shield. Low-power microwave attenuation measurement and scanning electron microscopic inspection were conducted to probe and examine the quality of the metal coating on the ECH shield.
Low-temperature dynamic nuclear polarization at 9.4 T with a 30 mW microwave source.
Thurber, Kent R; Yau, Wai-Ming; Tycko, Robert
2010-06-01
Dynamic nuclear polarization (DNP) can provide large signal enhancements in nuclear magnetic resonance (NMR) by transfer of polarization from electron spins to nuclear spins. We discuss several aspects of DNP experiments at 9.4 T (400 MHz resonant frequency for (1)H, 264 GHz for electron spins in organic radicals) in the 7-80K temperature range, using a 30 mW, frequency-tunable microwave source and a quasi-optical microwave bridge for polarization control and low-loss microwave transmission. In experiments on frozen glycerol/water doped with nitroxide radicals, DNP signal enhancements up to a factor of 80 are observed (relative to (1)H NMR signals with thermal equilibrium spin polarization). The largest sensitivity enhancements are observed with a new triradical dopant, DOTOPA-TEMPO. Field modulation with a 10 G root-mean-squared amplitude during DNP increases the nuclear spin polarizations by up to 135%. Dependencies of (1)H NMR signal amplitudes, nuclear spin relaxation times, and DNP build-up times on the dopant and its concentration, temperature, microwave power, and modulation frequency are reported and discussed. The benefits of low-temperature DNP can be dramatic: the (1)H spin polarization is increased approximately 1000-fold at 7 K with DNP, relative to thermal polarization at 80K. (c) 2010 Elsevier Inc. All rights reserved.
Investigation of the microwave emission from the PRETEXT tokamak
International Nuclear Information System (INIS)
Gandy, R.F.
1981-10-01
A study of the microwave emission from the PRETEXT tokamak has been conducted. Two types of emission have been observed: electron cyclotron and electron plasma frequency. Three general emission regimes have been identified. These regimes are best classified by the dimensionless parameter α, where α = ω/sub pe//Ω/sub e/
International Nuclear Information System (INIS)
Shrivastava, Purushottam
2001-01-01
With the advances in high power microwave devices as well as in microwave technologies it has become possible to go on higher frequencies at higher powers as well as to go for newer devices which are more efficient and compact and hence reducing the power needs as well as space and weight requirement for accelerators. New devices are now available in higher frequency spectrum for example at C-Band, X-band and even higher. Also new devices like klystrodes/Higher Order Mode Inductive Output Tubes (HOM IOTs) are now becoming competitors for existing tubes which are in use at present accelerator complexes. The design/planning of the accelerators used for particle physics research, medical accelerators, industrial irradiation, or even upcoming Driver Accelerators for Sub Critical Reactors for nuclear power generation are being done taking into account the newer technologies. The accelerators which use magnetrons, klystrons and similar devices at S-Band can be modified/redesigned with devices at higher frequencies like X-Band. Pulsed accelerators need high power high voltage pulsed modulators whereas CW accelerators need high voltage power supplies for functioning of RF / Microwave tubes. There had been a remarkable growth in the development and availability of solid state switches both for switching the pulsed modulators for microwave tubes as well as for making high frequency switch mode power supplies. Present paper discusses some of the advanced devices/technologies in this field as well as their capability to make advanced/compact/reliable accelerators. Microwave systems developed/under development at Centre for Advanced Technology are also discussed briefly along with some of the efforts done to make them compact. An overview of state of art vacuum tube devices and solid state switch technologies is given. (author)
Validation of multi-channel scanning microwave radiometer on-board Oceansat-1
Digital Repository Service at National Institute of Oceanography (India)
Muraleedharan, P.M.; Pankajakshan, T.; Harikrishnan, M.
Sea surface temperature (SST), sea surface wind speed (WS) and columnar water vapour (WV) derived from Multi-frequency Scanning Microwave Radiometer (MSMR) sensor on-board IRS-P4 (Oceansat-1) were validated against the in situ measurements from ship...
On-line measurement of the microwave power in ECR ion source
International Nuclear Information System (INIS)
Zhou Changgeng; Kang Wu; Hu Yonghong; Li Yan; Lou Benchao; Zu Xiulan; Xiong Riheng; Chen Junguang
2005-01-01
It is a new technology that ECR ion source is applied in the neutron generator. Because of effect of the structure, working state of ECR ion source could not be judged by the color of gas discharging in discharging chamber as doing in high frequency ion source. Therefore, state adjusting of ECR ion source was difficult in running of the neutron generator. The method to resolve the question is described in this paper. The micro-wave power was measured in case of running by using the method of directional coupler adding small microwave power meter. Because both were in the direct proportion, the ion beam current could be educed from microwave incidence power measured, and discharge state in discharge chamber could be judged. Finally, the neutron generator might be operated in best running state. (authors)
Design of a microwave calorimeter for the microwave tokamak experiment
International Nuclear Information System (INIS)
Marinak, M.
1988-01-01
The initial design of a microwave calorimeter for the Microwave Tokamak Experiment is presented. The design is optimized to measure the refraction and absorption of millimeter rf microwaves as they traverse the toroidal plasma of the Alcator C tokamak. Techniques utilized can be adapted for use in measuring high intensity pulsed output from a microwave device in an environment of ultra high vacuum, intense fields of ionizing and non-ionizing radiation and intense magnetic fields. 16 refs
Dielectric Characteristics and Microwave Absorption of Graphene Composite Materials
Directory of Open Access Journals (Sweden)
Kevin Rubrice
2016-10-01
Full Text Available Nowadays, many types of materials are elaborated for microwave absorption applications. Carbon-based nanoparticles belong to these types of materials. Among these, graphene presents some distinctive features for electromagnetic radiation absorption and thus microwave isolation applications. In this paper, the dielectric characteristics and microwave absorption properties of epoxy resin loaded with graphene particles are presented from 2 GHz to 18 GHz. The influence of various parameters such as particle size (3 µm, 6–8 µm, and 15 µm and weight ratio (from 5% to 25% are presented, studied, and discussed. The sample loaded with the smallest graphene size (3 µm and the highest weight ratio (25% exhibits high loss tangent (tanδ = 0.36 and a middle dielectric constant ε′ = 12–14 in the 8–10 GHz frequency range. As expected, this sample also provides the highest absorption level: from 5 dB/cm at 4 GHz to 16 dB/cm at 18 GHz.
Microwave instability across the transition energy
International Nuclear Information System (INIS)
Lee, S.Y.; Wang, J.M.
1985-01-01
It is well known that during the acceleration of hadrons in a storage ring, the beam always goes above the microwave instability threshold near the transition energy γ /SUB t/ . The reason is that the longitudinal revolution frequency spread of the beam which otherwise provides Landau damping vanishes at the transition energy. The amount of the beam dilution near the transition energy is determined by /tau/ /SUB th/ , the length of time when the beam stays unstable, and the growth rate of the instability. It is pointed out in this paper that /tau/ /SUB th/ is proportional to the fourth power of γ /SUB t/ , and thus the choice of a large γ /SUB t/ is not desirable from this point of view. An analysis is also given of the microwave instability induced beam dilution for the proposed Relativistic Heavy Ion Collider at BNL
Microwave instability across the transition energy
International Nuclear Information System (INIS)
Lee, S.Y.; Wang, J.M.
1985-01-01
It is well known that during the acceleration of hadrons in a storage ring, the beam always goes above the microwave instability threshold near the transition energy γ/sub t/. The reason is that the longitudinal revolution frequency spread of the beam which otherwise provides Landau damping vanishes at the transition energy. The amount of the beam dilution near the transition energy is determined by tau/sub th/, the length of time when the beam stays unstable, and the growth rate of the instability. It is pointed out in this paper that tau/sub th/ is proportional to the fourth power of γ/sub t/, and thus the choice of a large γ/sub t/ is not desirable from this point of view. An analysis is also given of the microwave instability induced beam dilution for the proposed Relativistic Heavy Ion Collider at BNL
Microwave power engineering applications
Okress, Ernest C
2013-01-01
Microwave Power Engineering, Volume 2: Applications introduces the electronics technology of microwave power and its applications. This technology emphasizes microwave electronics for direct power utilization and transmission purposes. This volume presents the accomplishments with respect to components, systems, and applications and their prevailing limitations in the light of knowledge of the microwave power technology. The applications discussed include the microwave heating and other processes of materials, which utilize the magnetron predominantly. Other applications include microwave ioni
On Frequency Combs in Monolithic Resonators
Directory of Open Access Journals (Sweden)
Savchenkov A. A.
2016-06-01
Full Text Available Optical frequency combs have become indispensable in astronomical measurements, biological fingerprinting, optical metrology, and radio frequency photonic signal generation. Recently demonstrated microring resonator-based Kerr frequency combs point the way towards chip scale optical frequency comb generator retaining major properties of the lab scale devices. This technique is promising for integrated miniature radiofrequency and microwave sources, atomic clocks, optical references and femtosecond pulse generators. Here we present Kerr frequency comb development in a historical perspective emphasizing its similarities and differences with other physical phenomena. We elucidate fundamental principles and describe practical implementations of Kerr comb oscillators, highlighting associated solved and unsolved problems.
Guss, Paul; Rabin, Michael; Croce, Mark; Hoteling, Nathan; Schwellenbach, David; Kruschwitz, Craig; Mocko, Veronika; Mukhopadhyay, Sanjoy
2017-09-01
We demonstrate very high-resolution photon spectroscopy with a microwave-multiplexed 4-pixel transition edge sensor (TES) array. The readout circuit consists of superconducting microwave resonators coupled to radio frequency superconducting-quantum-interference devices (RF-SQUIDs) and transduces changes in input current to changes in phase of a microwave signal. We used a flux-ramp modulation to linearize the response and avoid low-frequency noise. The result is a very high-resolution photon spectroscopy with a microwave-multiplexed 4-pixel transition edge sensor array. We performed and validated a small-scale demonstration and test of all the components of our concept system, which encompassed microcalorimetry, microwave multiplexing, RF-SQUIDs, and software-defined radio (SDR). We shall display data we acquired in the first simultaneous combination of all key innovations in a 4-pixel demonstration, including microcalorimetry, microwave multiplexing, RF-SQUIDs, and SDR. We present the energy spectrum of a gadolinium-153 (153Gd) source we measured using our 4-pixel TES array and the RF-SQUID multiplexer. For each pixel, one can observe the two 97.4 and 103.2 keV photopeaks. We measured the 153Gd photon source with an achieved energy resolution of 70 eV, full width half maximum (FWHM) at 100 keV, and an equivalent readout system noise of 90 pA/pHz at the TES. This demonstration establishes a path for the readout of cryogenic x-ray and gamma ray sensor arrays with more elements and spectral resolving powers. We believe this project has improved capabilities and substantively advanced the science useful for missions such as nuclear forensics, emergency response, and treaty verification through the explored TES developments.
Magnetic hysteresis effects in superconducting coplanar microwave resonators
Energy Technology Data Exchange (ETDEWEB)
Bothner, D.; Gaber, T.; Kemmler, M.; Gruenzweig, M.; Ferdinand, B.; Koelle, D.; Kleiner, R. [Universitaet Tuebingen (Germany); Wuensch, S.; Siegel, M. [Karlsruher Institut fuer Technologie (Germany); Mikheenko, P.; Johansen, T.H. [University of Oslo (Norway)
2013-07-01
We present experimental data regarding the impact of external magnetic fields on quality factor and resonance frequency of superconducting microwave resonators in a coplanar waveguide geometry. In particular we focus on the influence of magnetic history and show with the assistance of numerical calculations that the found hysteretic behaviour can be well understood with a highly inhomogeneous microwave current density in combination with established field penetration models for type-II superconducting thin films. Furthermore we have used magneto-optical imaging techniques to check the field distribution which we have assumed in our calculations. Finally, we demonstrate that and how the observed hysteretic behaviour can be used to optimize and tune the resonator performance for possible hybrid quantum sytems in magnetic fields.