WorldWideScience

Sample records for francine nol maryse

  1. Kirpitsh ne v mode? Vzdor! / Francine Houben ; interv. Caroline Kruit

    Index Scriptorium Estoniae

    Houben, Francine

    2004-01-01

    Intervjuu hollandi arhitekti Francine Houbeniga (arhitektuuribüroo Mecanoo), kes kasutab oma projekteeritud hoonetes ehitusmaterjalina tellist. Arnhemi vabaõhumuuseumi pääsla "lapitehnikas" müüridest. 2 ill

  2. Tellis pole moes? Jama! / Francine Houben ; interv. Caroline Kruit

    Index Scriptorium Estoniae

    Houben, Francine

    2004-01-01

    Intervjuu hollandi arhitekti Francine Houbeniga (arhitektuuribüroo Mecanoo), kes kasutab oma projekteeritud hoonetes ehitusmaterjalina tellist. Arnhemi vabaõhumuuseumi pääsla "lapitehnikas" müüridest. 2 ill

  3. Reconfiguring Boundaries in Maryse Condé's Crossing the Mangrove

    Directory of Open Access Journals (Sweden)

    Deborah B. Gaensbauer

    2004-06-01

    Full Text Available Maryse Condé's 1989 novel, Crossing the Mangrove , presents a compelling performance of the complicated patterns of place and space inherent in the social masquerade of a small, isolated, Guadeloupean village. Because the novel corresponds to Condé's return to a Caribbean "stage" to continue a long process of questioning mapped configurations of identity, critical attention has focused on the character of Francis Sancher, the returning "stranger," whose wake serves as both frame and catalyst for the action. Insufficient attention has been paid to the role of Mira Lameaulnes, Sancher's rejected mistress and the mother of his child, whose story the novel to a significant extent becomes as she effectively invades and undermines Sancher's role as the principal signifying figure. This reading foregrounds Mira's critical confrontation with notions of place and space as an illustration of Condé's revolutionary approach to invalidating static or formulaic treatments of Antillean sites of identity.

  4. The Cook and the Writer: Maryse Condé's Journey of Self-Discovery

    Directory of Open Access Journals (Sweden)

    Bonnie Thomas

    2013-07-01

    Full Text Available In her 2006 memoir, Victoire, les saveurs et les mots, (translated into English as Victoire: My Mother’s Mother, celebrated Guadeloupean writer Maryse Condé makes an explicit comparison between herself and her maternal grandmother Victoire. A work of literary invention as much as of personal reflection, this book represents an example of Condé’s quest to know herself as a woman and a writer. It also enables her to fill in some of the gaps left by her mother Jeanne who was always reluctant to share details of her childhood with her daughter and died when Condé was only twenty. One of the few facts Jeanne gives to her about Victoire is that she was a cook and that the results of her labour helped open the doors to greater autonomy for her daughter and, consequently, her granddaughter. This paper will examine the way in which food and cooking are linked to Condé’s journey of self-discovery as well as to the historical trajectory of the French Caribbean islands of Marie-Galante and Guadeloupe.

  5. A Challenging Time in the History of Lamaze International: An Interview With Francine Nichols

    Science.gov (United States)

    Zwelling, Elaine

    2006-01-01

    Dr. Francine Nichols—President of Lamaze International from 1988 to 1991 (when the organization was known as “the American Society for Psychoprophylaxis in Obstetrics” or “ASPO/Lamaze”) and the founding editor of The Journal of Perinatal Education in 1990—is a woman with many skills that have contributed to her success throughout her career. Dr. Nichols is a knowledgeable leader in maternal-newborn nursing, a respected nurse and childbirth educator, a researcher, and an author. However, these skills were not the abilities she relied upon the most to lead the Lamaze organization through a challenging period in the 1980s; rather, Dr. Nichols's tenacity, business savvy, and willingness to face controversy helped guide Lamaze International back on track so that it was able to grow into the strong organization it remains today. This interview took place by telephone on June 12, 2006, when Dr. Nichols was in Washington, D.C., for the summer to coordinate the National Institute of Nursing Research's Summer Genetics Institute, a doctoral-level course cosponsored by Georgetown University. PMID:17768430

  6. Qualitative Outcomes of Participation in Fishing Components of NOLS Courses

    Directory of Open Access Journals (Sweden)

    Katherine Soule

    2012-03-01

    Full Text Available Numerous fishing education programs in the United States strive to impart hard skill development, as well as life values to youth. This study employs utilizing semi-structured interviewing techniques and means-end analysis to evaluate the effects of youth participation in fishing components of NOLS courses. Interviews were conducted over five years to study benefit retention across time. The fishing component led to thirteen consequences, most frequently to youth feeling a sense of fun and excitement, developing hard skills, and having a new experience/opportunity. In turn, these consequences led youth to a number of values, including transference of information learned or benefits to other areas of their lives, an increased self-respect/esteem/confidence, self-fulfillment, a sense of accomplishment, and self-awareness. These results provide educators and program managers with information to direct programming development for youth attainment and retention of specific participation outcomes.

  7. The ribosome biogenesis factor Nol11 is required for optimal rDNA transcription and craniofacial development in Xenopus.

    Directory of Open Access Journals (Sweden)

    John N Griffin

    2015-03-01

    Full Text Available The production of ribosomes is ubiquitous and fundamental to life. As such, it is surprising that defects in ribosome biogenesis underlie a growing number of symptomatically distinct inherited disorders, collectively called ribosomopathies. We previously determined that the nucleolar protein, NOL11, is essential for optimal pre-rRNA transcription and processing in human tissue culture cells. However, the role of NOL11 in the development of a multicellular organism remains unknown. Here, we reveal a critical function for NOL11 in vertebrate ribosome biogenesis and craniofacial development. Nol11 is strongly expressed in the developing cranial neural crest (CNC of both amphibians and mammals, and knockdown of Xenopus nol11 results in impaired pre-rRNA transcription and processing, increased apoptosis, and abnormal development of the craniofacial cartilages. Inhibition of p53 rescues this skeletal phenotype, but not the underlying ribosome biogenesis defect, demonstrating an evolutionarily conserved control mechanism through which ribosome-impaired craniofacial cells are removed. Excessive activation of this mechanism impairs craniofacial development. Together, our findings reveal a novel requirement for Nol11 in craniofacial development, present the first frog model of a ribosomopathy, and provide further insight into the clinically important relationship between specific ribosome biogenesis proteins and craniofacial cell survival.

  8. Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.

    Science.gov (United States)

    Lee, Soon Goo; Krishnan, Hari B; Jez, Joseph M

    2014-04-29

    The symbiosis between rhizobial microbes and host plants involves the coordinated expression of multiple genes, which leads to nodule formation and nitrogen fixation. As part of the transcriptional machinery for nodulation and symbiosis across a range of Rhizobium, NolR serves as a global regulatory protein. Here, we present the X-ray crystal structures of NolR in the unliganded form and complexed with two different 22-base pair (bp) double-stranded operator sequences (oligos AT and AA). Structural and biochemical analysis of NolR reveals protein-DNA interactions with an asymmetric operator site and defines a mechanism for conformational switching of a key residue (Gln56) to accommodate variation in target DNA sequences from diverse rhizobial genes for nodulation and symbiosis. This conformational switching alters the energetic contributions to DNA binding without changes in affinity for the target sequence. Two possible models for the role of NolR in the regulation of different nodulation and symbiosis genes are proposed. To our knowledge, these studies provide the first structural insight on the regulation of genes involved in the agriculturally and ecologically important symbiosis of microbes and plants that leads to nodule formation and nitrogen fixation.

  9. Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory NolR

    Science.gov (United States)

    The symbiosis between rhizobial microbes and host plants involves the coordinated expression of multiple genes, which leads to nodule formation and nitrogen fixation. As part of the transcriptional machinery for nodulation and symbiosis across a range of Rhizobium, NolR serves as a global regulatory...

  10. Adsorption Isotherms of Phenol and 4-Chlorophenol on Petroleum Asphaltenes Adsorption du phénol et du 4-chlorophénol sur les asphaltènes pétroliers

    Directory of Open Access Journals (Sweden)

    Jaoui M.

    2006-11-01

    Full Text Available The adsorption isotherms for phenol and 4-chlorophenol from water onto asphaltenes flocculated in bulk and asphaltenes deposited on silica were established by frontal analysis chromatography at 293, 298, 303, and 308 K. The adsorption was more important with asphaltenes flocculated in bulk and corresponded to a Freundlich isotherm mechanism. The high adsorbed amount of phenols suggests possible migration of phenols through the loose asphaltene structure. Isotherms observed with the silica coated by asphaltenes showed that adsorption occurs in two stages corresponding probably to two different organizations of solute molecules at the surface. Les isothermes d'adsorption du phénol et du 4-chlorophénol en solution dans l'eau sur des asphaltènes floculés en masse et sur des asphaltènes déposés sur de la silice ont été déterminés par analyse chromatographique frontale à 293, 298, 303 et 308 K. L'adsorption sur des asphaltènes floculés en masse était la plus importante avec des isothermes correspondant à un mécanisme de Freundlich. La quantité élevée de phénols adsorbés suggère une migration possible des molécules du phénol à travers la structure peu compacte des asphaltènes. Les isothermes observés dans le cas de silice tapissée d'asphaltènes ont montré que l'adsorption se produit en deux étapes correspondant probablement à deux organisations différentes des molécules de soluté à la surface.

  11. ELIMINATION DU 4-CHLOROPHÉNOL PAR DES PROCÉDÉS D’OXYDATION AVANCÉE

    OpenAIRE

    BENBACHIR, Hayet

    2010-01-01

    Ce mémoire est consacré à l'étude de l'applicabilité des procédés d’oxydation avancée pour le traitement des eaux contaminées par des polluants organiques. Dans cette étude, nous avons mis en évidence que la cinétique de dégradation et les rendements de minéralisation de 4-Chlorophénol pouvaient être significativement augmentés, par variation des différents paramètres expérimentaux (pH, le rapport R, la concentration du polluant…). Nous avons également déterminé au cours de ce ...

  12. Au ban de la société, à la frontière de l’Amérique : les sorcières et les marginaux dans Moi, Tituba sorcière… de Maryse Condé

    Directory of Open Access Journals (Sweden)

    Maryse Sullivan

    2017-05-01

    Full Text Available Dans cet article, nous étudions la figure de la sorcière dans Moi, Tituba sorcière… de Maryse Condé afin de voir comment elle dialogue avec les discours postcoloniaux et féministes de l’époque. Nous analysons d’abord l’intertextualité construit dans le roman avec la pièce d’Arthur Miller Les sorcières de Salem en regardant comment Condé transforme les événements qui ont eu lieu à Salem en 1692 et comment elle réhabilite le personnage de Tituba. Nous nous penchons ensuite sur la figure de la sorcière et des marginaux dans le texte en vue de comprendre sa construction protéiforme et ses points de contact avec les discours ambiants.

  13. Influenza A H3N2 subtype virus NS1 protein targets into the nucleus and binds primarily via its C-terminal NLS2/NoLS to nucleolin and fibrillarin

    Science.gov (United States)

    2012-01-01

    Background Influenza A virus non-structural protein 1 (NS1) is a virulence factor, which is targeted into the cell cytoplasm, nucleus and nucleolus. NS1 is a multi-functional protein that inhibits host cell pre-mRNA processing and counteracts host cell antiviral responses. Previously, we have shown that the NS1 protein of the H3N2 subtype influenza viruses possesses a C-terminal nuclear localization signal (NLS) that also functions as a nucleolar localization signal (NoLS) and targets the protein into the nucleolus. Results Here, we show that the NS1 protein of the human H3N2 virus subtype interacts in vitro primarily via its C-terminal NLS2/NoLS and to a minor extent via its N-terminal NLS1 with the nucleolar proteins, nucleolin and fibrillarin. Using chimeric green fluorescence protein (GFP)-NS1 fusion constructs, we show that the nucleolar retention of the NS1 protein is determined by its C-terminal NLS2/NoLS in vivo. Confocal laser microscopy analysis shows that the NS1 protein colocalizes with nucleolin in nucleoplasm and nucleolus and with B23 and fibrillarin in the nucleolus of influenza A/Udorn/72 virus-infected A549 cells. Since some viral proteins contain NoLSs, it is likely that viruses have evolved specific nucleolar functions. Conclusion NS1 protein of the human H3N2 virus interacts primarily via the C-terminal NLS2/NoLS and to a minor extent via the N-terminal NLS1 with the main nucleolar proteins, nucleolin, B23 and fibrillarin. PMID:22909121

  14. Tiesas nolēmumu piespiedu izpilde pārrobežu civillietās un komerclietās

    OpenAIRE

    Staltmane, Anda

    2015-01-01

    Autores mērķis, rakstot šo darbu, ir apzināt praksē pastāvošās problēmas pārrobežu civillietās un komerclietās, kas saistītas ar tiesu nolēmumu praktisko izpildi ārvalstīs. Vienlaikus autore izdarīs secinājumus par problēmu cēloņiem, to iespējamiem risinājumiem, t.sk. arī par Latvijas normatīvā regulējuma pilnveidošanu, ņemot vērā arī ārvalstu pieredzi, doktrīnu un citus avotus. Autore, lai sasniegtu šo mērķi, darbā aplūkos galvenokārt starptautiskos dokumentus un nacionālo tiesību regulēj...

  15. Annonce du diagnostic et rupture biographique | Francine | African ...

    African Journals Online (AJOL)

    African Sociological Review / Revue Africaine de Sociologie. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 14, No 2 (2010) >. Log in or Register to get access to full text downloads.

  16. Concentration urinaire de bisphénol A et obésité chez les adultes : résultats de l’Enquête canadienne sur les mesures de la santé

    Directory of Open Access Journals (Sweden)

    Minh T. Do

    2017-01-01

    Full Text Available Introduction : Des études chez l’animal ont révélé que l’exposition au bisphénol A (BPA affecte le métabolisme des lipides et favorise la prise de poids. Des études épidémiologiques récentes appuient aussi l’existence d’un lien entre le BPA et l’obésité chez l’humain, mais la plupart d’entre elles se limitent à une seule mesure de l’adiposité ou ne tiennent pas compte des facteurs de confusion alimentaires possibles. Cette étude vise à examiner les associations entre les concentrations urinaires de BPA et les mesures de l’adiposité dans un échantillon national représentatif des adultes canadiens. Méthodologie : Nous avons réalisé des analyses à l’aide de données de biosurveillance et de données anthropométriques mesurées directement auprès de 4 733 adultes de 18 à 79 ans dans le cadre de l’Enquête canadienne sur les mesures de la santé (2007-2011. Nous avons utilisé des modèles de régression logistique multinomiale et binaire pour estimer les associations entre, d’une part, les concentrations urinaires de BPA et, d’autre part, les diverses catégories d’indice de masse corporelle (IMC (embonpoint par opposition à poids insuffisant ou normal; obésité par opposition à poids insuffisant ou normal et un tour de taille élevé (102 cm ou plus pour les hommes; 88 cm ou plus pour les femmes en tenant compte des facteurs de confusion possibles. Des analyses de régression linéaire ont aussi été effectuées pour évaluer les associations entre les concentrations urinaires de BPA et des mesures de l’IMC et du tour de taille. Résultats : On a pu associer positivement la concentration urinaire de BPA et l’obésité (définie par l’IMC. Le rapport de cotes s’est situé à 1,54 (intervalle de confiance [IC] à 95 % : 1,002 à 2,37 dans le quartile de BPA le plus élevé par rapport au plus bas (test de tendance, p = 0,041. La concentration urinaire de BPA n’a pas été associ

  17. Performance de deux techniques d'extraction des phénols ...

    African Journals Online (AJOL)

    Influence in vitro des composes phénoliques des jeunes feuilles du pécher. Prunus persica (1) Batsch, sur le puceron vert du pecher, Myzus persicae sulzer. Agronomie 8 (9) : 787-792. Bell J.N., Dixon R.A., Bailey J.A., Rowell P.M. &. Lamb C.J., 1984. Differential induction of chalcone synthase mRNA activity at the onset.

  18. The NOL ballistic piston compressor 2: Operation up to 5,000 ATM

    Science.gov (United States)

    Hammond, G. L.; Lalos, G. T.

    1971-01-01

    Experiments are described which demonstrated the feasibility of rapidly compressing inert gases in a ballistic piston compressor to simultaneously high temperatures and densities previously unobtainable in the laboratory. With argon, temperatures of the order of 6000 K and accompanying densities of the order of 100 Amagats have been obtained; and with nitrogen, temperatures and densities of 3000 K and 400 Amagats have been approached. Details of the design, assembly, instrumentation, and operating procedures are presented, and the results of mechanical and thermal performance tests up to 5000 atmospheres pressure are described. Emphasis is placed on experiments which demonstrated the usefulness of this apparatus for spectral line broadening studies.

  19. 40 CFR 721.1850 - Toluene sulfonamide bis-phe-nol A epoxy adduct.

    Science.gov (United States)

    2010-07-01

    ... methods for protecting against such risk, into a Material Safety Data Sheet (MSDS) as described in § 721... epoxy adduct. 721.1850 Section 721.1850 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... or method of manufacture, import, or processing associated with any use of this substance without...

  20. Dosage des polyphénols et activité anti-oxydante de feuilles et d ...

    African Journals Online (AJOL)

    Borassus aethiopum est une plante de la famille des Arécacées. C'est un géant palmier qui présente un tronc dur appelé stipe, des racines fasciculées et des feuilles longues en forme d'éventail. Elle est presque cosmopolite et ses différentes parties sont utilisées dans nombreux domaines : économiques, écologiques, ...

  1. Conception et synthèse de sondes moléculaires pour l'étude d'interactions polyphénol-protéine

    OpenAIRE

    Tran , Dong tien

    2015-01-01

    Polyphenols are plant secondary metabolites. These natural substances, known for their antioxidant and anti-free radical properties, generally contribute to the protection of human health not only against cardiovascular and neurodegenerative diseases, but also against certain cancers and diabetes. In some cases, these beneficial biological effects could also be related to specific polyphenol-protein interactions. However, studying this type of interactions has suffered from the lack of adequa...

  2. Modélisation de la rétention de phénols séparés par CLHP – PI ...

    African Journals Online (AJOL)

    Key-words: Phenols – RP / HPLC – Retention – QSRR model. Auteur correspondant : d_messadi@yahoo.fr ...... Introduction to linear regression analysis, 2nd edition, Wiley Interscience, New York. [19] Matlab, 2004. Version 7.0.0.19920. (Release 14). The language of technical computing. The Math Works, Inc. May 06.

  3. PELECEHAN SEKSUAL TERHADAP TOKOH PEREMPUAN DALAM NOVEL PEREMPUAN DI TITIK NOL KARYA NAWAL EL-SAADAWI DAN THE COLOUR PURPLE KARYA ALICE WALKER

    Directory of Open Access Journals (Sweden)

    Dwi Sulistyorini

    2016-10-01

    Full Text Available The purpose of this study is to know what kinds of sexual abuse that have been done to the women figures in the novels “Perempuan di Titik Nol” by Nawal El Saadawi and “The Color Purple” by Alice Walker. Besides, the purpose of the study is to know the impact of sexual abuse that happened to the women. To achieve the objectives above, the study used qualitative design and feminism approach. The re- sult of the studyshows that sexual abuse happened to the leading women figures in the novels from before, during, and after theirmarriage. The kinds of sexual abuse which happened to the leading women figures are gender harrassment,  seduction behaviour, sexual bribery, sexual coercion, dan sexual imposition

  4. Kesk- ja Ida-Euroopa kunstiajaloo "rändseminarid" / Krista Kodres

    Index Scriptorium Estoniae

    Kodres, Krista, 1957-

    2013-01-01

    USA-s Williamstownis tegutseva Clarki kunstiinstituudi (The Sterling and Francine Clark Art Institute) korraldatud seminaridest aastatel 2010-2012 teemal "Unfolding Narratives: Art Histories in East-Central Europe after 1989"

  5. Preparation, spectroscopic studies and X-ray structure of homobinuclear lanthanide(III complexes derived from 2,6-diformyl-4-chlorophénol-bis-(2’-hydroxy-benzoylhydrazone

    Directory of Open Access Journals (Sweden)

    Pepe Marcel Haba

    2006-06-01

    Full Text Available Reaction of the 2,6-diformyl-4-chlorophenol-bis-(2'-hydroxy-benzoylhydrazone with Ln(NO33.nH2O (n = 5 or 6 and Ln = Y, La, Ce, Pr, Nd, Sm, Gd, Dy, Er and Yb produces homobinuclear complexes. These complexes have been characterized by analysis, molar conductance, magnetic measurements, infrared spectral studies and X-ray diffraction. The analytical data showed 1:3 (metal:ligand stoichiometry. Molar conductance measurements in dmf indicate 1:3 electrolytes in all cases. Magnetic moment values are close proximity of the Van Vleck values. IR studies suggest the coordination of the ligand is through the azomethine, the phenolic oxygen atom and the carbonyl oxygen of the hydrazonic moiety. The nitrate ion is also found to be ionic in all the complexes. An X-ray structure determination of [C66H48N12O15Cl3Er2]Cl2NO3.5H2O confirms the conclusion from the spectroscopic studies and show that the erbium is at the centre of a tricapped trigonal prism with coordination number nine. In all the complexes the lanthanide ions have substantially similar coordination.

  6. Meet Jessica and Elizabeth from Sweet Valley: Who Are the Female Role Models in Popular Romance Novels for Children?

    Science.gov (United States)

    Roberts, Sherron Killingsworth

    Jessica and Elizabeth are two female characters, twins, featured throughout Francine Pascal's Sweet Valley series, the Bantam Publishers popular series for girls from elementary school through junior high, high school, university, and well into adulthood. This paper notes that these books are a part of the same formula that are used for romance…

  7. Twenty-Five Years and Counting of "Sweet Valley": Jessica and Elizabeth in Romance Novels for Young Children?

    Science.gov (United States)

    Roberts, Sherron Killingsworth

    2010-01-01

    With the 2008 reissue of Francine Pascal's (1983) "Sweet Valley High", the popular cultural icons of twins Jessica and Elizabeth have been revitalized. Jessica and Elizabeth are the much-beloved protagonists in romance novels strategically targeted for young adults in "Sweet Valley High" or "Sweet Valley U", and for first- and second-grade readers…

  8. 76 FR 14351 - Proposed Withdrawal of Certain Federal Aquatic Life Water Quality Criteria Applicable to Wisconsin

    Science.gov (United States)

    2011-03-16

    ... Proposed Withdrawal of Certain Federal Aquatic Life Water Quality Criteria Applicable to Wisconsin AGENCY... aquatic life water quality criteria for chronic and acute copper and nickel, and chronic endrin and...., Washington, DC 20460 or Francine Norling, Proposed Withdrawal of Certain Federal Aquatic Life Water Quality...

  9. A novel CYP1A1 gene polymorphism and the risk of head and neck ...

    African Journals Online (AJOL)

    Administrator

    2011-06-15

    Jun 15, 2011 ... 5274 Afr. J. Biotechnol. The principal enzymes ..... Amalio T, Paul I, Francine M, Tobias S, Thomas B (1993). Direct, automated .... Olshan A, Weissler M, Watson MA, Bell D (2000). GSTM1, GSTT1, ... Jr. JF, editors. Cancer ...

  10. Lighting the Flame: Teaching High School Students To Love, Not Loathe, Literature.

    Science.gov (United States)

    Milburn, Michael

    2001-01-01

    Discusses how Francine Prose accuses English teachers of assigning simplistic, badly written books that breed incompetent writers and readers who loathe literature. Notes that Prose focuses her contempt upon "To Kill a Mockingbird" and Maya Angelou's "I Know Why the Caged Bird Sings." Suggests that students show teachers how to help them love…

  11. Thank you

    CERN Multimedia

    GS Department

    2009-01-01

    We have been deeply touched by the expressions of sympathy and affection from all the friends and colleagues of Ron at CERN. As it is impossible to answer each one, Sophie, Marc and myself would like to express our gratitude to everyone who sent their condolences. Francine Forrest

  12. (μ-Acetato-κ2 O:O′)[μ-2,6-bis­({bis­[(pyri­din-2-yl-κN)meth­yl]amino-κN}meth­yl)-4-methyl­phenolato-κ2 O:O](metha­nol-κO)dizinc bis­(perchlorate)

    Science.gov (United States)

    Das, Biswanath; Haukka, Matti; Nordlander, Ebbe

    2014-01-01

    The binuclear title complex, [Zn2(C33H33N6O)(CH3COO2)(CH3OH)](ClO4)2, was synthesized by the reaction between 2,6-bis­({[bis­(pyridin-2-yl)meth­yl]amino}­meth­yl)-4-methyl­phenol (H-BPMP), Zn(OAc)2 and NaClO4. The two ZnII ions are bridged by the phenolate O atom of the octadentate ligand and the acetate group. An additional methanol ligand is terminally coordinated to one of the ZnII ions, rendering the whole structure unsymmetric. Other symmetric dizinc complexes of BPMP have been reported. However, to the best of our knowledge, the present structure, in which the two ZnII ions are distinguishable by the number of coordinating ligands and the coordination geometries (octahedral and square-pyramidal), is unique. The dizinc complex is a dication, and two perchlorate anions balance the charge. The –OH group of the coordinating methanol solvent mol­ecule forms a hydrogen bond with a perchlorate counter-anion. One of the anions is disordered over two sets of sites with an occupancy ratio of 0.734 (2):0.266 (2). PMID:24826088

  13. 2298-IJBCS-Article-Roger Niebié

    African Journals Online (AJOL)

    hp

    Nord du Burkina Faso ont fait l'objet d'une étude comparative de leurs teneurs en polyphénols totaux et de leurs activités antioxydantes en fonction du système de solvant et du type d'extraction. Les teneurs en polyphénols totaux ont.

  14. Les dynamiques de partager un récit: Auteur, autorité et auto-récit ...

    African Journals Online (AJOL)

    chez Maryse Condé et Tituba, dans Moi, Tituba, Sorcière…noire de Salem. Ceci est un récit fictif de la vie de Tituba, Indienne, une esclave accusée de la sorcellerie en 1692. L'article adopte l' idée de la poétique de la relation par Édouard ...

  15. Investigation of the interaction of iron(III) complexes with dAMP by ESI-MS, MALDI-MS and potentiometric titration: insights into synthetic nuclease behavior.

    Science.gov (United States)

    Fernandes, Christiane; Oliveira Moreira, Rafaela; Lube, Leonardo M; Horn, Adolfo; Szpoganicz, Bruno; Sherrod, Stacy; Russell, David H

    2010-06-07

    We report herein the characterization by electrospray ionization (ESI) mass spectrometry (MS), matrix assisted laser desorption ionization (MALDI-MS) and potentiometric titration of three iron(III) compounds: [Fe(III)(HPClNOL)Cl2]·NO3 (1), [Cl(HPClNOL)Fe(III)-(μ-O)-Fe(III)(HPClNOL)Cl]·Cl2·H2O (2) and [(SO4)(HPClNOL)Fe(III)-(μ-O)-Fe(III)(HPClNOL)(SO4)]·6H2O (3), where HPClNOL= 1-(bis-pyridin-2-ylmethyl-amino)-3-chloropropan-2-ol). Despite the fact that the compounds have distinct structures in solid state and non-buffered solution, all compounds present similar ESI and MALDI mass spectra in a buffered medium (pH 7.0). At this pH, the species [(PClNOL)Fe(III)-(μ-O)-Fe(III)(PClNOL)](2+) (m/z 354) was observed for all the compounds under investigation. Potentiometric titration confirms a similar behavior for all compounds, indicating that the dihydroxo form [(OH)(HPClNOL)Fe(III)-(μ-O)-Fe(III)(HPClNOL)(OH)](2+) is the major species at pH 7.0, for all the compounds. The products of the interaction between compounds (1), (2) and (3) and dAMP (2'-deoxyadenosine-5'-monophosphate) in a buffered medium (pH 7.0) were identified by MALDI-MS/MS. The fragmentation data obtained by MS/MS allow one to identify the nature of the interaction between the iron(III) compounds and dAMP, revealing the direct interaction between the iron center and phosphate groups.

  16. Effect of nano-oxide layers on giant magnetoresistance in pseudo-spin-valves using Co2FeAl electrodes

    International Nuclear Information System (INIS)

    Zhang, D.L.; Xu, X.G.; Wu, Y.; Miao, J.; Jiang, Y.

    2011-01-01

    We studied the pseudo-spin-valves (PSVs) with a structure of Ta/Co 2 FeAl/NOL 1 /Co 2 FeAl/Cu/Co 2 FeAl/NOL 2 /Ta, where NOL represents the nano-oxide layer. Compared with the normal Co 2 FeAl (CFA) PSV with a structure of Ta/Co 2 FeAl/Cu/Co 2 FeAl/Ta, which shows only a current-in-plane (CIP) giant magnetoresistance (GMR) of 0.03%, the CFA PSV with NOLs shows a large CIP-GMR of 5.84%. The enhanced GMR by the NOLs inserted in the CFA PSV is due to the large specular reflection caused by [(CoO)(Fe 2 O 3 )(Al 2 O 3 )] in NOL 1 and [(Fe 2 O 3 )(Al 2 O 3 )(Ta 2 O 5 )] in NOL 2 . Another reason is that the roughness of the interface between Ta and CFA is improved by the oxidation procedure. - Research highlights: → Nano-oxide layers are applied in the pseudo-spin-valves with the Heusler alloy. → The CIP-GMR of pseudo-spin-valves is improved from 0.03% to 5.84%. → The GMR ratio is decided by the position of nano-oxide layers.

  17. From “Modern” to “Contemporary”: A Case in Post-Cultural Revolutionary Art

    Directory of Open Access Journals (Sweden)

    Wu Hung

    2011-06-01

    Full Text Available This paper was to have been Wu Hung’s contribution to the conference “Contemporaneity in the History of Art” at the Sterling and Francine Clark Institute, Williamstown, Mass., October 8 and 9, 2009. However, he was unable to attend. The paper is presented here in the form in which it would have been presented. See also, in this issue of Contemporaneity, notes from this conference by its convener, Terry Smith.

  18. Self-aligned periodic Ni nano dots embedded in nano-oxide layer

    International Nuclear Information System (INIS)

    Doi, M.; Izumi, M.; Kawasaki, S.; Miyake, K.; Sahashi, M.

    2007-01-01

    The Ni nano constriction dots embedded in the Ta-nano-oxide layer (NOL) was prepared by the ion beam sputtering (IBS) method. After the various conditions of the oxidations, the structural analyses of the NOL were performed by RHEED, AES and in situ STM/AFM observations. From the current image of the conductive AFM for NOL, the periodically aligned metallic dots with the size around 5-10 nm were successfully observed. The mechanism of the formation of the self-organized aligned Ni nano constriction dots is discussed from the standpoint of the grain size, the crystal orientation, the preferred oxidation of Ta at the diffused interface

  19. Molecule of the Month

    Indian Academy of Sciences (India)

    having solutions coloured red in methanol, violet in etha- nol, blue in isopropyl alcohol, green in acetone and green- ish-yellow in anisole. The electronic ... concentrated sulfuric acid to obtain a symmetric triphenylpyrelium. Box 1. Compounds ...

  20. Toxicological evaluation of methanol leaves extract of Vernonia ...

    African Journals Online (AJOL)

    Treatment with 800mg/kg body weight of methanol leaf extract significantly decreased body .... active ingredient (Dichloromethane/DCM) in metha- nol leaf .... formalin over night at room temperature after blood ..... Ehrlich`s tumor cells in mice.

  1. Chemical properties and GMR improvement of specular spin valves with nano-oxide layers, formed in ambient mixed gases

    International Nuclear Information System (INIS)

    Quang, H D; Hien, N T; Oh, S K; Sinh, N H; Yu, S C

    2004-01-01

    Specular spin valves (SVs) containing nano-oxide layers (NOLs) structured as substrate/seed/AF/P 1 /NOL/P 2 /Cu/F/NOL, have been fabricated. The NOLs were formed by natural oxidation in different ambient atmospheres of pure oxygen, oxygen/nitrogen and oxygen/argon gas mixtures. The fabrication conditions were optimized to enhance the magnetoresistance (MR) ratio, to suppress the interlayer coupling fields (H f ) between the free and pinned layers, to suppress the high interface density of the NOL, to ease the control of the NOL thickness and to form a smooth NOL/P 2 interface for promoting specular electron scattering. The characteristics of our specular SVs are the MR ratio of 14.1%, the exchange bias field of 44-45 mT, and H f weaker than 1.0 mT. The optimal conditions for oxidation time, total oxidation pressure and the annealing temperature were found to be 300 s, 0.14 Pa (oxygen/argon = 80/20) and 250 deg. C, respectively. Also, the origin of thermal stability of MMn-based (M = Fe, Pt, Ir, etc) specular SVs has been explained in detail by chemical properties of NOL using secondary-ion mass spectroscopy and x-ray photoelectron spectroscopy depth profile analyses. Thermal stability turns out to be caused by a decrease in MR ratios at high temperatures (>250 deg. C), which is a serious problem for device applications using the SV structure as a high density read head device

  2. Chlorophyll b degradation by chlorophyll b reductase under high-light conditions.

    Science.gov (United States)

    Sato, Rei; Ito, Hisashi; Tanaka, Ayumi

    2015-12-01

    The light-harvesting chlorophyll a/b binding protein complex of photosystem II (LHCII) is the main antenna complex of photosystem II (PSII). Plants change their LHCII content depending on the light environment. Under high-light conditions, the content of LHCII should decrease because over-excitation damages the photosystem. Chlorophyll b is indispensable for accumulating LHCII, and chlorophyll b degradation induces LHCII degradation. Chlorophyll b degradation is initiated by chlorophyll b reductase (CBR). In land plants, NON-YELLOW COLORING 1 (NYC1) and NYC1-Like (NOL) are isozymes of CBR. We analyzed these mutants to determine their functions under high-light conditions. During high-light treatment, the chlorophyll a/b ratio was stable in the wild-type (WT) and nol plants, and the LHCII content decreased in WT plants. The chlorophyll a/b ratio decreased in the nyc1 and nyc1/nol plants, and a substantial degree of LHCII was retained in nyc1/nol plants after the high-light treatment. These results demonstrate that NYC1 degrades the chlorophyll b on LHCII under high-light conditions, thus decreasing the LHCII content. After the high-light treatment, the maximum quantum efficiency of the PSII photochemistry was lower in nyc1 and nyc1/nol plants than in WT and nol plants. A larger light-harvesting system would damage PSII in nyc1 and nyc1/nol plants. The fluorescence spectroscopy of the leaves indicated that photosystem I was also damaged by the excess LHCII in nyc1/nol plants. These observations suggest that chlorophyll b degradation by NYC1 is the initial reaction for the optimization of the light-harvesting capacity under high-light conditions.

  3. CREDIT AGRICOLE

    CERN Multimedia

    2001-01-01

    The Crédit Agricole wishes to inform its CERN customers that the bank's Prévessin site premises are to be refurbished with a view to improving and extending services to customers. Duration of the work: from Monday 28 May 2001 to Wednesday 25 July 2001. Routine services will be maintained throughout this period, and for any other matters customers are invited to contact our GEX branch, where Maryse MEIGNIEN will be available to answer any enquiries. We thank you for your understanding during this period.

  4. NOA36 Protein Contains a Highly Conserved Nucleolar Localization Signal Capable of Directing Functional Proteins to the Nucleolus, in Mammalian Cells

    Science.gov (United States)

    de Melo, Ivan S.; Jimenez-Nuñez, Maria D.; Iglesias, Concepción; Campos-Caro, Antonio; Moreno-Sanchez, David; Ruiz, Felix A.; Bolívar, Jorge

    2013-01-01

    NOA36/ZNF330 is an evolutionarily well-preserved protein present in the nucleolus and mitochondria of mammalian cells. We have previously reported that the pro-apoptotic activity of this protein is mediated by a characteristic cysteine-rich domain. We now demonstrate that the nucleolar localization of NOA36 is due to a highly-conserved nucleolar localization signal (NoLS) present in residues 1–33. This NoLS is a sequence containing three clusters of two or three basic amino acids. We fused the amino terminal of NOA36 to eGFP in order to characterize this putative NoLS. We show that a cluster of three lysine residues at positions 3 to 5 within this sequence is critical for the nucleolar localization. We also demonstrate that the sequence as found in human is capable of directing eGFP to the nucleolus in several mammal, fish and insect cells. Moreover, this NoLS is capable of specifically directing the cytosolic yeast enzyme polyphosphatase to the target of the nucleolus of HeLa cells, wherein its enzymatic activity was detected. This NoLS could therefore serve as a very useful tool as a nucleolar marker and for directing particular proteins to the nucleolus in distant animal species. PMID:23516598

  5. Matter-wave two-dimensional solitons in crossed linear and nonlinear optical lattices

    International Nuclear Information System (INIS)

    Luz, H. L. F. da; Gammal, A.; Abdullaev, F. Kh.; Salerno, M.; Tomio, Lauro

    2010-01-01

    The existence of multidimensional matter-wave solitons in a crossed optical lattice (OL) with a linear optical lattice (LOL) in the x direction and a nonlinear optical lattice (NOL) in the y direction, where the NOL can be generated by a periodic spatial modulation of the scattering length using an optically induced Feshbach resonance is demonstrated. In particular, we show that such crossed LOLs and NOLs allow for stabilizing two-dimensional solitons against decay or collapse for both attractive and repulsive interactions. The solutions for the soliton stability are investigated analytically, by using a multi-Gaussian variational approach, with the Vakhitov-Kolokolov necessary criterion for stability; and numerically, by using the relaxation method and direct numerical time integrations of the Gross-Pitaevskii equation. Very good agreement of the results corresponding to both treatments is observed.

  6. Matter-wave two-dimensional solitons in crossed linear and nonlinear optical lattices

    Science.gov (United States)

    da Luz, H. L. F.; Abdullaev, F. Kh.; Gammal, A.; Salerno, M.; Tomio, Lauro

    2010-10-01

    The existence of multidimensional matter-wave solitons in a crossed optical lattice (OL) with a linear optical lattice (LOL) in the x direction and a nonlinear optical lattice (NOL) in the y direction, where the NOL can be generated by a periodic spatial modulation of the scattering length using an optically induced Feshbach resonance is demonstrated. In particular, we show that such crossed LOLs and NOLs allow for stabilizing two-dimensional solitons against decay or collapse for both attractive and repulsive interactions. The solutions for the soliton stability are investigated analytically, by using a multi-Gaussian variational approach, with the Vakhitov-Kolokolov necessary criterion for stability; and numerically, by using the relaxation method and direct numerical time integrations of the Gross-Pitaevskii equation. Very good agreement of the results corresponding to both treatments is observed.

  7. Identification of signals that facilitate isoform specific nucleolar localization of myosin IC

    Energy Technology Data Exchange (ETDEWEB)

    Schwab, Ryan S.; Ihnatovych, Ivanna; Yunus, Sharifah Z.S.A.; Domaradzki, Tera [Department of Physiology and Biophysics, University at Buffalo—State University of New York, Buffalo, NY (United States); Hofmann, Wilma A., E-mail: whofmann@buffalo.edu [Department of Physiology and Biophysics, University at Buffalo—State University of New York, Buffalo, NY (United States)

    2013-05-01

    Myosin IC is a single headed member of the myosin superfamily that localizes to the cytoplasm and the nucleus, where it is involved in transcription by RNA polymerases I and II, intranuclear transport, and nuclear export. In mammalian cells, three isoforms of myosin IC are expressed that differ only in the addition of short isoform-specific N-terminal peptides. Despite the high sequence homology, the isoforms show differences in cellular distribution, in localization to nuclear substructures, and in their interaction with nuclear proteins through yet unknown mechanisms. In this study, we used EGFP-fusion constructs that express truncated or mutated versions of myosin IC isoforms to detect regions that are involved in isoform-specific localization. We identified two nucleolar localization signals (NoLS). One NoLS is located in the myosin IC isoform B specific N-terminal peptide, the second NoLS is located upstream of the neck region within the head domain. We demonstrate that both NoLS are functional and necessary for nucleolar localization of specifically myosin IC isoform B. Our data provide a first mechanistic explanation for the observed functional differences between the myosin IC isoforms and are an important step toward our understanding of the underlying mechanisms that regulate the various and distinct functions of myosin IC isoforms. - Highlights: ► Two NoLS have been identified in the myosin IC isoform B sequence. ► Both NoLS are necessary for myosin IC isoform B specific nucleolar localization. ► First mechanistic explanation of functional differences between the isoforms.

  8. Grèce, pays d’immigration : Perspectives historiques et sociologiques

    Directory of Open Access Journals (Sweden)

    Dimitrios Parsanoglou

    2010-05-01

    Full Text Available Thèse soutenue le 4 mai 2009Composition du JuryMarie - Claude Blanc - Chaléard, Maître de conférences à l’Université Paris 1, Georges Dertilis, Directeur d'études à l’ÉHESS, Nancy Green, Directrice d'études à l’ÉHESS (direction de thèse, Pierre Sintès, Maître de conférences à l’Université de Provence, Maryse Tripier, Professeur émérite à l’Université Paris 7.RésuméCette thèse se divise en trois parties relativement autonomes mais reliées. La première partie, intitulée « L’histoire migratoire...

  9. Inscribir, mostrar y recrear una cicatriz: infancia y escritura en la novela autobiográfica del Caribe

    Directory of Open Access Journals (Sweden)

    Claudia Amigo

    2013-12-01

    Full Text Available ¿Qué papel tiene la escritura en un relato de infancia? El presente artículo intenta responder esa pregunta a partir de la lectura de tres narrativas de inspiración autobiográfica del Caribe: Chemin d'école [Camino a la escuela] (1994, de Patrick Chamoiseau; Una casa para Mr. Biswas, de V.S. Naipaul (1961 y Le coeur à rire et à pleurer [Un corazón que ríe y llora] (1999, de Maryse Condé. En todas esas obras observamos los momentos en que la escritura se torna un problema para los personajes-niños y relacionamos esos episodios con la imagen de la cicatriz. Hacia el final, esbozamos una relación posible entre esa imagen y el concepto de glocalización, de Zygmunt Bauman.

  10. Agile Objects: Component-Based Inherent Survivability

    Science.gov (United States)

    2003-12-01

    pages 37-55, February 1990. [3] Clar, David D., Van Jacobson, John Romkey, and Howard Salwen. “An analysis of TCP processing overhead”. IEEE...www.microsoft.com/technet/treeview/default.asp?url=/technet/prodtech nol/acs/Default.asp 34. Chaum , D.L., Untraceable Electronic Mail, Return

  11. Benchmarking Outdoor Expeditionary Program Risk Management Strategies

    Science.gov (United States)

    Meerts-Brandsma, Lisa; Furman, Nate; Sibthorp, Jim

    2017-01-01

    In 2003, the University of Utah and the National Outdoor Leadership School (NOLS) completed a study that developed a risk management taxonomy in the outdoor adventure industry and assessed how different outdoor expeditionary programs (OEPs) managed risk (Szolosi, Sibthorp, Paisley, & Gookin, 2003). By unifying the language around risk, the…

  12. The Cost of Becoming an Outdoor Instructor.

    Science.gov (United States)

    Cashel, Chris

    This article describes instructor criteria in three outdoor organizations: Outward Bound (OB), the National Outdoor Leadership School (NOLS), and the Wilderness Education Association (WEA). Common requirements for outdoor leadership programs are outdoor experience and skills, advanced first aid, CPR, and a minimum age requirement. Traditionally…

  13. Lipophilic Super-Absorbent Swelling Gels as Cleaners for Use on Weapons Systems and Platforms

    Science.gov (United States)

    2014-02-01

    Tetrahydrofuran (THF), isopropa- nol, acetonitrile, and dichloromethane were obtained from Acros Organics (Morris Plains, NJ). Dimethylsulfoxide ( DMSO ) and 1...1. In the following solvents , swelling degree did not change in both heating and cooling processes: water, DMSO , methanol, ethanol, isopropanol...available alkylstyrene copolymer (imbiber beads). The cleaning ability of the gels was compared with the standard solvent cleaner trichloroethylene

  14. Analisis Perbandingan Karakteristik Berbeban Generator Arus Searah Penguatan Bebas Dengan Generator Arus Searah Penguatan Shunt

    OpenAIRE

    Ardian S., Randy Niko

    2010-01-01

    Berdasarkan cara memberikan fluks pada kumparan medannya, generator DC dikelompokkan menjadi dua yaitu generator berpenguatan bebas dan generator berpenguatan sendiri. Karakteristik yang ada pada generator DC antara lain karakteristik beban nol, karakterik berbeban, dan karakteristik luar. Pada karakteristik berbeban sebuah generator DC menunjukkan bagaimana hubungan antara tegangan terminal Vt dan arus medan If ketika generator dibebani. Bila generator dibebani maka akan mengalir arus beb...

  15. Analisis Perbandingan Karakteristik Luar Generator Arus Searah Penguatan Bebas Dengan Generator Arus Searah Penguat Shunt

    OpenAIRE

    Arwinsyah

    2009-01-01

    Generator DC digunakan untuk peralatan yang membutuhkan supply arus searah. Berdasarkan cara memberikan fluks pada kumparan medannya, generator DC dikelompokkan menjadi dua yaitu generator berpenguatan bebas dan generator berpenguatan sendiri. Karakteristik yang ada pada generator DC antara lain karakteristik beban nol, karakterik berbeban, dan karakteristik luar. Karakteristik luar sebuah generator DC menunjukkan bagaimana perubahan tegangan terminal ( Vt ) terhadap beban yang berubah – ubah...

  16. A preliminary investigation of the water use efficiency of sweet ...

    African Journals Online (AJOL)

    2016-01-01

    Jan 1, 2016 ... ridges); sugary juice from its stalk (for making syrup or etha- nol); and bagasse and green leaves (as an ... switched off 3 weeks prior to the harvest date. The plants were harvested when the grain ..... sorghum yield is sensitive to planting date and low yields can result if the crop is planted too early (not cold ...

  17. Physiochemical characteristics of honey obtained from traditional ...

    African Journals Online (AJOL)

    Bheema

    2002-09-14

    Sep 14, 2002 ... There are about 201,000 bee colonies and 2,300 tones of honey production in a year (BoANRD, 2008). ..... to honey. 74/409/EEC, Official Journal of the European communities, NOL 221/14. ... Composition of American honey.

  18. AcEST: BP917010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ructural polyprotein OS=Eastern equine en... 29 9.9 sp|Q6NVM6|NOL10_XENTR Nucleolar protein 10 OS=Xenopus tr...ct: 166 KVPDDEIQALQQHGHWTVERI-EPLVVPALDA 196 >sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine

  19. M Moringa a extra eff acts us fects o sed in on etha sugarc anolic ...

    African Journals Online (AJOL)

    sunny

    wine quality a. Juice clarific yces cerevisia. N of the most. United States estimated approximately. 2014). In this . After extrac and insoluble author. E-mail: that this article ..... nol industry, ors during ferm nse-quently e re 1. Interaction mentation speed. Brazil; Season letters compare. , TRS, TPC a e TRS values ant reduction.

  20. Magnetic properties comparison of mass standards among seventeen national metrology institutes

    CSIR Research Space (South Africa)

    Becerra, LO

    2006-09-01

    Full Text Available ), 1, Rue Gaston Boissier, 75015 Paris, France 13 Centro Espa?nol de Metrologia (CEM), c/ del Alfar, 2 ? Apartado 37, 28760 Tres Cantos (Madrid), Spain 14 National Metrology Institute of Japan, National Institute of Advanced Industrial Science...

  1. Natural pomegranate juice reduces inflammation, muscle damage ...

    African Journals Online (AJOL)

    Ammar Achraf

    Therefore, the purpose of the present study is to investigate the effect of natural pomegranate juice (POMj) rich in ... POMj rich in polyphe- nols seems to have a power anti-inflammatory effect and to be an effective treatment for patients who ... cellular transcription factors such as the nuclear factor NF-kB. (NF-kB), tumor ...

  2. Fulltext PDF

    Indian Academy of Sciences (India)

    red to the number expected from calcula- tions based on the standard solar model and the standard model of elementary ..... had need have a Great memory; /fhe Confer little, he had need have a Present Wit: And ifhe Read little, he had need have much Cunning. to seem to know that. he doth nol. Histories make Men Wise; ...

  3. Sélection d\\'un champignon filamenteux pour l\\'épuration des eaux ...

    African Journals Online (AJOL)

    Son exposition préalable au phénol augmente sa vitesse de respiration nette en présence de celui-ci et du catéchol. Par contre, son adaptation ... Making the choice of a microorganism for wastewater treatment is difficult, since this organism must conserve it metabolic activity under stress condition. Discrimination between ...

  4. Aerodynamics of Combat Aircraft Controls and of Ground Effects: Conference Proceedings of the Symposium of the Fluid Dynamics Panel Held in Madrid, Spain on 2-5 October 1989

    Science.gov (United States)

    1989-10-01

    iCtnan u c’. 23-) 0 Touchdown - Analyzed pordon of maneuver =-2907 ft 34G.ft --- 2000 ft 5700an ft - 7 T 0 Wesl camara e Eost coaera 516411 ., . -20 -0... drone sun Icaesile i’avliou me pose do fait do dfiveiuppessiit, nol soaffinric, de is ionerta unmite. Lu aims- Iloion do soi coosiste don,, A s’aifrsorbir

  5. New insight into hybridization and unidirectional introgression between Ammodytes japonicus and Ammodytes heian (Trachiniformes, Ammodytidae).

    Science.gov (United States)

    Kim, Jin-Koo; Bae, Seung Eun; Lee, Soo Jeong; Yoon, Moon Geun

    2017-01-01

    Based on northern (NOL) and southern (SOL) mitochondrial lineages, recently, it proposed the new species Ammodytes heian and revived the species name Ammodytes japonicus to describe sand lances from the northwestern Pacific Ocean. This study used molecular methods to investigate genetic relationships between the two sand lance species in Korea and Japan. In total, 154 specimens were collected from four locations in Korea (Baengnyeongdo in the Yellow Sea, Tongyeong in the Korean Strait, and Jumunjin and Gijang in the East Sea), and 50 specimens were collected from a single location in Japan (Wakkanai in the Okhotsk Sea). Mitochondrial DNA analysis demonstrated that the individuals from Baengnyeongdo and Tongyeong all belonged to the SOL, whereas those from Gijang, Jumunjin, and Wakkanai included individuals from both the NOL and SOL (over 75% NOL). Population structure analyses were performed on the same individuals using seven microsatellite DNA markers. The population structure analysis based on 201 specimens identified two clusters (named as northern group and southern group), with the admixture proportion (q) of heian. However, the admixture proportion in the Jumunjin and Gijang sand lances was 0.71-0.75 for the southern group, indicating that hybridization and unidirectional introgression from SOL to NOL occurs in southwestern margin of the East Sea. Our findings illustrate the speciation process based on different patterns of gene flow between Korean and Japanese sand lance, which is strongly influenced by both the paleo-climatic change and the contemporary local oceanic current pattern.

  6. 77 FR 74798 - Awards for Information Relating To Detecting Underpayments of Tax or Violations of the Internal...

    Science.gov (United States)

    2012-12-18

    ... contribution and the IRS's independent administration of the tax laws, this clear link requires: (i) A direct... in the information provided. The direct relationship test of the definition's first prong amounts to... regulations' definition of collected proceeds, therefore, does not refer explicitly to NOLs, tax credits, or...

  7. Fulltext PDF

    Indian Academy of Sciences (India)

    Dictionary of Biology. Chanchal Sarin. Tata McGrfNol Hill. 1996, RS.90. Physical Chemistry. G K Vemulapalli. Prentice-Hall of India. 1993, Rs.295. Science Matters. Robert M Hazen and. James Trefil. Universities Press. 1991, Rs.135. Microprocessor and its Applications. R Theagarajan, S Dhanasekaran. & S Dhanapal.

  8. 1688-IJBCS-Article-Adama Hema +

    African Journals Online (AJOL)

    hp

    Antioxidant Capacity (TEAC), 1,1-Diphenyl-1-picrylhydrazyl (DPPH) et Ferric Reducing Antioxidant Power. (FRAP). L'étude a montré que les polyphénols, responsables de la couleur des ..... Foundation" ... “antioxidant power”: the FRAP assay.

  9. Practical polyphenolics: from structure to molecular recognition and physiological action, by Edwin Haslam.[Book review

    Science.gov (United States)

    Richard W. Hemingway

    1998-01-01

    Hemingway’s book review brings into focus Edwin Haslam's career, devoted to defining the significance of plant polyphenols. That historical perspective focuses on the progress made in this science over the last 30 years. Most important, this book demonstrates the myriad ways that plant polyphe­nols influence our lives. Professor Haslam makes a strong argument for...

  10. Potential of bioethanol as a chemical building block for biorefineries: Preliminary sustainability assessment of 12 bioethanol-based products

    NARCIS (Netherlands)

    Posada Duque, J.A.; Patel, A.D.; Roes, A.L.; Blok, K.; Faaij, A.P.C.; Patel, M.K.

    2013-01-01

    The aim of this study is to present and apply aquick screening method and to identify the most promising bioethanol derivatives using an early- stage sustainability assessment method that compares abioetha- nol-base d conversion route to its respective petrochemical counterpart. The method

  11. Influence of chemical structure of branched and dendritic organosilicon luminophores on their optical and thermal properties

    Directory of Open Access Journals (Sweden)

    Borshchev Oleg V.

    2017-04-01

    Full Text Available Synthesis and investigation of optical and thermal properties of a homologous series of highly luminescent nanostructured organosilicon luminophores (NOLs containing different donor to acceptor ratio (D:A are reported. Each of the NOL consists of a 1,4-bis(5-phenylthienyl-2-ylbenzene (PTPTP acceptor unit and four, six or twelve 2,2′-bithienyl donor fragments connected to each other through two or six silicon atoms. These complex molecules show a “molecular antenna” effect with high efficiency of intramolecular energy transfer about 97-98% combined with excellent photoluminescence (PL quantum yield of 84-91% and fast PL decay time of 0.90-0.95 ns. A significant increase of the molar extinction coefficient from 94 000 to 257 000 M−1cm−1 with increasing the D:A ratio from 4:1 to 12:1 was observed. It was found that increasing the branching extent in the NOLs prohibits their crystallization. Thermal gravimetric analysis (TGA showed that all the NOLs reported, regardless of their branching extent, are thermally stable up to 455 °C under nitrogen. These characteristics make them promising materials for various organic photonics applications.

  12. Bibliography

    NARCIS (Netherlands)

    NN,

    1964-01-01

    Abbayes, H. des: Lichens nouveaux ou intéressants du Vietnam (Rev. Bryol. & Lichénol. 32, 1963, 216-222, 1 pl.). Adams, H.H. & M.A. Reinikka: Calcareous Cypripediums of southern Asia (Orchid.) (Am. Orchid Soc. Bull. 1963, 182-186).

  13. Net Weight Issue LLNL DOE-STD-3013 Containers

    International Nuclear Information System (INIS)

    Wilk, P

    2008-01-01

    The following position paper will describe DOE-STD-3013 container sets No.L000072 and No.L000076, and how they are compliant with DOE-STD-3013-2004. All masses of accountable nuclear materials are measured on LLNL certified balances maintained under an MC and A Program approved by DOE/NNSA LSO. All accountability balances are recalibrated annually and checked to be within calibration on each day that the balance is used for accountability purposes. A statistical analysis of the historical calibration checks from the last seven years indicates that the full-range Limit of Error (LoE, 95% confidence level) for the balance used to measure the mass of the contents of the above indicated 3013 containers is 0.185 g. If this error envelope, at the 95% confidence level, were to be used to generate an upper-limit to the measured weight of the containers No.L000072 and No.L000076, the error-envelope would extend beyond the 5.0 kg 3013-standard limit on the package contents by less than 0.3 g. However, this is still well within the intended safety bounds of DOE-STD-3013-2004

  14. Growing grass: a smart material interactive display, design and construction history

    NARCIS (Netherlands)

    Minuto, A.; Nijholt, Antinus

    2012-01-01

    In this paper we will present the design process and development of "Follow the Grass", our smart material interactive pervasive display, with related technical detailed explanation. We will present the design steps and prototypes with instructions for the use of smart materials (NiTiNOL) to create

  15. Nu, qui, où ?

    Directory of Open Access Journals (Sweden)

    Claire Hancock

    2004-04-01

    Full Text Available Si Francine Barthe-Deloizy semble s’excuser, dans la première phrase de son introduction, de commettre « un livre de plus sur la nudité, le nu, le corps », les géographes qui la liront ne partageront certainement pas cette lassitude : leur réaction devrait bien plutôt s’apparenter à « enfin, une géographie du nu et du corps !». Peut-être par pudibonderie, ou peut-être parce que le géographe français aime à se penser comme pur esprit, notre discipline a longtemps ...

  16. Coupled matter-wave solitons in optical lattices

    Science.gov (United States)

    Golam Ali, Sk; Talukdar, B.

    2009-06-01

    We make use of a potential model to study the dynamics of two coupled matter-wave or Bose-Einstein condensate (BEC) solitons loaded in optical lattices. With separate attention to linear and nonlinear lattices we find some remarkable differences for response of the system to effects of these lattices. As opposed to the case of linear optical lattice (LOL), the nonlinear lattice (NOL) can be used to control the mutual interaction between the two solitons. For a given lattice wave number k, the effective potentials in which the two solitons move are such that the well (Veff(NOL)), resulting from the juxtaposition of soliton interaction and nonlinear lattice potential, is deeper than the corresponding well Veff(LOL). But these effective potentials have opposite k dependence in the sense that the depth of Veff(LOL) increases as k increases and that of Veff(NOL) decreases for higher k values. We verify that the effectiveness of optical lattices to regulate the motion of the coupled solitons depends sensitively on the initial locations of the motionless solitons as well as values of the lattice wave number. For both LOL and NOL the two solitons meet each other due to mutual interaction if their initial locations are taken within the potential wells with the difference that the solitons in the NOL approach each other rather rapidly and take roughly half the time to meet as compared with the time needed for such coalescence in the LOL. In the NOL, the soliton profiles can move freely and respond to the lattice periodicity when the separation between their initial locations are as twice as that needed for a similar free movement in the LOL. We observe that, in both cases, slow tuning of the optical lattices by varying k with respect to a time parameter τ drags the oscillatory solitons apart to take them to different locations. In our potential model the oscillatory solitons appear to propagate undistorted. But a fully numerical calculation indicates that during evolution

  17. Coupled matter-wave solitons in optical lattices

    International Nuclear Information System (INIS)

    Golam Ali, Sk; Talukdar, B.

    2009-01-01

    We make use of a potential model to study the dynamics of two coupled matter-wave or Bose-Einstein condensate (BEC) solitons loaded in optical lattices. With separate attention to linear and nonlinear lattices we find some remarkable differences for response of the system to effects of these lattices. As opposed to the case of linear optical lattice (LOL), the nonlinear lattice (NOL) can be used to control the mutual interaction between the two solitons. For a given lattice wave number k, the effective potentials in which the two solitons move are such that the well (V eff (NOL)), resulting from the juxtaposition of soliton interaction and nonlinear lattice potential, is deeper than the corresponding well V eff (LOL). But these effective potentials have opposite k dependence in the sense that the depth of V eff (LOL) increases as k increases and that of V eff (NOL) decreases for higher k values. We verify that the effectiveness of optical lattices to regulate the motion of the coupled solitons depends sensitively on the initial locations of the motionless solitons as well as values of the lattice wave number. For both LOL and NOL the two solitons meet each other due to mutual interaction if their initial locations are taken within the potential wells with the difference that the solitons in the NOL approach each other rather rapidly and take roughly half the time to meet as compared with the time needed for such coalescence in the LOL. In the NOL, the soliton profiles can move freely and respond to the lattice periodicity when the separation between their initial locations are as twice as that needed for a similar free movement in the LOL. We observe that, in both cases, slow tuning of the optical lattices by varying k with respect to a time parameter τ drags the oscillatory solitons apart to take them to different locations. In our potential model the oscillatory solitons appear to propagate undistorted. But a fully numerical calculation indicates that during

  18. Tertiary phosphine complexes of rhenium: a spectroscopic study

    International Nuclear Information System (INIS)

    Fergusson, J.E.; Heveldt, P.F.

    1976-01-01

    Complexes of the type ReOX 3 L 2 , ReNX 2 L 3 , ReX 3 (NO)L 2 and ReX 2 (NO)L 3 have been studied using, UV visible, IR and H 1 , C 13 NMR spectroscopy. (X is a halogen, Cl, Br, I and L is a tertiary phosphine Et 3 P and Et 2 PhP). Evidence obtained on the blue cis isomer ReOCl 3 L 2 suggests that the halogens are arranged on a face of the octahedral complex. Assignments of ν(Re-X) and ν(Re-P) vibrations have been made. Three complexes of technetium, [TcCl 4 (Ph 3 P) 2 ], [TcCl 3 (Et 2 PhP) 3 ] and [TcCl 3 (NO)(Et 2 PhP) 2 ] have been isolated. (author)

  19. Chinese Investment in Latin American Ports: The Ecuadorian, Mexican, And Colombian Cases

    Science.gov (United States)

    2014-12-01

    Cooperation MPA Manta Port Authority NAFTA North American Free Trade Agreement NOL Neptune Orient Lines NPC National Planning Commission NDRC National...operate in the same operational environment, constitutes a serious management challenge. For this reason the port authorities and cargo handling...region that made adjustments to FDI used some similar methods. One basic characteristic of the changes was that new laws gave permission to companies

  20. [Comparative evaluation of the effectiveness of the treatment of gastroduodenal Campylobacter infection in children].

    Science.gov (United States)

    Korovina, N A; Levitskaia, S V; Bokser, G V; Spirina, T S; Taranenko, L A; Safonova, T B

    1991-01-01

    Schemes developed by the authors for antibacterial therapy of gastroduodenal bacterosis caused by Campylobacter spp. in children are described. The data on the treatment of 56 patients with duodenal ulcer and gastroduodenitis are presented. The efficacy of the treatment with medicines under the control of the clinical, endoscopic and microbiological indices was compared. The study showed that De-Nol, furazolidone and combination of trichopol (metronidazole) with vicair were the most efficient drugs for therapy of children with such diseases.

  1. 2081-IJBCS-Article-Emmanuel Bassene

    African Journals Online (AJOL)

    hp

    polyphénols totaux obtenues sont 13,56% et 5,6% Eq d'acide tannique respectivement dans les feuilles et les inflorescences mâles. ... DPPH, les résultats obtenus en mg Eq d'acide ascorbique sont 4 et 5 mg Eq respectivement dans les extraits d'acétate éthyle et ..... pathologies liées au stress oxydatif. REFERENCES.

  2. Stemcell Information: SKIP000630 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available nol+5ng/ml human bFGF ... 5% Negative ... Yes ... RIKEN BioResource Center 理化学...研究所バイオリソースセンター RIKEN BioResource Center 理化学研究所バイオリソースセンター ... Available RIKEN BioResource Center 理化学研究

  3. Stemcell Information: SKIP000631 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available nol+5ng/ml human bFGF ... 5% Negative ... Yes ... RIKEN BioResource Center 理化学...研究所バイオリソースセンター RIKEN BioResource Center 理化学研究所バイオリソースセンター ... Available RIKEN BioResource Center 理化学研究

  4. Green synthesis and catalytic application of curcumin stabilized ...

    Indian Academy of Sciences (India)

    Plant based materials seem to be the best can- didates and they are suitable for large-scale 'biosyn- thesis' of nanoparticles.8,9 The key or active agent in some of these ... nols, like in the case of tea, wine and winery waste, ... On completion of this treat- ment the ... solid powder c-AgNPs (S2) sample (Figures 4a and 4b).

  5. Artishoki aastanäitus "XXX" / Liisa Kaljula

    Index Scriptorium Estoniae

    Kaljula, Liisa

    2008-01-01

    Tallinna Linnagaleriis 10.-19. VII avatud Maarin Ektermanni ja Margus Tamme kureeritud näitusel osalesid kriitikutest Indrek Grigor, Kati Ilves, Margus Kiis, Elnara Taidre, Anneli Porri, Ave Randviir, Maria-Kristiina Soomre, Andreas Trossek, Karolina Labowicz-Dymanus (Varssavi) ja Isin Önol ((Istanbul), kunstnikest Tanja Muravskaja, Liisi Eelmaa, Noolegrupp, Cnopt, Billeneeve, Mihkel Kleis, Sirli Hein, Maris Palgi, Minna Hint ja Jaanus Samma. Toimus 10 ühepäevast näitust, esitati 100 kunstikriitilist teksti

  6. régression linéaire multiple

    African Journals Online (AJOL)

    Mots clés: Alcools et phénols – Représentation numérique de la structure chimique – Facteur acentrique – Régression linéaire multiple – Modèle RSP hybride. English Title: Structure / acentric factor relationship of alcohols and phenols: genetic algorithm – multiple linear regression approach. English Abstract. The acentric ...

  7. Identifying Neurofibromin Specific Regulatory Nodes for Therapeutic Targeting in NF1

    Science.gov (United States)

    2017-10-01

    suggestions for reducing this burden to Department of Defense, Washington Headquarters Services, Directorate for Information Operations and Reports (0704...imatinib, an approved BCR-ABL inhibitor. Given the robustness of these results, we believe K562 is an ideal cancer cell line system to interrogate ...fusion gene partner NOL4L greatly increased viability in the NF1 knockout cells, suggesting that these genes normally suppress growth through

  8. Methyl Salicylate: A Reactive Chemical Warfare Agent Surrogate to Detect Reaction with Hypochlorite (POSTPRINT)

    Science.gov (United States)

    2011-05-01

    presumably due to saponification (Figure 2) followed by a slower decarbox- ylation step to produce detectable amounts of 2-chloro-, 4-chloro- and 2,4...reaction of MeS with hypochlorite demonstrating the effect of a cosolvent on the rate of reaction. Figure 2. Proposed mechanism for EAS, saponification , and...Quantitative analysis of the products is complicated by the competing process of saponification of the esters to chlorophe- nols, and by possible surface

  9. Development of an Assay Based on the Effects of PGBx on the Isolated Perfused Rat Heart and Rat Skeletal Muscle.

    Science.gov (United States)

    1980-09-01

    had no effect on discphe- nol induced alterations in spontaneous heart rate, but did appear to prevent the increase in coronary flow caused by...Phosphorylase a i -24 activity was also the same in each of the groups examined (Table 2-4). DISCUSSION The ability of PGBx to prevent 2,4-dinitrophenol-induced...euthyroid and hyperthyroid rats. Eur. J. Pharmac. 19, 12-17. Aronson, C. E. and Serlick, E. R. (1977a) Effects of chlorpromazine on the isolated

  10. Use of Bifunctional Immunotherapeutic Agents to Target Breast Cancer

    Science.gov (United States)

    2007-07-01

    Science 270, 1500–1502. 32. Pasqualini , R., Koivunen, E., and Ruoslahti, E. (1997) v integrins as receptors for tumor targeting by circulating ligands...Nat. Biotech- nol. 15, 542–546. 33. Arap, W., Pasqualini , R., and Ruoslahti, E. (1998) Cancer treatment by targeted drug delivery to tumor...Cancer Res. 2, 663–673. 47. Arap, W., Pasqualini , R., and Ruoslahti, E. (1998) Cancer treatment by targeted drug delivery to tumor vasculature in a

  11. Untitled

    African Journals Online (AJOL)

    (NO) in aqueous media have been studied at 30°C, I=0.25 M (LiCl), (HJ=3.0x10 M. The reaction is first Order with respect to Oxidant and reductant concentrations and the reaction rate showed dependence on acid concentration. The reaction conforms to the rate equation. -dirosl/dt = a(HIrosilNOl. The rate of the reaction ...

  12. Chronic intermittent hypoxia and obstructive sleep apnea: an experimental and clinical approach

    OpenAIRE

    Sforza E; Roche F

    2016-01-01

    Emilia Sforza, Fréderic Roche Service de Physiologie Clinique et de l'Exercice, Pole NOL, CHU, EA SNA-EPIS 4607, Faculté de Médecine J. Lisfranc, UJM Saint-Etienne, Université de Lyon, Saint-Etienne, France Abstract: Obstructive sleep apnea (OSA) is a prevalent sleep disorder considered as an independent risk factor for cardiovascular consequences, such as systemic arterial hypertension, ischemic heart disease, cardiac arrhythmias, metaboli...

  13. Abstracts from Rambam Research Day

    OpenAIRE

    Shraga Blazer

    2015-01-01

    Introduction: Patients under anesthesia cannot communicate pain; hence an objective monitoring system is needed to assess intra-operative nociception and guide proper treatment. Based on a combination of physiological parameters, the Nociception Level (NoL) index was developed (0?100 scale). Random Forest Regression, capable of dealing with large numbers of input parameters arising from the complexity of the autonomous nervous system and their time derivatives, was applied to reveal their non...

  14. New insight into hybridization and unidirectional introgression between Ammodytes japonicus and Ammodytes heian (Trachiniformes, Ammodytidae.

    Directory of Open Access Journals (Sweden)

    Jin-Koo Kim

    Full Text Available Based on northern (NOL and southern (SOL mitochondrial lineages, recently, it proposed the new species Ammodytes heian and revived the species name Ammodytes japonicus to describe sand lances from the northwestern Pacific Ocean. This study used molecular methods to investigate genetic relationships between the two sand lance species in Korea and Japan. In total, 154 specimens were collected from four locations in Korea (Baengnyeongdo in the Yellow Sea, Tongyeong in the Korean Strait, and Jumunjin and Gijang in the East Sea, and 50 specimens were collected from a single location in Japan (Wakkanai in the Okhotsk Sea. Mitochondrial DNA analysis demonstrated that the individuals from Baengnyeongdo and Tongyeong all belonged to the SOL, whereas those from Gijang, Jumunjin, and Wakkanai included individuals from both the NOL and SOL (over 75% NOL. Population structure analyses were performed on the same individuals using seven microsatellite DNA markers. The population structure analysis based on 201 specimens identified two clusters (named as northern group and southern group, with the admixture proportion (q of < 0.1 for the northern group in the Backyeongdo and Tongyeong sand lances and < 0.1 for the southern group in the Wakkanai sand lances. The high heterogeneity indicated that the former was probably A. japonicus and the latter probably A. heian. However, the admixture proportion in the Jumunjin and Gijang sand lances was 0.71-0.75 for the southern group, indicating that hybridization and unidirectional introgression from SOL to NOL occurs in southwestern margin of the East Sea. Our findings illustrate the speciation process based on different patterns of gene flow between Korean and Japanese sand lance, which is strongly influenced by both the paleo-climatic change and the contemporary local oceanic current pattern.

  15. Prisen Årets studenter start-up går til Drop Bucket

    DEFF Research Database (Denmark)

    Lassen, Lisbeth

    2015-01-01

    DTU’s ny pris for årets mest innovative studerende blev ved universitetets årsfest givet til Heiða Gunnarsdóttir Nolsøe og Marie Stampe Berggreen, som står bag virksomheden Drop Bucket. Koncerndirektør for innovation og entreprenørskab, Marianne Thellersen, overakte prisen til de to innovatører s...

  16. effect of dl-carnitine on tissue content of ad eno ine triphospha te

    African Journals Online (AJOL)

    BSN

    values of 16.2 ± 5.2µ mols lg dry weight for ATP and I 1.7± 2.5 ~11nols/g dry weight for CP in normal (non ischaem1c) myocardial tissue. Continuous perfusion of the heans "ith perfusate contaming 4.9µmols/ml. DL-Carnitine appeared to prevent the lowermg of ATP and CP levels as a result of induction of ischaemia.

  17. Evolution of a Native Oxide Layer at the a-Si:H/c-Si Interface and Its Influence on a Silicon Heterojunction Solar Cell.

    Science.gov (United States)

    Liu, Wenzhu; Meng, Fanying; Zhang, Xiaoyu; Liu, Zhengxin

    2015-12-09

    The interface microstructure of a silicon heterojunction (SHJ) solar cell was investigated. We found an ultrathin native oxide layer (NOL) with a thickness of several angstroms was formed on the crystalline silicon (c-Si) surface in a very short time (∼30 s) after being etched by HF solution. Although the NOL had a loose structure with defects that are detrimental for surface passivation, it acted as a barrier to restrain the epitaxial growth of hydrogenated amorphous silicon (a-Si:H) during the plasma-enhanced chemical vapor deposition (PECVD). The microstructure change of the NOL during the PECVD deposition of a-Si:H layers with different conditions and under different H2 plasma treatments were systemically investigated in detail. When a brief H2 plasma was applied to treat the a-Si:H layer after the PECVD deposition, interstitial oxygen and small-size SiO2 precipitates were transformed to hydrogenated amorphous silicon suboxide alloy (a-SiO(x):H, x ∼ 1.5). In the meantime, the interface defect density was reduced by about 50%, and the parameters of the SHJ solar cell were improved due to the post H2 plasma treatment.

  18. Coenzyme Q10, α-Tocopherol, and Oxidative Stress Could Be Important Metabolic Biomarkers of Male Infertility

    Directory of Open Access Journals (Sweden)

    Anna Gvozdjáková

    2015-01-01

    Full Text Available Oxidative stress, decreased antioxidant capacity, and impaired sperm mitochondrial function are the main factors contributing to male infertility. The goal of the present study was to assess the effect of the per os treatment with Carni-Q-Nol (440 mg L-carnitine fumarate + 30 mg ubiquinol + 75 IU vitamin E + 12 mg vitamin C in each softsule in infertile men on sperm parameters, concentration of antioxidants (coenzyme Q10,  CoQ10-TOTAL, γ, and α-tocopherols, and oxidative stress in blood plasma and seminal fluid. Forty infertile men were supplemented daily with two or three Carni-Q-Nol softsules. After 3 and 6 months of treatment, improved sperm density was observed (by 48.9% and 80.9%, resp. and after 3-month treatment the sperm pathology decreased by 25.8%. Concentrations of CoQ10-TOTAL (ubiquinone + ubiquinol and α-tocopherol were significantly increased and the oxidative stress was decreased. In conclusion, the effect of supplementary therapy with Carni-Q-Nol showed benefits on sperm function in men, resulting in 45% pregnancies of their women. We assume that assessment of oxidative stress, CoQ10-TOTAL, and α-tocopherol in blood plasma and seminal fluid could be important metabolic biomarkers in both diagnosis and treatment of male infertility.

  19. CLUB PETANQUE

    CERN Multimedia

    CLUB PETANQUE

    2010-01-01

      Jeudi 16 Septembre s’est déroulé le challenge RITA.20 joueurs se sont mesurés au cours de 3 parties, sous la commande de  notre juge arbitre Albert. Le toujours jeune Michel Vuillier s’est imposé devant David Jouve et André Domeniconi , départagés aux points, la première féminine est Sandy (fille de Rita). Merci à notre généreux Donateur Alain époux de Rita qui a très bien récompensé les gagnants. Coup de chapeau à Gégé pour le repas excellent qu’il nous a confectionné. La buvette est toujours aussi bien tenu par Maryse..Ce concours était le dernier de la saison puisque nous avons du annuler le challenge LECOSSEC. Place maintenant au championnat corporatif au boulodrome des Vernets.   * * * * * Samedi au boulodrome de l...

  20. Staff members with 25 years’ service at CERN in 2007

    CERN Multimedia

    HR Department

    2007-01-01

    The 24 staff members who have spent 25 years within CERN in 2007 were invited by the Director-General to a reception in their honour on 11 October. Mr.\tBLEUS Baudouin\tAB Mr.\tBRUNEL Bernard\tPH Mr.\tCAILLET Norbert\tHR Dr.\tCASPERS Friedhelm\tAB Mr.\tCHEVRET Thierry\tTS Mr.\tCUMER Gérard\tTS Mrs.\tDA COSTA Maryse\tIT Mrs.\tDELAMARE Catherine\tIT Mr.\tERIKSSON Tommy\tAB Mrs.\tFOFFANO Susan\tIT Mr.\tGONZALEZ José Luis\tAB Mr.\tHUTCHINS Stephen\tAB Dr.\tKLEMPT Wolfgang\tPH Mr.\tLEVRIER François\tTS Dr.\tMARCHIORO Alessandro\tPH Mr.\tNORMANN Lasse\tAB Dr.\tRAICH Ulrich\tAB Mr.\tREBUT Michel\tPH Mr.\tRUSSO Aniello\tAT Dr.\tSTAMPFLI Lorenz\tDSU Mrs.\tTUUVA Martine\tTS Dr.\tWEISZ Sylvain\tTS Mr.\tYVON Guy\tAB Mr.\tZIEGLER Patrice\tTS

  1. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    2010-01-01

    Full Text Available Esperança Bielsa. The Latin American Urban Crónica: Between Literature and Mass Culture by Miguel González-Abellás Gene H. Bell-Villada, ed. Gabriel García Márquez’s One Hundred Years of Solitude: A Casebook by Miguel González-Abellás Albert Memmi. Decolonization and the Decolonized . Trans. Robert Bononno by Christa Jones Erin Graff Zivin. The Wandering Signifier: Rhetoric of Jewishness in the Latin American Imaginary by Naomi Lindstrom Dawn Fulton. Signs of Dissent: Maryse Condé and Postcolonial Crticism by Jane E. Evans Anne Lambright. Creating the Hybrid Intellectual: Subject, Space and the Feminine in the Narrative of José María Arguedas by Arturio Arias Andrew Sobanet. Jail Sentences: Representing Prison in Twentieth-Century French Fiction by Elisabeth-Christine Muelsch Olga López-Valero Colbert. The Gaze on the Past: Popular Culture and History in Antonio Muñoz Molina’s Novels by Jorge Pérez Warren Motte. Fiction Now: The French Novel in the Twenty-First Century by Martine Fernandes Hélène Cixous. Hyperdream . Trans. Beverley Bie Brahic. by Amy Baram Reid Jean-Michel Rabaté. 1913: The Cradle of Modernism by Safoi Babana-Hampton

  2. Mutation of the N-Terminal Region of Chikungunya Virus Capsid Protein: Implications for Vaccine Design.

    Science.gov (United States)

    Taylor, Adam; Liu, Xiang; Zaid, Ali; Goh, Lucas Y H; Hobson-Peters, Jody; Hall, Roy A; Merits, Andres; Mahalingam, Suresh

    2017-02-21

    Mosquito-transmitted chikungunya virus (CHIKV) is an arthritogenic alphavirus of the Togaviridae family responsible for frequent outbreaks of arthritic disease in humans. Capsid protein, a structural protein encoded by the CHIKV RNA genome, is able to translocate to the host cell nucleolus. In encephalitic alphaviruses, nuclear translocation induces host cell transcriptional shutoff; however, the role of capsid protein nucleolar localization in arthritogenic alphaviruses remains unclear. Using recombinant enhanced green fluorescent protein (EGFP)-tagged expression constructs and CHIKV infectious clones, we describe a nucleolar localization sequence (NoLS) in the N-terminal region of capsid protein, previously uncharacterized in CHIKV. Mutation of the NoLS by site-directed mutagenesis reduced efficiency of nuclear import of CHIKV capsid protein. In the virus, mutation of the capsid protein NoLS (CHIKV-NoLS) attenuated replication in mammalian and mosquito cells, producing a small-plaque phenotype. Attenuation of CHIKV-NoLS is likely due to disruption of the viral replication cycle downstream of viral RNA synthesis. In mice, CHIKV-NoLS infection caused no disease signs compared to wild-type CHIKV (CHIKV-WT)-infected mice; lack of disease signs correlated with significantly reduced viremia and decreased expression of proinflammatory factors. Mice immunized with CHIKV-NoLS, challenged with CHIKV-WT at 30 days postimmunization, develop no disease signs and no detectable viremia. Serum from CHIKV-NoLS-immunized mice is able to efficiently neutralize CHIKV infection in vitro Additionally, CHIKV-NoLS-immunized mice challenged with the related alphavirus Ross River virus showed reduced early and peak viremia postchallenge, indicating a cross-protective effect. The high degree of CHIKV-NoLS attenuation may improve CHIKV antiviral and rational vaccine design. IMPORTANCE CHIKV is a mosquito-borne pathogen capable of causing explosive epidemics of incapacitating joint pain

  3. Chlorophyll b Reductase Plays an Essential Role in Maturation and Storability of Arabidopsis Seeds1[W

    Science.gov (United States)

    Nakajima, Saori; Ito, Hisashi; Tanaka, Ryouichi; Tanaka, Ayumi

    2012-01-01

    Although seeds are a sink organ, chlorophyll synthesis and degradation occurs during embryogenesis and in a manner similar to that observed in photosynthetic leaves. Some mutants retain chlorophyll after seed maturation, and they are disturbed in seed storability. To elucidate the effects of chlorophyll retention on the seed storability of Arabidopsis (Arabidopsis thaliana), we examined the non-yellow coloring1 (nyc1)/nyc1-like (nol) mutants that do not degrade chlorophyll properly. Approximately 10 times more chlorophyll was retained in the dry seeds of the nyc1/nol mutant than in the wild-type seeds. The germination rates rapidly decreased during storage, with most of the mutant seeds failing to germinate after storage for 23 months, whereas 75% of the wild-type seeds germinated after 42 months. These results indicate that chlorophyll retention in the seeds affects seed longevity. Electron microscopic studies indicated that many small oil bodies appeared in the embryonic cotyledons of the nyc1/nol mutant; this finding indicates that the retention of chlorophyll affects the development of organelles in embryonic cells. A sequence analysis of the NYC1 promoter identified a potential abscisic acid (ABA)-responsive element. An electrophoretic mobility shift assay confirmed the binding of an ABA-responsive transcriptional factor to the NYC1 promoter DNA fragment, thus suggesting that NYC1 expression is regulated by ABA. Furthermore, NYC1 expression was repressed in the ABA-insensitive mutants during embryogenesis. These data indicate that chlorophyll degradation is induced by ABA during seed maturation to produce storable seeds. PMID:22751379

  4. Advanced Tomographic Imaging Methods for the Analysis of Materials

    Science.gov (United States)

    1991-08-01

    and several other factors such as e.q. brittleness, caused by oxydative aging. Due to the swelling behavior T2 becomes longer and T, is to expected...employing 170- enriched water and 1L70 666I brings an elegant and efficient solution. Use of other 170 labeled liquids ( alcohols , phe- nols, ethers etc...polyethylene glycol), were suspended in ethyl alcohol and ball- milled for 16 h. S13N4 whiskers 10 wt.% (UBE Chemical Ind. UBE- SN-WB 0) were added and ball

  5. Recent developments in graphite. [Use in HTGR and aerospace

    Energy Technology Data Exchange (ETDEWEB)

    Cunningham, J.E.

    1983-01-01

    Overall, the HTGR graphite situation is in excellent shape. In both of the critical requirements, fuel blocks and support structures, adequate graphites are at hand and improved grades are sufficiently far along in truncation. In the aerospace field, GraphNOL N3M permits vehicle performance with confidence in trajectories unobtainable with any other existing material. For fusion energy applications, no other graphite can simultaneously withstand both extreme thermal shock and neutron damage. Hence, the material promises to create new markets as well as to offer a better candidate material for existing applications.

  6. The Fatigue Characteristics of Bolted Lap Joints of 24S-T Alclad Sheet Materials

    Science.gov (United States)

    1946-10-01

    extremely close bolt fits are needed to o%tain maximum life of bolt ~oint~ under repeated etreseeci. -. Szvzral ty~+?+s of bolt patterns hava been tegted...Memorial Institute on spec~meris of 0.102-i.nch sheet. In particular, figure 4 shows, on a load- life diagram, . results of tests Qn single-bolt...results of tests at the Univer- sity of’ il~~nols on single—bolt specimens, Tables 10 and 11 give reeults of tests, made at the U“ uiversity of Illino~8 , on

  7. European Origin of Bradyrhizobium Populations Infecting Lupins and Serradella in Soils of Western Australia and South Africa† ‡

    OpenAIRE

    Stępkowski, Tomasz; Moulin, Lionel; Krzyżańska, Agnieszka; McInnes, Alison; Law, Ian J.; Howieson, John

    2005-01-01

    We applied a multilocus phylogenetic approach to elucidate the origin of serradella and lupin Bradyrhizobium strains that persist in soils of Western Australia and South Africa. The selected strains belonged to different randomly amplified polymorphic DNA (RAPD)-PCR clusters that were distinct from RAPD clusters of applied inoculant strains. Phylogenetic analyses were performed with nodulation genes (nodA, nodZ, nolL, noeI), housekeeping genes (dnaK, recA, glnII, atpD), and 16S-23S rRNA inter...

  8. Shape Modeling of a Concentric-tube Continuum Robot

    DEFF Research Database (Denmark)

    Bai, Shaoping; Xing, Charles Chuhao

    2012-01-01

    Concentric-tube continuum robots feature with simple and compact structures and have a great potential in medical applications. The paper is concerned with the shape modeling of a type of concentric-tube continuum robot built with a collection of super-elastic NiTiNol tubes. The mechanics...... is modeled on the basis of energy approach for both the in-plane and out-plane cases. The torsional influences on the shape of the concentric-tube robots are considered. An experimental device was build for the model validation. The results of simulation and experiments are included and analyzed....

  9. Trials of Command: General John D. Lavelle and the Seventh Air Force in Vietnam

    Science.gov (United States)

    2011-04-07

    Lavelle related that Ryan accused Lavelle ofgoing behind his back td the Secretary and undermining his decision on the Lockheed plan. In Lavelle’s...however, after meeting with his immediate supervisor and officer in charge received a direct order td comply with the . reporting requirement.· The...PrRs oN 1 r1AY 19?2• ~, llJ ) pUBLIC A.FfHRS GIJ!DANCE, MO i"USUc A.f•.!NOl:JNCEHeNT Op r<Ny .- !(.HiD WILL SE HAD:; !~JTH REG;!,RO rAGE 1 DE

  10. How we think about depression: The role of linguistic framing

    OpenAIRE

    Florencia Reali; Tania Soriano; Daniela Rodríguez

    2016-01-01

    Las descripciones de los desórdenes emocionales varían de acuerdo a la cultura y los contextos históricos. Recientemente, se ha propuesto que enmarcar lingüísticamente estos desórdenes como enfermedades --- en contraposición a consecuencias de factores psicosociales --- podría ser una estrategia para combatir estigmas. En este trabajo combinamos un análisis del corpus lingüístico y un estudio experimental para explorar las características y consecuencias del enmarque lingüístico en espa˜nol p...

  11. Recent developments in graphite

    International Nuclear Information System (INIS)

    Cunningham, J.E.

    1983-01-01

    Overall, the HTGR graphite situation is in excellent shape. In both of the critical requirements, fuel blocks and support structures, adequate graphites are at hand and improved grades are sufficiently far along in truncation. In the aerospace field, GraphNOL N3M permits vehicle performance with confidence in trajectories unobtainable with any other existing material. For fusion energy applications, no other graphite can simultaneously withstand both extreme thermal shock and neutron damage. Hence, the material promises to create new markets as well as to offer a better candidate material for existing applications

  12. Toward Active Control of Noise from Hot Supersonic Jets

    Science.gov (United States)

    2014-04-21

    Mechanisms AGARD - CP -131, 1974, pp. 13.1-13.12. [23] Goldstein, M.E., "On identifying the true sources of aerodynamic sound," Journal of Fluid Mechanics Vol...either constant or begins to decay. For the resampled data (1/8 inch microphones resampled at 100 kHz), the change in 7( 73 ) follows the originally...supersonic jet and their acoustic radiation," Journal of Fluid Mechanics, Vol. 69, No.l, 1975, pp. 73 95. [5] Tain, C. K. W., "Mach wave radiation from high

  13. Nonstructural Protein NSs of Schmallenberg Virus Is Targeted to the Nucleolus and Induces Nucleolar Disorganization.

    Science.gov (United States)

    Gouzil, Julie; Fablet, Aurore; Lara, Estelle; Caignard, Grégory; Cochet, Marielle; Kundlacz, Cindy; Palmarini, Massimo; Varela, Mariana; Breard, Emmanuel; Sailleau, Corinne; Viarouge, Cyril; Coulpier, Muriel; Zientara, Stéphan; Vitour, Damien

    2017-01-01

    Schmallenberg virus (SBV) was discovered in Germany in late 2011 and then spread rapidly to many European countries. SBV is an orthobunyavirus that causes abortion and congenital abnormalities in ruminants. A virus-encoded nonstructural protein, termed NSs, is a major virulence factor of SBV, and it is known to promote the degradation of Rpb1, a subunit of the RNA polymerase II (Pol II) complex, and therefore hampers global cellular transcription. In this study, we found that NSs is mainly localized in the nucleus of infected cells and specifically appears to target the nucleolus through a nucleolar localization signal (NoLS) localized between residues 33 and 51 of the protein. NSs colocalizes with nucleolar markers such as B23 (nucleophosmin) and fibrillarin. We observed that in SBV-infected cells, B23 undergoes a nucleolus-to-nucleoplasm redistribution, evocative of virus-induced nucleolar disruption. In contrast, the nucleolar pattern of B23 was unchanged upon infection with an SBV recombinant mutant with NSs lacking the NoLS motif (SBVΔNoLS). Interestingly, unlike wild-type SBV, the inhibitory activity of SBVΔNoLS toward RNA Pol II transcription is impaired. Overall, our results suggest that a putative link exists between NSs-induced nucleolar disruption and its inhibitory function on cellular transcription, which consequently precludes the cellular antiviral response and/or induces cell death. Schmallenberg virus (SBV) is an emerging arbovirus of ruminants that spread in Europe between 2011 and 2013. SBV induces fetal abnormalities during gestation, with the central nervous system being one of the most affected organs. The virus-encoded NSs protein acts as a virulence factor by impairing host cell transcription. Here, we show that NSs contains a nucleolar localization signal (NoLS) and induces disorganization of the nucleolus. The NoLS motif in the SBV NSs is absolutely necessary for virus-induced inhibition of cellular transcription. To our knowledge, this

  14. Evolution de certains composés volatils du bois de chêne au cours de son séchage premiers résultats

    Directory of Open Access Journals (Sweden)

    Pascal Chatonnet

    1994-12-01

    Full Text Available Pendant le séchage des merrains sur parc à l'air libre, on assiste à une profonde modification de la composition chimique et du profil aromatique du bois de chêne. La teneur en eugénol, en aldéhydes phénols et en Β-méthyl-y-octalactone augmente régulièrement pendant le vieillissement du bois. Principalement sous forme trans au début du séchage, la Β-méthyl-y-octalactone s'accumule finalement sous la forme cis plus aromatique. Dans le même temps, on observe également une accumulation importante du précurseur inodore de Β-méthyl-y-octalactone. L'intervention des micro-organismes fréquemment isolés sur le bois en cours de séchage naturel sur la formation de composés aromatiques a été étudiée. La culture de diverses moisissures isolées de bois en cours de séchage naturel sur extraits de bois et directement sur sciure de chêne aboutit dans tous les cas à une forte diminution des teneurs en aldéhydes phénols, notamment de la vanilline. En effet, tous les micro-organismes étudiés (Penicilium sp., Trichoderma sp., Aureobasidium sp. sont incapables de dégrader la lignine car ils ne possèdent pas d'activité ligninase. En revanche, ces champignons possèdent une forte activité oxydo-réductase capable de réduire la vanilline en alcool vanillique inodore. En conséquence, les aldéhydes phénols apparaissant au cours du séchage naturel du merrain ne dérivent pas d'une attaque enzymatique mais plus vraisemblablementde l'acidolyse et de l'oxydation chimique de la lignine du bois. Le stockage du bois à l'air libre en présence d'eau et d'oxygène doit permettre une évolution favorable de son potentiel aromatique tant que la vanilline et la cis Β-méthyly-octalactone s'accumulent.

  15. L'application des déchets traités de l'algue Gelidium sesquipédale ...

    African Journals Online (AJOL)

    AKA Boko

    L'acidité est déterminée par titrage de 10ml de la culture pure, par une solution alcaline. (NaOH) N/9, en présence de phénol phtaléine comme indicateur coloré. L'évaluation numérique est obtenue par l'application de la formule suivante. Utiliser un éditeur mathématique pour écrire la formule : é. 3-1-3. Test antibactérien.

  16. Non-Conscious Sex Role Ideology: The Implications for Optimal Utilization of U.S. Servicewomen.

    Science.gov (United States)

    1984-03-01

    trayed in or encouraged towards culturally stereotyped "appropriate" roles [Ref. 17: p. 561. It is reflected in women’s magazines and newspapers where...Ref. 22: p. 130]. But the firmly entrenched Army mentality towards women prevailed, in spite of intentions to the contrary. Women were considered...DA4502 NON-CONSIU ’E NOL 000LG THE M A ONS FOR 12~~~~~OPTMLUIIAIN 0 N R WOME U NAVAL UPOSTGRDUATE SCHO 0 MONTEREY CA M BOYNTON MAR 84 UN7SSFE F/G

  17. Environmental Assessment: Hurricane Katrina Recovery and Installation Development at Keesler Air Force Base, Mississippi

    Science.gov (United States)

    2006-12-01

    ly Sweeney Jef fe rso n D avi s Ze ro M a u villa Foulois Fe che t Cabell Esposito Percy Thunderbolt James Ar nol d Pine Lawn Monroe W all Bilm arsan... Jackson counties in Mississippi. These three counties encompass 1,785 square miles of land area and comprise the entire coastline of Mississippi along the...24.2% Hancock County 46,711 11.6% 15.7% 23.4% Harrison County 193,810 29.8% 16.5% 25.7% Jackson County 135,940 27.6% 15.0% 25.8% Biloxi MSA 376,461

  18. Resolution of foveal detachment in dome-shaped macula after treatment by spironolactone: report of two cases and mini-review of the literature

    Directory of Open Access Journals (Sweden)

    Dirani A

    2014-05-01

    Full Text Available Ali Dirani,1 Alexandre Matet,1 Talal Beydoun,2 Irmela Mantel,1 Francine Behar-Cohen1–3 1Department of Ophthalmology, University of Lausanne, Jules Gonin Eye Hospital, Lausanne, Switzerland; 2Department of Ophthalmology, Hôtel-Dieu de Paris Hospital, Assistance Publique – Hôpitaux de Paris, Paris, France; 3Inserm UMRS872, Physiopathology of Ocular Diseases: Therapeutic Innovations, Centre de Recherche des Cordeliers, Paris, France Abstract: Dome-shaped macula (DSM was recently described in myopic patients as a convex protrusion of the macula within a posterior pole staphyloma. The pathogenesis of DSM and the development of associated serous foveal detachment (SFD remain unclear. The obstruction of choroidal outflow and compressive changes of choroidal capillaries have been proposed as causative factors. In this paper, we report two cases of patients with chronic SFD associated with DSM treated with oral spironolactone. After treatment, there was a complete resolution of SFD in both patients. To the best of our knowledge, this is the first report of successful treatment of SFD in DSM by a mineralocorticoid receptor antagonist. Keywords: serous foveal detachment, mineralocorticoid receptor antagonist, dome-shaped macula, treatment

  19. Entre l’exil et l’asile : l’inter-dit silencieux dans Le Pavillon des miroirs de Sergio Kokis

    Directory of Open Access Journals (Sweden)

    Steven Urquhart

    2010-05-01

    Full Text Available Lorsqu’on parle du premier roman de Sergio Kokis, Le Pavillon des miroirs, on souligne à juste titre le caractère autobiographique du roman manifeste par le va-et-vient narratif entre le présent du narrateur/peintre au Québec et le souvenir de sa jeunesse au Brésil ainsi que les enjeux de son exil et la nature vive et grotesque des images qui hantent son imagination. Francine Bordeleau résume ce dernier aspect en disant que « les images sont puissantes, l’écriture brûlante, et certains passages, paroxystiques atteignent une sorte de fureur. Kokis n’est pas un tiède » (10. Cependant, on constate également au cours d’une analyse détaillée du roman l’importance de la question du silence et la place considérable qu’il occupe dans la pensée du narrateur.

  20. Stability of matter-wave solitons in optical lattices

    Science.gov (United States)

    Ali, Sk. Golam; Roy, S. K.; Talukdar, B.

    2010-08-01

    We consider localized states of both single- and two-component Bose-Einstein condensates (BECs) confined in a potential resulting from the superposition of linear and nonlinear optical lattices and make use of Vakhitov-Kolokolov criterion to investigate the effect of nonlinear lattice on the stability of the soliton solutions in the linear optical lattice (LOL). For the single-component case we show that a weak nonlinear lattice has very little effect on the stability of such solitons while sufficiently strong nonlinear optical lattice (NOL) squeezes them to produce narrow bound states. For two-component condensates we find that when the strength of the NOL (γ1) is less than that of the LOL (V0) a relatively weak intra-atomic interaction (IAI) has little effect on the stability of the component solitons. This is true for both attractive and repulsive IAI. A strong attractive IAI, however, squeezes the BEC solitons while a similar repulsive IAI makes the component solitons wider. For γ1 > V0, only a strong attractive IAI squeezes the BEC solitons but the squeezing effect is less prominent than that found for γ1 < V0. We make useful checks on the results of our semianalytical stability analysis by solving the appropriate Gross-Pitaevskii equations numerically.

  1. "A disease of our time": The Catholic Church's condemnation and absolution of psychoanalysis (1924-1975).

    Science.gov (United States)

    Foschi, Renato; Innamorati, Marco; Taradel, Ruggero

    2018-03-01

    The present paper is focused on the evolution of the position of the Catholic Church toward psychoanalysis. Even before Freud's The Future of an Illusion (1927), psychoanalysis was criticized by Catholic theologians. Psychoanalysis was viewed with either contempt or with indifference, but nonpsychoanalytic psychotherapy was accepted, especially for pastoral use. Freudian theory remained for most Catholics a delicate and dangerous subject for a long time. From the center to the periphery of the Vatican, Catholic positions against psychoanalysis have varied in the way that theological stances have varied. In the middle decades of the twentieth century, some Catholics changed their attitudes and even practiced psychoanalysis, challenging the interdict of the Holy Office, which prohibited psychoanalytic practice until 1961. During the Cold War, psychoanalysis progressively became more and more relevant within Catholic culture for two main reasons: changes in psychoanalytic doctrine (which began to stress sexuality to a lesser degree) and the increasing number of Catholic psychoanalysts, even among priests. Between the 1960s and the 1970s, psychoanalysis was eventually accepted and became the main topic of a famous speech by Pope Paul VI. This paper illustrates how this acceptance was a sort of unofficial endorsement of a movement that had already won acceptance within the Church. The situation was fostered by people like Maryse Choisy or Leonardo Ancona, who had advocated within the Church for a sui generis use of psychoanalysis (e.g., proposing a desexualized version of Freudian theories), despite warnings and prohibitions from the hierarchies of the Church. © 2018 Wiley Periodicals, Inc.

  2. Allium compounds, dipropyl and dimethyl thiosulfinates as antiproliferative and differentiating agents of human acute myeloid leukemia cell lines

    Directory of Open Access Journals (Sweden)

    Faten Merhi

    2008-08-01

    Full Text Available Faten Merhi1, Jacques Auger2, Francine Rendu1, Brigitte Bauvois11UMR 7131 UPMC Paris Universitas/CNRS, Groupe Hospitalier Broussais-HEGP, Paris, France; 2University F. Rabelais, IRBI, UPRESA CNRS 6035, Tours, FranceAbstract: Epidemiologic studies support the premise that Allium vegetables may lower the risk of cancers. The beneficial effects appear related to the organosulfur products generated upon processing of Allium. Leukemia cells from patients with acute myeloid leukemia (AML display high proliferative capacity and have a reduced capacity of undergoing apoptosis and maturation. Whether the sulfur-containing molecules thiosulfinates (TS, diallyl TS (All2TS, dipropyl TS (Pr2TS and dimethyl TS (Me2TS, are able to exert chemopreventative activity against AML is presently unknown. The present study was an evaluation of proliferation, cytotoxicity, differentiation and secretion of AML cell lines (U937, NB4, HL-60, MonoMac-6 in response to treatment with these TS and their related sulfides (diallylsulfide, diallyl disulfide, dipropyl disulfide, dimethyl disulfide. As assessed by flow cytometry, ELISA, gelatin zymogaphy and RT-PCR, we showed that Pr2TS and Me2TS, but not All2TS and sulfides, 1 inhibited cell proliferation in dose- and time-dependent manner and this process was neither due to cytotoxicity nor apoptosis, 2 induced macrophage maturation, and 3 inhibited the levels of secreted MMP-9 (protein and activity and TNF-α protein, without altering mRNA levels. By establishing for the first time that Pr2TS and Me2TS affect proliferation, differentiation and secretion of leukemic cell lines, this study provides the opportunity to explore the potential efficiency of these molecules in AML.Keywords: acute myeloid leukemia, thiosulfinate, proliferation, differentiation, matrix metalloproteinase-9

  3. MEDITERRANEAN FOREST TREE DECLINE IN ITALY: RELATIONSHIPS BETWEEN DROUGHT, POLLUTANTS AND THE WAX STRUCTURE OF LEAVES

    Directory of Open Access Journals (Sweden)

    E. PAOLETTI

    1996-04-01

    Full Text Available After presenting the situation of forest decline in Italy and analyzing the factors that play a contributing role, tbis paper studies the response of the epicuticular wax structures and the stomata in ten broadleaf species and one conifer to fog-like treatments with acids andlor surfactants and to severe water stress. The main results are that wax structure alterations vary in intensity in the different species studied and that the microstructural alterations observed in field conditions cannot be attributed only to severe drought. since sample trccs put through water stress simulations do nol differ significantly from controls. In the artificial surfactant treatment, a positive relationship between structural damage to tbe stomata and transpiration suggests possible synergies between the effects of drought and those of pollutants in inducing stress conditions in Mediterranean vegetation.

  4. Contrôle et éléments de maîtrise de la contamination par la levure brettanomyces au cours du procédé de vinification en rouge

    OpenAIRE

    Barbin, Pascal

    2006-01-01

    Les levures du genre Dekkera/Brettanomyces sont reconnues comme les agents de contamination des vins rouges responsables des défauts phénolés et animaux. Une procédure complète de dépistage et d'isolement a été développée en associant plusieurs critères discriminants. Elle a permis de confirmer la présence du contaminant tout au long du procédé, de la matière première (raisins sur pieds), au produit fini (vin en bouteilles). Des études de terrain, en amont du procédé de vinification ont mis e...

  5. Development of a New Class of Scintillating Fibres with Very Short Decay Time and High Light Yield

    International Nuclear Information System (INIS)

    Borshchev, O.; Ponomarenko, S.; Surin, N.; Cavalcante, A.B.R.; Gavardi, L.; Gruber, L.; Joram, C.; Shinji, O.

    2017-01-01

    We present first studies of a new class of scintillating fibres which are characterised by very short decay times and high light yield. The fibres are based on a novel type of luminophores admixed to a polystyrene core matrix. These so-called Nanostructured Organosilicon Luminophores (NOL) have high photoluminescense quantum yield and decay times just above 1 ns. A blue and a green emitting prototype fibre with 250 μm diameter were produced and characterised in terms of attenuation length, ionisation light yield, decay time and tolerance to x-ray irradiation. The well-established Kuraray SCSF-78 and SCSF-3HF fibres were taken as references. Even though the two prototype fibres mark just an intermediate step in an ongoing development, their performance is already on a competitive level. In particular, their decay time constants are about a factor of two shorter than the fastest known fibres, which makes them promising candidates for time critical applications.

  6. The Role of Bismuth in the Treatment of Gastroduodenal Pathology (Literature Review and Own Researches

    Directory of Open Access Journals (Sweden)

    Yu.M. Stepanov

    2016-09-01

    Full Text Available The article presents the history of colloidal bismuth subcitrate and considers the basic mechanisms of its effects on the gastric mucosa, both cytoprotective and anti-helicobacter. The recent data of the worldwide researches are given on the use of the bismuth subcitrate as a component of antibacterial therapy in order to improve the effectiveness of the eradication, especially under the resistance to the basic drugs. The results of own researches are also shown, they are dedicated to the dynamics of structural adjustment of the gastric mucosa in patients with chronic atrophic gastritis for 3 years after the eradication of H.pylori. The use of first-line therapy with the addition of the drug De-Nol allowed to achieve eradication in 94.3 % of patients and positive microstructural changes of the gastric mucosa.

  7. Hydrodeoxygenation of Phenolic Compounds by Sulfided (CoMo/Al2O3 Catalysts, a Combined Experimental and Theoretical Study Hydrodésoxygénation de composés phénoliques en présence de catalyseurs sulfurés (CoMo/Al2O3 : une étude expérimentale et théorique

    Directory of Open Access Journals (Sweden)

    Badawi M.

    2013-04-01

    Full Text Available The hydrodeoxygenation of model phenol compounds (phenol and 2-ethylphenol was carried over unpromoted Mo/Al2O3 and promoted CoMo/Al2O3 catalysts. Hydrodeoxygenation proceeds by two pathways: – hydrogenation of the aromatic ring followed by Csp3-O bond cleavage (HYD pathway, (hydrogenation of the aromatic ring followed by Csp3-O bond cleavage; – direct cleavage of the Csp2-O bond (DDO pathway. Both routes were favored by the presence of Co on the catalyst, while the presence of the alkyl substituent on the phenolic ring favors the DDO route but inhibits the HYD pathway. IR (InfraRed spectroscopy shows that while phenol mostly dissociates on these catalysts, a significant fraction of 2-ethylphenol remains non dissociated. The adsorption energies of both reactants and possible reaction intermediates on promoted and non-promoted sulfide phases as computed by DFT (Density-Functional Theory confirm these findings and allow rationalizing the catalytic activity trends observed experimentally. L’hydrodésoxygénation de deux composés phénoliques modèles (phénol et 2-éthylphénol a été étudiée sur deux catalyseurs Mo/Al2O3 et CoMo/Al2O3 sulfurés. La désoxygénation de ces molécules fait intervenir deux voies parallèles et indépendantes, à savoir : – l’hydrogénation du noyau aromatique suivie par la rupture de la liaison Csp3-O (voie HYD, (hydrogenation of the aromatic ring followed by Csp3-O bond cleavage; – la rupture directe de la liaison Csp2-O (voie de DésOxygénation Directe – DOD. Ces deux voies sont favorisées en présence du catalyseur promu par le cobalt (CoMo/Al2O3. La présence du groupe éthyle permet d’améliorer la voie DOD mais conduit à une diminution de la voie HYD. Les études menées par spectroscopie IR (InfraRouge montrent que le phénol est majoritairement dissocié sur ces catalyseurs alors que le 2-éthylphénol semble plutôt adsorbé de façon non-dissociative. Les énergies d’adsorption de

  8. APLIKASI SPLINE ESTIMATOR TERBOBOT

    Directory of Open Access Journals (Sweden)

    I Nyoman Budiantara

    2001-01-01

    Full Text Available We considered the nonparametric regression model : Zj = X(tj + ej, j = 1,2,…,n, where X(tj is the regression curve. The random error ej are independently distributed normal with a zero mean and a variance s2/bj, bj > 0. The estimation of X obtained by minimizing a Weighted Least Square. The solution of this optimation is a Weighted Spline Polynomial. Further, we give an application of weigted spline estimator in nonparametric regression. Abstract in Bahasa Indonesia : Diberikan model regresi nonparametrik : Zj = X(tj + ej, j = 1,2,…,n, dengan X (tj kurva regresi dan ej sesatan random yang diasumsikan berdistribusi normal dengan mean nol dan variansi s2/bj, bj > 0. Estimasi kurva regresi X yang meminimumkan suatu Penalized Least Square Terbobot, merupakan estimator Polinomial Spline Natural Terbobot. Selanjutnya diberikan suatu aplikasi estimator spline terbobot dalam regresi nonparametrik. Kata kunci: Spline terbobot, Regresi nonparametrik, Penalized Least Square.

  9. Evaluation of polyimide/glass fiber composites for construction of light weight pressure vessels for cryogenic propellants

    Science.gov (United States)

    Petker, I.; Segimoto, M.

    1973-01-01

    The application of polyimide resin as a matrix for glass filament-wound thin metal-lined pressure vessels was studied over a temperature range of (minus) 320 to 600 F. Keramid 601 polyimide was found to perform quite well over the entire range of temperature. Hoop stress values of 425 ksi were determined at 75 F which is equivalent to epoxy resin in similar structures. At -320 and 600 F, 125 and 80% of this strength was retained. Thermal ageing at 500 F for up to 50 hours was studied with severe reduction in strength, but there is evidence that this reduction could be improved. Another polyimide resin studied was P10PA which was found to have processing characteristics inappropriate for filament-winding. NOL ring tensile and shear data was determined from both resins with S-glass. Pressure vessel design, fabrication and test procedures are described in detail.

  10. Planta de producció de paracetamol

    OpenAIRE

    Analgedol (Grup de recerca); Lafuente Sancho, Francisco Javier; Universitat Autònoma de Barcelona. Escola d'Enginyeria

    2009-01-01

    L'objectiu d'aquest projecte es basa en el disseny d'una planta química en la qual es durà a terme la producció del paracetamol a partir de la nitració del fenol. Per a realitzar aquest projecte s'haurà de tenir en compte que la planta compleixi les normatives i legislacions vigents. Aquest projecte inclou els càlculs realitzats per a obtenir el disseny dels equips necessaris per a dur a terme el procés, els diagrames corresponents al procés com ara plànols d'enginyeria, implantació, etc., la...

  11. Actovegin administration in patients with ulcerated gout tophuses

    Directory of Open Access Journals (Sweden)

    M S Eliseev

    2005-01-01

    Full Text Available Objective. To study actovegin efficacy in the treatment of chronic skin ulcers due to ulceration of tophuses in pts with chronic tophaceous gout. Materials and methods. 6 pts with chronic tophaceous gout aged 52 to 77 years with disease duration from 6 to 20 years with longstanding persisting skin ulcers due to tophuses ulceration were included. In addition to allopuri- nol, steroid and nonsteroidal anti-inflammatory drugs they were treated with actovegin 20% intravenously and local applications of 2% actovegin gel. Clinical examination was performed before and after the course of therapy- Results. Two from six pts showed healing of single chronic ulcers to the end of the treatment course. In the remaining pts ulcer count and size decrease was achieved. Conclusion. Actovegin administration in combined therapy of chronic skin ulcers in pts with chronic tophaceous gout promoted healing of the defects in all cases.

  12. Trayectos de uso de TIC: Caso de la Universidad Javeriana

    Directory of Open Access Journals (Sweden)

    Mónica Irlanda Brijaldo-Rodríguez

    2015-01-01

    Full Text Available El propósito de la investigación fue conocer de qué mane - ra los docentes universitarios de la Pontificia Universidad Javeriana, Bogotá (Colombia, utilizan las herramientas tec - nológicas digitales para apoyar su docencia. La metodología empleada combinó estrategias cualitativas y cuantitativas que posibilitaron la comprensión de los usos que hacen los docen - tes de las herramientas tecnológicas. Los resultados permitie - ron delimitar concepciones de tecnología, niveles de acerca - miento a las TIC y definición de los trayectos de uso de las TIC en los profesores universitarios. En este artículo se presenta la discusión sobre los trayectos que desarrollan los docentes cuando utilizan las TIC. Las conclusiones muestran las posibi - lidades que ofrece la cartografía de las trayectorias descritas.

  13. Growth performance of pearl goldfish juvenile carassius auratus cultured in 3 ppt salinity with different exposure time of electric field

    Directory of Open Access Journals (Sweden)

    Kukuh Nirmala

    2015-04-01

    pemberian paparan medan listrik berdaya rendah (10 V ke air media budidaya yang dinaikkan salinitasnya menjadi 3 ppt, dengan tujuan memberikan kondisi mendekati isoosmotik, dan juga untuk mengefektifkan arus listrik dari elektroda ke tubuh ikan. Penelitian ini bertujuan untuk menghitung tingkat kelangsungan hidup dan pertumbuhan benih ikan maskoki mutiara ukuran S (2‒4 cm yang dipelihara pada media bersalinitas 3 ppt yang diberi perlakuan lama waktu pemaparan medan listrik (nol, dua, empat, dan enam menit sebelum ikan diberi pakan dengan daya 10 volt. Ikan dipelihara dengan kepadatan 2 ekor/L dalam akuarium berukuran 20×30×20 cm3 dengan volume air 6 L. Ikan uji yang digunakan memiliki panjang rata-rata 4,11±0,05 cm dan bobot rata-rata 2,89±0,05 g/ekor. Pemberian paparan medan listrik dilakukan selama nol, dua, empat, dan enam menit sebelum ikan diberi pakan, dilakukan setiap hari sebanyak tiga kali yaitu pagi, siang, dan sore hari. Rancangan penelitian terdiri atas empat perlakuan, yaitu 0, 2, 4, dan 6 (lama paparan nol/kontrol, dua, empat, dan enam menit yang diulang masing-masing tiga kali ulangan. Hasil pemaparan arus listrik 10 volt selama nol, dua, empat, dan enam menit, tidak memberikan pengaruh yang nyata pada kelangsungan hidup (p>0,05. Untuk kinerja pertumbuhan, perlakuan paparan empat menit memberikan hasil yang terbaik dibandingkan kontrol (p<0,05, didukung oleh peningkatan persentase nilai rasio panjang usus terhadap panjang tubuh ikan serta nilai efisiensi pakan yang lebih tinggi.Kata kunci: lama paparan medan listrik, kinerja pertumbuhan, ikan maskoki mutiara

  14. A charge-dependent mechanism is responsible for the dynamic accumulation of proteins inside nucleoli.

    Science.gov (United States)

    Musinova, Yana R; Kananykhina, Eugenia Y; Potashnikova, Daria M; Lisitsyna, Olga M; Sheval, Eugene V

    2015-01-01

    The majority of known nucleolar proteins are freely exchanged between the nucleolus and the surrounding nucleoplasm. One way proteins are retained in the nucleoli is by the presence of specific amino acid sequences, namely nucleolar localization signals (NoLSs). The mechanism by which NoLSs retain proteins inside the nucleoli is still unclear. Here, we present data showing that the charge-dependent (electrostatic) interactions of NoLSs with nucleolar components lead to nucleolar accumulation as follows: (i) known NoLSs are enriched in positively charged amino acids, but the NoLS structure is highly heterogeneous, and it is not possible to identify a consensus sequence for this type of signal; (ii) in two analyzed proteins (NF-κB-inducing kinase and HIV-1 Tat), the NoLS corresponds to a region that is enriched for positively charged amino acid residues; substituting charged amino acids with non-charged ones reduced the nucleolar accumulation in proportion to the charge reduction, and nucleolar accumulation efficiency was strongly correlated with the predicted charge of the tested sequences; and (iii) sequences containing only lysine or arginine residues (which were referred to as imitative NoLSs, or iNoLSs) are accumulated in the nucleoli in a charge-dependent manner. The results of experiments with iNoLSs suggested that charge-dependent accumulation inside the nucleoli was dependent on interactions with nucleolar RNAs. The results of this work are consistent with the hypothesis that nucleolar protein accumulation by NoLSs can be determined by the electrostatic interaction of positively charged regions with nucleolar RNAs rather than by any sequence-specific mechanism. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. Diverse Genetic Regulon of the Virulence-Associated Transcriptional Regulator MucR in Brucella abortus 2308

    Science.gov (United States)

    Caswell, Clayton C.; Elhassanny, Ahmed E. M.; Planchin, Emilie E.; Roux, Christelle M.; Weeks-Gorospe, Jenni N.; Ficht, Thomas A.; Dunman, Paul M.

    2013-01-01

    The Ros-type regulator MucR is one of the few transcriptional regulators that have been linked to virulence in Brucella. Here, we show that a Brucella abortus in-frame mucR deletion strain exhibits a pronounced growth defect during in vitro cultivation and, more importantly, that the mucR mutant is attenuated in cultured macrophages and in mice. The genetic basis for the attenuation of Brucella mucR mutants has not been defined previously, but in the present study the genes regulated by MucR in B. abortus have been elucidated using microarray analysis and real-time reverse transcription-PCR (RT-PCR). In B. abortus 2308, MucR regulates a wide variety of genes whose products may function in establishing and maintaining cell envelope integrity, polysaccharide biosynthesis, iron homeostasis, genome plasticity, and transcriptional regulation. Particularly notable among the MucR-regulated genes identified is arsR6 (nolR), which encodes a transcriptional regulator previously linked to virulence in Brucella melitensis 16 M. Importantly, electrophoretic mobility shift assays (EMSAs) determined that a recombinant MucR protein binds directly to the promoter regions of several genes repressed by MucR (including arsR6 [nolR]), and in Brucella, as in other alphaproteobacteria, MucR binds to its own promoter to repress expression of the gene that encodes it. Overall, these studies have uncovered the diverse genetic regulon of MucR in Brucella, and in doing so this work has begun to define the MucR-controlled genetic circuitry whose misregulation contributes to the virulence defect of Brucella mucR mutants. PMID:23319565

  16. European Origin of Bradyrhizobium Populations Infecting Lupins and Serradella in Soils of Western Australia and South Africa† ‡

    Science.gov (United States)

    Stępkowski, Tomasz; Moulin, Lionel; Krzyżańska, Agnieszka; McInnes, Alison; Law, Ian J.; Howieson, John

    2005-01-01

    We applied a multilocus phylogenetic approach to elucidate the origin of serradella and lupin Bradyrhizobium strains that persist in soils of Western Australia and South Africa. The selected strains belonged to different randomly amplified polymorphic DNA (RAPD)-PCR clusters that were distinct from RAPD clusters of applied inoculant strains. Phylogenetic analyses were performed with nodulation genes (nodA, nodZ, nolL, noeI), housekeeping genes (dnaK, recA, glnII, atpD), and 16S-23S rRNA intergenic transcribed spacer sequences. Housekeeping gene phylogenies revealed that all serradella and Lupinus cosentinii isolates from Western Australia and three of five South African narrow-leaf lupin strains were intermingled with the strains of Bradyrhizobium canariense, forming a well supported branch on each of the trees. All nodA gene sequences of the lupin and serradella bradyrhizobia formed a single branch, referred to as clade II, together with the sequences of other lupin and serradella strains. Similar patterns were detected in nodZ and nolL trees. In contrast, nodA sequences of the strains isolated from native Australian legumes formed either a new branch called clade IV or belonged to clade I or III, whereas their nonsymbiotic genes grouped outside the B. canariense branch. These data suggest that the lupin and serradella strains, including the strains from uncultivated L. cosentinii plants, are descendants of strains that most likely were brought from Europe accidentally with lupin and serradella seeds. The observed dominance of B. canariense strains may be related to this species' adaptation to acid soils common in Western Australia and South Africa and, presumably, to their intrinsic ability to compete for nodulation of lupins and serradella. PMID:16269740

  17. European origin of Bradyrhizobium populations infecting lupins and serradella in soils of Western Australia and South Africa.

    Science.gov (United States)

    Stepkowski, Tomasz; Moulin, Lionel; Krzyzańska, Agnieszka; McInnes, Alison; Law, Ian J; Howieson, John

    2005-11-01

    We applied a multilocus phylogenetic approach to elucidate the origin of serradella and lupin Bradyrhizobium strains that persist in soils of Western Australia and South Africa. The selected strains belonged to different randomly amplified polymorphic DNA (RAPD)-PCR clusters that were distinct from RAPD clusters of applied inoculant strains. Phylogenetic analyses were performed with nodulation genes (nodA, nodZ, nolL, noeI), housekeeping genes (dnaK, recA, glnII, atpD), and 16S-23S rRNA intergenic transcribed spacer sequences. Housekeeping gene phylogenies revealed that all serradella and Lupinus cosentinii isolates from Western Australia and three of five South African narrow-leaf lupin strains were intermingled with the strains of Bradyrhizobium canariense, forming a well supported branch on each of the trees. All nodA gene sequences of the lupin and serradella bradyrhizobia formed a single branch, referred to as clade II, together with the sequences of other lupin and serradella strains. Similar patterns were detected in nodZ and nolL trees. In contrast, nodA sequences of the strains isolated from native Australian legumes formed either a new branch called clade IV or belonged to clade I or III, whereas their nonsymbiotic genes grouped outside the B. canariense branch. These data suggest that the lupin and serradella strains, including the strains from uncultivated L. cosentinii plants, are descendants of strains that most likely were brought from Europe accidentally with lupin and serradella seeds. The observed dominance of B. canariense strains may be related to this species' adaptation to acid soils common in Western Australia and South Africa and, presumably, to their intrinsic ability to compete for nodulation of lupins and serradella.

  18. Between Stephen Lloyd and Esteban Yo-eed: Locating Jamaica Through Cuba

    Directory of Open Access Journals (Sweden)

    Faith Smith

    2012-08-01

    Full Text Available In their oft-cited manifesto, the Martinican Creolists exhort Caribbean people to forego their continuing allegiances to the “mythical shores” of various old worlds, and to affirm instead the “alluvial Creoleness” that binds (or that ought to bind them to each other, and to other communities across the globe with a similar plantation history: “Neither Europeans, nor Africans, nor Asians, we proclaim ourselves Creoles; “[the Creole language] is the initial means of communication of our deep self, or our collective unconscious, of our common genius, and it remains the river of our alluvial Creoleness.” Despite their qualifications – “Creoleness is an open specificity,” for example – they have been chided for simplifying the complicated socio-political histories of the region. Maryse Condé, for example, has noted that the opposition of colonizing French language and resisting Creole language ignores the extent to which plantation heterogeneity and negotiation rendered Creole a language of both “unity and compromise.” On what terms can alluvial relationships that can undercut imperial and diasporic ties be uncovered? What does the idea of a Creole unconscious solidify, restore, revivify, and for whom? In this essay, I am interested in a Jamaican-born novelist’s use of Cuba’s second war of independence in the 1890s to critique Jamaican complacency about British colonialism after the Second World War. Cuba, and a “Creole Latin” world more generally, allows him, on my reading, to proffer hispanophone and francophone plantation histories as a model for anglophone sensibilities in the region. The “Creole Latin” affirmation of nationalism, revolutionary struggle, and strong affective ties to the land and to personal relationships, are uncontaminated by the domineering spirit, legalistic prejudices, bureaucracy and commerce, and negotiated concessions that typify anglophone Protestant modes of life. Since the scene

  19. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    1997-06-01

    Full Text Available Culture and Theory Conley, Verena Andermatt, ed. Rethinking Technologies by Laurence M. Porter Leitch, Vincent B. Cultural Criticism, Literary Theory, Poststructuralism by Merry M. Pawlowski French Studies Bersani, Leo and Ulysse Dutoit. Arts of Impoverishment: Beckett, Rothko, Resnais by Thomas Trezise Boldt-Irons, Leslie Anne. On Bataille: Critical Essays by Walter A. Strauss Deleuze, Gilles. Negotiations . Trans. Martin Joughin by Charles J. Stivale Fisher, Dominique D. Staging of Language and Language(s of the Stage: Mallarmé's poëme critique and Artaud's poetry-minus-text by Maryse Fauvel Goodall, Jane. Artaud and the Gnostic Drama by Claudine G. Fisher Lydon, Mary. Skirting the Issue: Essays in Literary Theory by Carol J. Murphy German Studies Barnouw, Dagmar. Critical Realism: History, Photography, and the Work of Siegfried Kracauer by Florence Martin Pfandl-Buchegger, Ingrid. David Lodge als Literaturkritiker, Theoretiker and Romanautor by Charles A. Grair Samuels, Clarise. Holocaust Visions: Surrealism and Existentialism in the Poetry of Paul Celan by Francis Michael Sharp Stefan, Verena. Shedding and Literally Dreaming. Shedding. Trans. Johanna Steigleder Moore and Beth E. Weckmueller; Literally Dreaming . Trans. Johanna Albert and Tobe Levin; "Euphoria and Cacophony." Trans. and Afterword Tobe Levin by Miriam Frank Stern, J.P. The Dear Purchase: A Theme in German Modernism by Theodore Ziolkowski Russian Studies Berry, Ellen E. and Anesa Miller-Pogacer, eds. Re-Entering the Sign: Articulating New Russian Culture by Rolf Hellebust Erlich, Victor. Modernism and Revolution: Russian Literature in Transition by Henry Elbaum Hohne, Karen and Helen Wussow, eds. A Dialogue of Voices: Feminist Literary Theory and Bakhtin by Laura Beraha Masing-Delic, Irene. Abolishing Death: A Salvation Myth of Russian Twentieth-Century Literature by Rolf Hellebust Paperno, Irina and Joan Delaney Grossman, eds. Creating Life: The Aesthetic Utopia of Russian

  20. Perimenarchal air pollution exposure and menstrual disorders.

    Science.gov (United States)

    Mahalingaiah, S; Missmer, S E; Cheng, J J; Chavarro, J; Laden, F; Hart, J E

    2018-01-25

    What is the association between perimenarchal exposure to total suspended particulate (TSP) in air, menstrual irregularity phenotypes and time to menstrual cycle regularity? Exposures to TSP during high school are associated with slightly increased odds of menstrual irregularity and longer time to regularity in high school and early adulthood. The menstrual cycle is responsive to hormonal regulation. Particulate matter air pollution has demonstrated hormonal activity. However, it is not known if air pollution is associated with menstrual cycle regularity. Cross sectional study of 34 832 of the original 116 430 women (29.91%) enrolled in 1989 from the Nurses' Health Study II (NHSII). The follow-up rate for this analytic sample was 97.76% at the 1991 survey. Annual averages of TSP were available for each year of high school attendance. We created three case definitions including high school menstrual irregularity and androgen excess. The time to menstrual cycle regularity was reported by participants as air pollution in the adolescent and early adulthood window may be especially important, given its association with phenotypes of menstrual irregularity. The data from this study agrees with existing literature regarding air pollution and reproductive tract diseases. Shruthi Mahalingaiah: Reproductive Scientist Development Program HD000849, and a research grant from the Boston University Department of Obstetrics and Gynecology, Stacey Missmer: R01HD57210 from the National Institute of Child Health and Human Development and the Massachusetts Institute of Technology Center for Environmental Health Sciences Translational Pilot Project Program, R01CA50385 from the National Cancer Institute, Jaime Hart and Francine Laden: 5R01ES017017 from the National Institute for Environmental Health Sciences, Jaime Hart: P30 ES00002 from the National Institute for Environmental Health Sciences at the National Institute of Health, The Nurses' Health Study II is supported by

  1. Salivary glucose concentration exhibits threshold kinetics in normal-weight, overweight, and obese children

    Directory of Open Access Journals (Sweden)

    Hartman ML

    2014-12-01

    Full Text Available Mor-Li Hartman,1 J Max Goodson,1 Roula Barake,2 Osama Alsmadi,3 Sabiha Al-Mutawa,4 Jitendra Ariga,4 Pramod Soparkar,1 Jawad Behbehani,5 Kazem Behbehani,6 Francine Welty7 1Department of Applied Oral Sciences, The Forsyth Institute, Cambridge, MA, USA; 2Department of Nutrition, The Dasman Diabetes Institute, Dasman, Kuwait; 3Genome Center, The Dasman Diabetes Institute, Dasman, Kuwait; 4Ministry of Health, Kuwait City, Kuwait; 5Faculty of Dentistry, Kuwait University, Kuwait City, Kuwait; 6The Dasman Diabetes Institute, Dasman, Kuwait; 7Division of Cardiology, Beth Israel Deaconess Medical Center, Boston, MA, USA Background: Metabolic syndrome in childhood predicts the development of cardiovascular disease and type 2 diabetes (T2D in adulthood. Testing for features of metabolic syndrome, such as fasting plasma glucose concentration, requires blood sampling which can be difficult in children. Here we evaluated salivary glucose concentration as a surrogate measurement for plasma glucose concentration in 11-year-old US children. Methods: Children from Portland, Maine, and Cambridge, Massachusetts, with a mean age of 10.6±0.2 years provided 6-hour fasting samples of both blood and whole saliva. Salivary glucose levels were measured with a high-sensitivity assay (sensitivity =0.002 mg/dL. Plasma glucose levels were determined by a commercial clinical laboratory. Blood pressure, salivary flow rate, height, and weight were also measured. Results: Of the 65 children enrolled, there were two underweight children (3.1%, 30 normal-weight children (46.2%, 12 overweight children (18.4%, and 21 obese children (32.3%. The mean overall glucose concentrations were 0.11±0.02 mg/dL in saliva and 86.3±0.8 mg/dL in plasma, and these did not differ significantly by body–weight groups. By regression analysis, the plasma concentration equaled 13.5 times the saliva concentration, with a threshold level of 84.8 mg/dL. Salivary glucose values less than threshold plasma

  2. Walter Rowe Courtenay, Jr. (1933–2014)

    Science.gov (United States)

    Benson, Amy J.

    2016-01-01

    WALTER R. COURTENAY, JR., ichthyologist and retired professor, Florida Atlantic University, Boca Raton, Florida, died in Gainesville, Florida, on 30 January 2014 at age 80. Walt was born in Neenah, Wisconsin, on 6 November 1933, son of Walter and Emily Courtenay. Walt's interest in fish began at a young age as evidenced by a childhood diary in which at 13 years of age he wrote about his first catch—a two-and-a-half pound “pike” from Lake Winnebago. When Walt turned ten, the family moved from Wisconsin to Nashville, Tennessee, the move precipitated by his father accepting a position as pastor of the First Presbyterian Church. During those early days in Nashville, Walt's father would take summers off and travel to Michigan to teach at Camp Miniwanca along the shore of Lake Michigan where father and son honed their angling skills. It was also at that time Walt's father had definite views on what his son should be doing in adult life—in Walt's case it was to become a medical doctor. However, his Woods Hole internship in marine biology and oceanography toward the end of his undergraduate years was a transformative experience for him so much so that he abandoned all ideas of becoming a medical doctor and instead specialized in ichthyology and oceanography. Apart from the inherent interest and opportunities Woods Hole opened to him, being back at the shore of a large body of water, in this case the Atlantic Ocean, was far more interesting than sitting in lectures on organic chemistry. With that, Walt completed his B.A. degree at Vanderbilt University in 1956. In 1960 while in graduate school in Miami, Walt met and married Francine Saporito, and over the next several years had two children, Walter III and Catherine. He went on to receive his M.S. in 1961 from The Rosenstiel School of Marine and Atmospheric Science at the University of Miami on the systematics of the genus Haemulon (grunts) and his Ph.D. degree in 1965 working under his advisor C. Richard

  3. Evaluation of a novel very high sun-protection-factor moisturizer in adults with rosacea-prone sensitive skin

    Directory of Open Access Journals (Sweden)

    Grivet-Seyve M

    2017-06-01

    Full Text Available Mathieu Grivet-Seyve,1 Francine Santoro,2 Nadège Lachmann2 1Galderma Research and Development, Sophia Antipolis, France; 2Galderma Research and Development, Egerkingen, Switzerland Background/objective: Rosacea-prone sensitive skin requires high sun-protection factor (SPF moisturizers. This study evaluated Daylong Extreme SPF 50+ lotion, a novel cream containing five ultraviolet filters, two emollients, and three skin conditioners.Subjects and methods: This was an open-label, single-center study. On day 1, before treatment, subjects answered a questionnaire on their skin conditions and sunscreen habits, and both subjects and dermatologist evaluated skin status. Subjects applied the product once daily in the morning to the face for 21 days, and after approximately 3–5 minutes they assessed tolerability and short-term cosmetic acceptability in a questionnaire and daily diary. On day 22, the dermatologist and subjects evaluated skin status for long-term tolerance and cosmetic acceptability.Results: The study enrolled 44 individuals (mean age 58.8 years, 91% female. At baseline, most subjects (39 of 44 showed erythema, and ~30% showed dryness and scaling. Dermatologists noted four cases of pustules and one case of papules. After 21 days’ treatment with the product, the dermatologist reported significantly less erythema, dryness and scaling, three cases of pustules and two cases of papules. At baseline, ~75% of subjects noted a feeling of dryness, >50% reported tension, and nearly 25% reported tickling. After using the product for 21 days, subjects reported significantly less tension, dryness, and tickling. Some subjects noted itching and burning before and after using the product. One subject noted papules during treatment. Most subjects said that the product was pleasant, did not irritate the skin or cause stinging/burning, was easy to apply, quickly absorbed, and nongreasy, improved skin moisturization, helped prevent sun-provoked facial

  4. Desain Pembelajaran Student’s Conceptual Construction Guider Berdasarkan Kesulitan Mahasiswa Calon Guru Fisika pada Konsep Gerak Parabola

    Directory of Open Access Journals (Sweden)

    Duden Saepuzaman

    2016-12-01

      dan y (vertikal. Kedua, membedakan vektor kecepatan, vektor komponen kecepatan, komponen vektor kecepatan dalam arah x dan y. Ketiga, terfokus pada hapalan rumus waktu yang ditempuh peluru untuk lintasan setengah parabola, tinggi maksimum,jarak terjauh maksimum. Keempat, selalu beranggapan kecepatan akhir benda yang bergerak parabola ketika menyentuh tanah selalu nol. Kelima, kecepatan benda nol di puncak (padahal hanya kecepatan dalam arah vertikal yang nol. Keenam, percepatan dimiliki oleh benda dalam arah x maupun y. Ketujuh, ditemukan beberapa mahasiswa menggunakan aturan sinus cosinus segitiga pada penentuan jarak/ ketinggian dan sebaliknya (padahal penentuan jarak/ketinggian berdasarkan informasi kecepatan. Diduga kuat, proses pembelajaran yang terjadi kurang  memfasilitasi  pengembangan kemampuan berpikir mahasiswa untuk membangun konsepnya sendiri (konstruktivisme. Penelitian ini bertujuan untuk membuat sebuah rancangan pembelajaran yang disebut  Student’s Conceptual Construction Guider. Metode yang digunakan adalah  metode analisis deskriftif. Pemahaman konseptual mahasiswa dievaluasi melalui tes konseptual yang berbentuk  uraian. Hasil penelitian  menunjukkan bahwa pembelajaran Student’s Conceptual Construction Guider dapat memfasilitasi  memfasilitasi  pengembangan kemampuan berpikir mahasiswa untuk membangun konsepnya sendiri  dalam memahami konsep gerak parabola. Kata-kata kunci: Student’s Conceptual Construction Guider , kesulitan mahasiswa , Gerak Parabola

  5. Betel leaf toothpastes inhibit dental plaque formation on fixed orthodontic patients

    Directory of Open Access Journals (Sweden)

    Rizka Amelia Mayasari

    2011-12-01

    mengevaluasi efek pasta gigi mengandung ekstrak daun sirih dalam menghambat pembentukan plak pada pemakai peranti ortodonti cekat. Metode: Penelitian dilakukan pada mahasiswa Fakultas Kedokteran Gigi Universitas Airlangga berusia 18–24 tahun, sudah memakai peranti cekat ortodonti selama 1–2 tahun, tidak mempunyai penyakit sistemik. Sampel dibagi dalam dibagi dalam dua kelompok, masing-masing 20 sampel. Sampel kelompok pertama menyikat gigi dengan pasta gigi yang mengandung daun sirih dan kelompok kedua dengan pasta gigi placebo memakai metode Scrub. Pembersihan gigi dilakukan sampai didapatkan skor nol (0 Pembersihan gigi dilakukan sampai didapatkan skor nol (0 didapatkan skor nol (0 orthodontic plaque index. Empat jam setelah itu skor plak diukur kembali. Data dianalisis dengan uji T berpasangan. dianalisis dengan uji T berpasangan. Hasil: Rerata pengumpulan plak pada pemakai pasta gigi mengandung daun sirih adalah 25,54 dan placebo adalah 41,09. Analisis data menunjukkan adanya perbedaan bermakna antara kedua kelompok (p = 0,001. Kesimpulan: Dapat disimpulkan bahwa pasta gigi mengandung daun sirih efektif dalam menghambat pertumbuhan plak pada pemakai peranti ortodonti cekat.

  6. Evolution des composés polyphénoliques du bois de chêne au cours de son séchage. Premiers résultats

    Directory of Open Access Journals (Sweden)

    Pascal Chatonnet

    1994-12-01

    Full Text Available Pendant le séchage naturel à l'air libre du bois de chêne, on assiste à une diminution régulière de la teneur du bois en composés extractibles et notamment en composés phénoliques du type ellagitanins. La diminution de la teneur en ellagitanins provient essentiellement de la disparition des formes oligomères solubles dans l'eau; les tanins polymérisés non extractibles car liés aux parois, évoluent peu au çours du séchage naturel à l'air libre. Les bois séchés rapidement à l'étuve possèdent toujours des quantités plus importantes de polyphénols. Dans le même temps et quel que soit le mode de séchage, on obselVe une diminution des coumarines glucosilées et une augmentation non proportionnelle des formes aglycones. D'un point de vue organoleptique, la diminution de l'ensemble des polyphénols pendant le séchage peut être interprétée comme favorable à l'évolution de la qualité du merrain. En effet, les fractions amères et astringentes du bois de chêne correspondent respectivement .sr certains tanins ellagiques et catéchiques. L'intelVention des micro-organismes isolés de bois de chêne en cours de séchage naturel dans la disparition des composés phénoliques du bois est discutée. La grande majorité des moisissures étudiées est capable de dégrader enzymatiquement les tanins hydrolysables du chêne. Cependant, ces mêmes composés s'hydrolysent et s'oxydent spontanément en présence d'eau et d'oxygène. En conséquence, considérant le profil de colonisation du bois par les micro-organismes et celui des composés phénoliques extractibles, on peut supposer que l'on assiste vraisemblablement pendant le séchage naturel du bois à une dégradation biochimique et chimique des polyphénols dans les couches superficielles du merrain (0 à 4 mm de profondeur et à une dégradation presque' exclusivement chimique au coeur du merrain. La présence d'eau et d'oxygène apparaÎt par conséquent comme un facteur

  7. Comparative Genomics Identifies a Novel Conserved Protein, HpaT, in Proteobacterial Type III Secretion Systems that Do Not Possess the Putative Translocon Protein HrpF

    Directory of Open Access Journals (Sweden)

    Céline Pesce

    2017-06-01

    Full Text Available Xanthomonas translucens is the causal agent of bacterial leaf streak, the most common bacterial disease of wheat and barley. To cause disease, most xanthomonads depend on a highly conserved type III secretion system, which translocates type III effectors into host plant cells. Mutagenesis of the conserved type III secretion gene hrcT confirmed that the X. translucens type III secretion system is required to cause disease on the host plant barley and to trigger a non-host hypersensitive response (HR in pepper leaves. Type III effectors are delivered to the host cell by a surface appendage, the Hrp pilus, and a translocon protein complex that inserts into the plant cell plasma membrane. Homologs of the Xanthomonas HrpF protein, including PopF from Ralstonia solanacearum and NolX from rhizobia, are thought to act as a translocon protein. Comparative genomics revealed that X. translucens strains harbor a noncanonical hrp gene cluster, which rather shares features with type III secretion systems from Ralstonia solanacearum, Paraburkholderia andropogonis, Collimonas fungivorans, and Uliginosibacterium gangwonense than other Xanthomonas spp. Surprisingly, none of these bacteria, except R. solanacearum, encode a homolog of the HrpF translocon. Here, we aimed at identifying a candidate translocon from X. translucens. Notably, genomes from strains that lacked hrpF/popF/nolX instead encode another gene, called hpaT, adjacent to and co-regulated with the type III secretion system gene cluster. An insertional mutant in the X. translucens hpaT gene, which is the first gene of a two-gene operon, hpaT-hpaH, was non-pathogenic on barley and did not cause the HR or programmed cell death in non-host pepper similar to the hrcT mutant. The hpaT mutant phenotypes were partially complemented by either hpaT or the downstream gene, hpaH, which has been described as a facilitator of translocation in Xanthomonas oryzae. Interestingly, the hpaT mutant was also complemented

  8. Peer review statement

    Science.gov (United States)

    2010-08-01

    All papers published in this Volume 12 of IOP Conference Series: Earth and Environmental Science have been peer reviewed through processes administered by the editors of the 25th IAHR Symposium on Hydraulic Machinery and Systems proceedings, Professor Romeo Susan-Resiga, Dr Sebastian Muntean and Dr Sandor Bernad. Reviews were conducted by expert referees from the Scientific Committee to the professional and scientific standards expected of a proceedings journal published by IOP Publishing. The members of the Scientific Committee who selected and reviewed the papers included in the Proceedings of the 25th IAHR Symposium on Hydraulic Machinery and Systems are: Anton ANTONTechnical University of Civil Engineering, BucharestRomania François AVELLANEcole Polytechnique Fédérale de LausanneSwitzerland Fidel ARZOLAEDELCAVenezuela Thomas ASCHENBRENNERVoith Hydro Gmb H & Co. KG, HeidenheimGermany Anton BERGANTLitostroj Power d.o.o., LjubljanaSlovenia Gerard BOISENSAM, LilleFrance Hermod BREKKENTNU, TrondheimNorway Stuart COULSON Voith Hydro Inc., YorkUSA Eduard EGUSQUIZAPolytechnical University Catalonia BarcelonaSpain Arpad FAYUniversity of MiskolczHungary Richard FISHERVoith Hydro Inc., York USA Regiane FORTES-PATELLAInstitut Polytechnique de GrenobleFrance Aleksandar GAJICUniversity of BelgradeSerbia Arno GEHRERAndritz Hydro GrazAustria José GONZÁLEZUniversidad de OviedoSpain François GUIBAULTEcole Polytechnique de MontrealCanada Chisachi KATOUniversity of TokyoJapan Kwang-Yong KIMInha University, IncheonKorea Jiri KOUTNIKVoith Hydro Gmb H & Co. KG, HeidenheimGermany Adrian LUNGUDunarea de Jos University of GalatiRomania Christophe NICOLETPower Vision Engineering Sàrl, LausanneSwitzerland Torbjøm K. NIELSENNTNU, TrodheimNorway Michihiro NISHIKyushu Institute of TechnologyJapan Maryse PAGEHydro Quebec IREQ, VarennesCanada Etienne PARKINSONAndritz Hydro LtdSwitzerland František POCHYLYBrno UniversityCzech Republic Stefan RIEDELBAUCHVoith Hydro Gmb H & Co. KG

  9. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2011-06-01

    (reviewed by Anthony R. Stevens-Acevedo Chanting Down the New Jerusalem: Calypso, Christianity, and Capitalism in the Caribbean, by Francio Guadeloupe (reviewed by Catherine Benoît Once Jews: Stories of Caribbean Sephardim, by Josette Capriles Goldish (reviewed by Aviva Ben-Ur Black and White Sands: A Bohemian Life in the Colonial Caribbean, by Elma Napier (reviewed by Peter Hulme West Indian Slavery and British Abolition, 1783-1807, by David Beck Ryden (reviewed by Justin Roberts The Children of Africa in the Colonies: Free People of Color in Barbados in the Age of Emancipation, by Melanie J. Newton (reviewed by Olwyn M. Blouet Friends and Enemies: The Scribal Politics of Post/Colonial Literature, by Chris Bongie (reviewed by Jacqueline Couti Nationalism and the Formation of Caribbean Literature, by Leah Reade Rosenberg (reviewed by Bénédicte Ledent Signs of Dissent: Maryse Condé and Postcolonial Criticism, by Dawn Fulton (reviewed by Florence Ramond Jurney The Archaeology of the Caribbean, by Samuel M. Wilson (reviewed by Frederick H. Smith Crossing the Borders: New Methods and Techniques in the Study of Archaeological Materials from the Caribbean, edited by Corinne L. Hofman, Menno L.P. Hoogland & Annelou L. van Gijn (reviewed by Mark Kostro

  10. Study of Asphaltene Solutions by Electrical Conductivity Measurements Conductivité électrique des solutions d'asphaltènes

    Directory of Open Access Journals (Sweden)

    Behar E.

    2006-11-01

    Full Text Available The asphaltene interactions in model solutions were studied using a technique based on the electrical conductivity measurement. Interactions with n-heptane, resins, surfactants, water, phenol and NaCI were investigated. The conclusions drawn from this study confirmed previous opinions on aggregation mechanism of asphaltenes in solutions. They confirmed also the interpretation of asphaltene behaviour in terms of colloidal solution theories. Les interactions des asphaltènes avec leur environnement moléculaire dans des solutions modèles ont été étudiées par la mesure de la conductivité électrique de ces solutions. Les interactions avec le n-heptane, des résines, des tensioactifs, l'eau, le phénol et le chlorure de sodium ont été explorées. Les conclusions tirées de cette étude ont confirmé certaines hypothèses faites sur les mécanismes d'agrégation des asphaltènes en solution, en particulier dans le cadre de la théorie des solutions colloïdales.

  11. Pierādījumu vērtēšana kriminālprocesā

    OpenAIRE

    Griķe, Madara

    2011-01-01

    Pierādījumu vērtēšana ir viena no būtiskākajām valsts atzīto un aizsargāto cilvēka pamattiesību garantijām kriminālprocesā, tā nosaka tiesas nolēmuma tiesiskumu un pamatotību. Attiecībā uz pierādījumu vērtēšanu likumā nav konkrēta panta, ir reglamentēti pierādīšanas teorijas centrālie jēdzieni, principi un prasības, pēc kurām jāatbilst pierādījumiem un pēc kurām tie jāvērtē. Autore darbā pievēršas sastopamām problēmām praksē, kas saistītas ar pierādījumu vērtēšanu. Autore aktualizē jautājumu...

  12. Identification of small molecule and genetic modulators of AON-induced dystrophin exon skipping by high-throughput screening.

    Directory of Open Access Journals (Sweden)

    Debra A O'Leary

    Full Text Available One therapeutic approach to Duchenne Muscular Dystrophy (DMD recently entering clinical trials aims to convert DMD phenotypes to that of a milder disease variant, Becker Muscular Dystrophy (BMD, by employing antisense oligonucleotides (AONs targeting splice sites, to induce exon skipping and restore partial dystrophin function. In order to search for small molecule and genetic modulators of AON-dependent and independent exon skipping, we screened approximately 10,000 known small molecule drugs, >17,000 cDNA clones, and >2,000 kinase- targeted siRNAs against a 5.6 kb luciferase minigene construct, encompassing exon 71 to exon 73 of human dystrophin. As a result, we identified several enhancers of exon skipping, acting on both the reporter construct as well as endogenous dystrophin in mdx cells. Multiple mechanisms of action were identified, including histone deacetylase inhibition, tubulin modulation and pre-mRNA processing. Among others, the nucleolar protein NOL8 and staufen RNA binding protein homolog 2 (Stau2 were found to induce endogenous exon skipping in mdx cells in an AON-dependent fashion. An unexpected but recurrent theme observed in our screening efforts was the apparent link between the inhibition of cell cycle progression and the induction of exon skipping.

  13. Effects of Asiatic Acid on Spatial Working Memory and Cell Proliferation in the Adult Rat Hippocampus

    Directory of Open Access Journals (Sweden)

    Apiwat Sirichoat

    2015-10-01

    Full Text Available Asiatic acid is a pentacyclic triterpene from Centella asiatica. Previous studies have reported that asiatic acid exhibits antioxidant and neuroprotective activities in cell culture. It also prevents memory deficits in animal models. The objective of this study was to investigate the relationship between spatial working memory and changes in cell proliferation within the hippocampus after administration of asiatic acid to male Spraque-Dawley rats. Control rats received vehicle (propylene glycol while treated rats received asiatic acid (30 mg/kg orally for 14 or 28 days. Spatial memory was determined using the novel object location (NOL test. In animals administered asiatic acid for both 14 and 28 days, the number of Ki-67 positive cells in the subgranular zone of the dentate gyrus was significantly higher than in control animals. This was associated with a significant increase in their ability to discriminate between novel and familiar object locations in a novel object discrimination task, a hippocampus-dependent spatial memory test. Administration of asiatic acid also significantly increased doublecortin (DCX and Notch1 protein levels in the hippocampus. These findings demonstrate that asiatic acid treatment may be a potent cognitive enhancer which improves hippocampal-dependent spatial memory, likely by increasing hippocampal neurogenesis.

  14. Antioxydants naturels végétaux

    Directory of Open Access Journals (Sweden)

    Rolland Yohan

    2004-11-01

    Full Text Available Oxidation of lipids corresponds to the degradation of fatty acids by a continuation of sequential reactions : the decomposition of peroxides formed on the fatty chains after the attack by radicalaires compounds ends in the production of aldéhydes, cétones, acids, alcohols and go to a loss of the organoleptic and nutritional qualities (characteristic rancy smell and taste, thus a significant loss of economic value. The synthetic antioxidants (BHT, BHA are effective, but their use is of pleased in more controversial. It is thus advisable to study with attention the plant natural antioxidants. The antioxidizing properties of the plant products are given by a certain number of tests as the test to the DPPH or the test ORAC in aqueous environment, and the measure of the index of peroxides or the Rancimat for the lipophilic phases. Certain tests are above all models of study, and few are really recognized, however certain standards are outlined, and the standardization arrives finally (cf the test ORAC, reference USDA. Among the compound vegetables which stand out very sharply at the level of their antioxidizing property, polyphénols are the most represented in the vegetal reign. It is a very wide family, but the extracts of grape seeds or tea are now well identified, and present results in the fight against the oxidation completely surprising.

  15. Experimental study of the crack depth ratio threshold to analyze the slow crack growth by creep of high density polyethylene pipes

    International Nuclear Information System (INIS)

    Laiarinandrasana, Lucien; Devilliers, Clémence; Lucatelli, Jean Marc; Gaudichet-Maurin, Emmanuelle; Brossard, Jean Michel

    2014-01-01

    To assess the durability of drinking water connection pipes subjected to oxidation and slow crack growth, a comprehensive database was constructed on a novel specimen geometry: the pre-cracked NOL ring. 135 tests were carried out consisting of initial crack depth ratio ranging from 0.08 to 0.6; single or double longitudinal cracks: tensile with steady strain rate and creep loading. A threshold value of the crack depth ratio of 0.2, induced by the oxidation was determined by analyzing several mechanical parameters. This threshold value was shown to be independent on the strain rate effects, single or double crack configuration and the kind of loading: tensile or creep. Creep test results with crack depth ratio larger than 0.2 were then utilized to establish a failure assessment diagram. A methodology allowing the prediction of residual lifetime of in-service pipes was proposed, using this diagram. - Highlights: • Experimental data on pre-cracked rings featuring a longitudinally cracked HDPE pipe. • Crack depth ratio threshold for slow crack growth study consecutive to oxidation. • Investigation of the effects of the single/double notch(es) and of the strain rate. • Original results obtained from tests performed with tensile and creep loadings. • Correlation between creep initiation time and C* with DENT and ring specimens

  16. Noziedzīgi iegūtu līdzekļu legalizēšanas aktuālās problēmas saistībā ar ārzonu kompānijām

    OpenAIRE

    Lapiņš, Roberts

    2016-01-01

    Maģistra darba temats ir „Noziedzīgi iegūtu līdzekļu legalizēšana jeb „netīrā nauda”. Noziedzīgi iegūtu līdzekļu legalizēšana ir noziedzīgs nodarījums pret tautsaimniecību. Noziedzīgi iegūtu līdzekļu legalizēšana ir noziedzīgi iegūtu līdzekļu pārvēršana citās vērtībās, ja šīs darbības tiek veiktas nolūkā slēpt vai maskēt to noziedzīgo izcelsmi. Autors darbā veica noziedzīgi iegūtu līdzekļu jeb tā sauktās „netīrās naudas” izpēti: lai sasniegtu izvirzīto mērķi, autors raksturoja noziedzīgi iegū...

  17. Possible Contributions of Jatropha curcas L. to Rural Poverty Alleviation in Senegal: Vision and Facts

    Directory of Open Access Journals (Sweden)

    Baudoin, JP.

    2008-01-01

    Full Text Available Les groupes chimiques de Ayapana triplinervis, extraits successivement au moyen de l'hexane, de l'éther de pétrole, du méthanol, de la chloroforme: méthanol (1:1 et de la chloroforme: méthanol (4:1 ont été étudiés pour leurs effets sur le Plutella xylostella, les Crocidolomia binotalis et les Myzus persicae, trois insectes nuisibles aux cultures horticoles à l'Ile Maurice. Les extraits bioactifs ont été fractionnés davantage en divers groupes en utilisant la chromatographie et sept d'entre eux montrant l'activité la plus forte ont été examinés sur chacun des trois insectes. Les résultats ont montré que les alcaloïdes et les tannins sont les groupes chimiques ayant la plus grande dissuasion d'alimentation dans les larves de P. xylostella et de C. binotalis, suivis des phénols et des flavonoïdes. Dans le cas des M. persicae, les extraits de A. triplinervis ont perturbé la croissance et le développement des nymphes, et sont des bons candidats pour les études plus poussées dans le contexte d'agriculture biologique et durable.

  18. Wilderness leadership--on the job.

    Science.gov (United States)

    Kanengieter, John; Rajagopal-Durbin, Aparna

    2012-04-01

    Lessons taught and learned in the challenging, unpredictable environment of a wilderness expedition have direct applications to today's business world. That's according to two directors at the National Outdoor Leadership School, who in this article share five principles for expedition--and career-success. (1) Practice leadership. The fundamental philosophy of NOLS is that leadership can be learned-even by those who don't think they have a natural ability to lead. You just need to practice making decisions, then reflecting on and learning from the outcomes. (2) Lead from everywhere. In an expedition group, or in an organization, you can play four roles, often simultaneously: designated leader, active follower, peer leader, and self-leader. Effective teamwork rests on knowing how and when to step into each role. (3) Behave well Leadership means getting along in a diverse group, cooperating with teammates, effectively resolving conflict, and keeping yourself and others motivated. (4) Keep calm. On expeditions and in business, people often end up scrapping not only Plan A but also Plan B. Leadership involves planning for things you can control, letting go of things you can't, expecting the unexpected, and maintaining composure when unforeseen circumstances arise. (5) Disconnect to connect. The fast-paced, high-tech world of work wreaks havoc on leaders' ability to engage in the careful, strategic thinking required of them. It's important to disconnect from 21st-century distractions and to connect with nature once in a while.

  19. Fuqing nuclear power of nuclear steam turbine generating unit No.1 at the implementation and feedback

    International Nuclear Information System (INIS)

    Cao Yuhua; Xiao Bo; He Liu; Huang Min

    2014-01-01

    The article introduces the Fuqing nuclear power of nuclear steam turbine generating unit no.l purpose, range of experience, experiment preparation, implementation, feedback and response. Turn of nuclear steam turbo-generator set flush, using the main reactor coolant pump and regulator of the heat generated by the electric heating element and the total heat capacity in secondary circuit of reactor coolant system (steam generator secondary side) of saturated steam turbine rushed to 1500 RPM, Fuqing nuclear power of nuclear steam turbine generating unit no.1 implementation of the performance of the inspection of steam turbine and its auxiliary system, through the test problems found in the clean up in time, the nuclear steam sweep turn smooth realization has accumulated experience. At the same time, Fuqing nuclear power of nuclear steam turbine generating unit no.1 at turn is half speed steam turbine generator non-nuclear turn at the first, with its smooth realization of other nuclear power steam turbine generator set in the field of non-nuclear turn play a reference role. (authors)

  20. Mātes-meitas -attiecības Elfrīdes Jelinekas romānā "Klavierspēlētāja"

    OpenAIRE

    Martiņuka, Jekaterina

    2014-01-01

    Elfrīdes Jelinekas romānā visvairāk uzminība tiek koncentrēta uz attiecībām starp māti un meitu, kā arī šo attiecību tālāko ietekmi uz galvenās varones dzīvi. Šis darbs sniedz ieskatu pašas rakstnieces dzīvē, kā arī viņas bērnībā, no kurienes arī nākušas romānas vēsmas. Galvenās varones Ērikas uzvedībai ir cēloņi, kas nāk no viņas bērnibas, bet galvenokārt no viņas attiecībām ar pašas māti. Jelineka izveidoja autoritāru tēlu, māti, kura audzina savu bērnu savtīgiem nolūkiem, tajā pašā laik...

  1. Prime Contractors with Awards Over $25,000 by Name, Location, and Contract Number, Fiscal Year 1992 (Daubert Industries, Inc.-Gaylord Industries, Inc.)

    Science.gov (United States)

    1993-01-01

    a0 m~ ar (0 - a 0 a4 04 H50 4 a 4 C-1 am a C3 L) 0ý an 0 a n c Za4 00 C.ým 4Lo j I N O Nol 0IS)0 cl r- m - anNe t"I ý ý Ll2 an N -z Do~ acca -fN- 0a’J...c to aQ Coo," I "o o) " ’ mC, ,I e nnI to a) ammc)oc Il I I L) o c wo x I Ca u m2 a. U r-7f cc ~ nl.< C0C) -*4~-0na-ao " 0 ELI ao (v acCa ’’ a~al~ nal...Fw IE~ 1. E F1 F4 o F. c4I F 4 F OF. F7 )I - F ~-4 .F 4 F 41) w 10 A F F W)( o4 v7- m ’mo7 l T =444 45 o o .7 c> S . o Lc4 mo - 04 NNr a)0 lo 7 1 7 o

  2. Izmaksu sistēmas integrācija Openstack mākoņu sistēmā

    OpenAIRE

    Andruškeviča, Eleonora

    2015-01-01

    Izmaksu sistēma ir programma priekš OpenStack atvērta pirmkoda mākoņu sistēmai, kas ir uzrakstīta ar Python programmēšanās valodas palīdzību. Programmas izstrādes nolūks ir paplašināt OpenStack platformu ar precīzu izmaksu radītājiem. Sistēma ir domāta tikai OpenStack lietotājiem. Izmaksu programma dod iespēju lietotājam zināt, cik viņām būtu jāmaksā par patērētiem resursiem konkrētajos periodos, ja OpenStack būtu par maksu. Rezultātā tika iegūta programma, kas dabū virtuālu mašīnu st...

  3. Impact of Crude Oil Quality on the Refining Conditions and Composition of Nutraceuticals in Refined Palm Oil.

    Science.gov (United States)

    Sampaio, Klicia A; Ayala, Jose Vila; Van Hoed, Vera; Monteiro, Simone; Ceriani, Roberta; Verhé, Roland; Meirelles, Antonio J A

    2017-08-01

    Palm oil is the major vegetable oil used worldwide due to its unique properties. The effect of crude palm oil acidity on the final free fatty acids (FFA) content, neutral oil loss (NOL), and nutraceutical compounds, such as carotenes, total tocols (tocopherols and tocotrienols), squalene, and phytosterols was investigated. A central composite design was employed to study the influence of the refining conditions: temperature (200 to 260 °C), steam percentage (0.5% to 3.5%), and initial FFA content (2.2% to 6.0%) on the quality of the refined product. The results revealed that initial palm oil acidity is a statistically important parameter to obtain commercially acceptable values for final FFA content. The increase of temperature presented the most important effect on the reduction of all nutraceutical compounds. The highest tocopherols (88%), phytosterols (98%), and squalene retention (84%) was obtained when applying the mildest temperature (200 °C). From the experimental results, 3 equations were generated enabling the prediction of the free fatty acids content, the tocols content, and the losses of neutral oil. Therefore, this work contributes to the understanding and optimization of the process for the production of palm oil with high nutraceutical quality and low free fatty acid contents. © 2017 Institute of Food Technologists®.

  4. Studies on the kinetics of uranium (VI) electro-reduction and reextraction: Pt. 2

    International Nuclear Information System (INIS)

    Tong Jihong; Ma Xuquan; Tai Derong; Sun Shiren

    1992-01-01

    The kinetics of U(VI) reextraction and U(IV) extraction in the process of U(VI) electro-reduction with the system of HNO 3 -N 2 H 5 NO 3 (H 2 O)/UO 2 (NO 3 ) 2 -HNO 3 (30% TBP-OK) is investigated with a constant interfacial area cell (Lewis cell) with cathode and anode in it. According to the experimental results and data processing, the apparent activation energy of the U(VI) reextraction process is 36.02 kJ/nol. The U(VI) reextraction rate increases when the stirring speed of two phases increases. This process is mainly diffusion controlled. For the U(VI) extraction process, the apparent activation energy is 21.13 kJ/mol. The U(IV) extraction rate also increases when the stirring speed of two phases increases. This process is mainly diffusion controlled. The lower the potential of cathode is, the higher the rates of U(VI) reextraction and U(IV) extraction are

  5. Franšīzes līgums

    OpenAIRE

    Bērziņš, Artūrs

    2011-01-01

    Bakalaura darba "Franšīzes līgums" mērķis ir jaunā nacionālā tiesiskā regulējuma izpēte, tā atbilstības starptautiskajam regulējumam konstatēšana. Bakalaura darbs sastāv no četrām nodaļām, kurās tiek aplūkots franšīzes līgums un tā būtība, tā atšķirība no citiem civiltieskiem līgumiem, franšīzes attīstība Latvijā un tiesiskā regulējuma pilnveidošana Eiropas Savienības tiesiskā regulējuma ietvaros, kā arī problēmjautājumi un to risinājums. Darba autors nonāk pie secinājuma, ka nolūkā past...

  6. Accelerated formation of hydrogen-producing granules for the start-up of UASB reactors using vinasses

    Directory of Open Access Journals (Sweden)

    César González-Ugalde

    2014-02-01

    Full Text Available Hydrogen-producing granules formation was studied in a CSTR. The aim of this process is to later transfer the mixed liquor to a UASB reactor to reduce its start-up period. Vinasses from a national bioetha­nol-producing industry (from sugar cane were used as substrate and their anaerobic fermentation was carried out under mesophilic conditions. The seed sludge was collected from an UASB reactor oper­ated in an industrial wastewater treatment plant and it was heat treated to inactivate methanogenic bacteria. Total viable and non-viable material growth curves were generated and it was determined that the exponential growth phase of the thermally pre­treated mixed culture was between 20 and 120 h. Finally, the anaerobic fermentation of the vinasses in batch mode for 70 hours, and then in continuous CSTR mode for 7 days, showed to be an effective method for accelerating the formation of hydrogen-producing granules. Using this method, granules with an average size of 1.24 mm were achieved. The good efficiency of the process is attributed to high mass transfer in the CSTR reactor.

  7. Tetovēšanas tradīcija Ķīnas vēsturē

    OpenAIRE

    Zolotarjova, Anastasija

    2012-01-01

    Šī bakalaura darba nosaukums ir „Tetovēšanas tradīcija Ķīnas vēsturē”. Tetovēšanas tradīcijai ir sena vēsture. Ķīnas teritoriju apdzīvojošās tautas jau kopš senatnes izmantoja tetovēšanu dažādiem nolūkiem – kā aizsargu no ļaunajiem gariem, kā dekoru, kā soda veidu, kā atpazīšanas zīmi un zvēresta nodošanai. Izpētītas arī mūsdienu Ķīnas mazākumtautību tetovēšanas tradīcijas. Darba mērķis ir seno Ķīnas tautu un mūsdienu Ķīnas mazākumtautību tradīciju un tetovēšanas iemeslu izpēte, kā arī i...

  8. Tīmekļa vietnes ar reaģējošu dizainu izstrāde, izmantojot “Laravel” PHP ietvaru

    OpenAIRE

    Vergins, Kristaps

    2015-01-01

    Mūsdienās tīmekļa vietņu pārlūkošanu nodrošina plašs klāsts dažādu ierīču. Cilvēku vidū lielu popularitāti iemantojusi tīmekļa pārlūkošana, izmantojot savus viedtālruņus un planšetdatorus. Protams, lai lietotājs gūtu baudāmu tīmekļa pārlūkošanas pieredzi savā mobilajā ierīcē, ir nepieciešams izstrādāt pielāgotu tīmekļa vietnes versiju. Tieši šim nolūkam arvien vairāk tiek izstrādātas tīmekļa vietnes ar reaģējošu dizainu. Reaģējošs dizains nodrošina iespēju tīmekļa vietni vienlīdz ērti lietot ...

  9. Latvijas kā medicīnas tūrisma galamērķa konkurētspēju ietekmējošie faktori

    OpenAIRE

    Sidorenko, Anna

    2012-01-01

    Bakalaura darba temats ir «Latvijas kā medicīnas tūrisma galamērķa konkurētspēju ietekmējošie faktori». Ņemot vērā starptautisko pieredzi, medicīnas pakalpojumu sniegšana ārvalstniekiem var nodrošināt papildus ienākumu avotu nacionālajai ekonomikai. Bakalaura darba mērķis ir identificēt un izpētīt faktorus, kas ietekmē Latvijas kā medicīnas tūrisma galamērķa konkurētspēju un izstrādāt priekšlikumus medicīnas pakalpojumu sniedzējiem un valsts pārvaldes institūcijām ar nolūku veicināt Latvij...

  10. Feminisma filozofijais ieskats par sociālistisko tiesību doktrīnu

    OpenAIRE

    Raģele, Ieva

    2006-01-01

    21.gadsimtā pastāv dažādas feminisma formas – liberālais feminisms, kura ietvaros tiek rīkotas kampaņas nolūkā sasniegt individualitātes un brīvības vienlīdzīgu realizēšanu sievietēm un vīriešiem; radikālais feminisms, kura pamatā ir atziņa, ka sieviešu apspiešana izriet no tā, ka sievietes tiek uzskatītas par zemāku šķiru attiecībā pret vīriešiem dzimtes dēļ, un ka visas apspiešanas formas rodas tieši no vīriešu pārākuma; sociālistiskais feminisms, kurš apvieno feministes, kuras aplūko sievi...

  11. Derived limits for radiological protection against ionizing radiation based on ICRP-60 recommendations

    International Nuclear Information System (INIS)

    Jang, Si Young; Lee, Byung Soo

    2000-01-01

    In Korea the dose limits are reduced and are set at the ICRP-60 limits. However, derived limits tabulated as MPC in air and water are sill specified in Notice Nol 98-12. There are some discrepancies between the primary dose limits and MPCs in air and water. Therefore, in order to accept ICRP-60 recommendations fully, derived limits such as ALI, DAC, ECL for radiological protection against ionizing radiation based on ICRP-60 recommendations were calculated using modified methods of those of 10 CFR part 20, dose limits and committed effective dose coefficients of the Basic Safety Standards of the IAEA. The derived limits in this study were also compared with those prescribed in 10 CFR part 20 as well as MPCs of Notice No.98-12 in order to analyze the impact of implementing derived limits on nuclear facilities. ECLs in air and water for the control of radioactive discharge into the environment in this study are shown to have lower values (i.e. more conservative), for most part, than those in Notice No. 98-12. Especially, for uranium elements, ECLs in water are approximately a magnitude in the order of two lower than those in Notice No. 98-12. (author)

  12. Perancangan Autonomous Landing pada Quadcopter Menggunakan Behavior-Based Intelligent Fuzzy Control

    Directory of Open Access Journals (Sweden)

    Chalidia Nurin Hamdani

    2013-09-01

    Full Text Available Quadcopter adalah salah satu platform unmanned aerial vehicle (UAV yang saat ini banyak diriset karena kemampuannya melakukan take-off dan landing secara vertikal. Karena menggunakan 4 motor brushless sebagai penggerak utama, quadcopter memiliki kompleksitas yang cukup tinggi baik dalam pemodelan maupun pengendalian. Landing merupakan salah satu mekanisme pada quadcopter yang membutuhkan kecepatan yang akurat dan aman dengan tetap mempertahankan keseimbangan. Pada penelitian ini, penulis menggunakan Behavior-Based Intelligent Fuzzy Control (BBIFC sebagai dasar kontrol untuk penerapan autonomous landing pada quadcopter. BBIFC adalah salah satu skema high-level control di mana desain kontrol terdiri dari beberapa layer. Ada 2 layer yang digunakan pada penelitian ini yaitu layer untuk pengendalian sudut pitch, roll, yaw dan layer untuk pengendalian ketinggian. Setiap layer memiliki mekanisme kontrol yang berbeda yang didesain menggunakan Intelligent Fuzzy Controller dan kontroler PID. Dengan metode ini dihasilkan algoritma untuk mekanisme safe autonomous landing dengan mengikuti sinyal eksponensial di mana quadcopter mencapai titik 0 (nol meter dalam waktu 15 detik dan Kontroler PID dapat mengendalikan keseimbangan quadcopter dalam waktu 7.97 detik untuk roll dan pitch serta 1.25 detik untuk yaw sejak gangguan sudut diberikan.

  13. G2E3 is a nucleo-cytoplasmic shuttling protein with DNA damage responsive localization

    International Nuclear Information System (INIS)

    Brooks, William S.; Banerjee, Sami; Crawford, David F.

    2007-01-01

    G2E3 was originally described as a G2/M-specific gene with DNA damage responsive expression. The presence of a conserved HECT domain within the carboxy-terminus of the protein indicated that it likely functions as a ubiquitin ligase or E3. Although HECT domains are known to function in this capacity for many proteins, we demonstrate that a portion of the HECT domain from G2E3 plays an important role in the dynamic subcellular localization of the protein. We have shown that G2E3 is a nucleo-cytoplasmic shuttling protein with nuclear export mediated by a novel nuclear export domain that functions independently of CRM1. In full-length G2E3, a separate region of the HECT domain suppresses the function of the NES. Additionally, G2E3 contains a nucleolar localization signal (NoLS) in its amino terminus. Localization of G2E3 to the nucleolus is a dynamic process, and the protein delocalizes from the nucleolus rapidly after DNA damage. Cell cycle phase-specific expression and highly regulated subcellular localization of G2E3 suggest a possible role in cell cycle regulation and the cellular response to DNA damage

  14. Mārketinga stratēģijas izstrāde AS "Aldaris" pārdošanas palielināšana

    OpenAIRE

    Rabinoviča, Aļina

    2007-01-01

    Maģistra darbs ir uzrakstīts par tēmu „Mārketinga stratēģijas izstrāde AS pārdošanas palielināšanas nolūkā”. Tas ir veltīts Latvijas alus tirgus izpētei un AS „Aldaris” esošās mārketinga stratēģijas analīzei ieteikumu izstrādei tās pilnveidošanai. Maģistra darbā aplūkoti sekojoši jautājumi: •mūsdienu mārketinga instrumenti kā uzņēmuma tirdzniecības stratēģijas elements; •reklāmas īpatnības un tās veidi; •pieejas reklāmas budžeta noteikšanai; •Latvijas reklāmas tirgus; •Latv...

  15. Radiation damage in carbon-carbon composites

    International Nuclear Information System (INIS)

    Burchell, T.D.; Eartherly, W.P.; Nelson, G.E.

    1992-01-01

    Graphite and carbon-carbon composite materials are widely used in plasma facing applications in current Tokamak devices such as TFTR and DIIID in the USA, JET, Tore Supra and TEXTOR in Europe, and JT-60U in Japan. Carbon-carbon composites are attractive choices for Tokamak limiters and diverters because of their low atomic number, high thermal shock resistance, high melting point, and high thermal conductivity. Next generation machines such as the International Thermonuclear Experimental Reactor (ITER) will utilize carbon-carbon composites in their first wall and diverter. ITER will be an ignition machine and thus will produce substantial neutron fluences from the D-T fusion reaction. The resultant high energy neutrons will cause carbon atom displacements in the plasma facing materials which will markedly affect their structure and physical properties. The effect of neutron damage on graphite has been studied for over forty years. Recently the effects of neutron irradiation on the fusion relevant graphite GraphNOL N3M was reviewed. In contrast to graphite, relatively little work has been performed to elucidate the effects of neutron irradiation on carbon-carbon composites. The results of our previous irradiation experiments have been published elsewhere. Here the irradiation induced dimensional changes in 1D, 2D, and 3D carbon-carbon composites are reported for fluences up to 4.7 dpa at an irradiation temperature of 600 degree C

  16. Submarine tectonic relief off Enshunada. Enshunadaoki no hendo chikei

    Energy Technology Data Exchange (ETDEWEB)

    Iwabuchi, Y; Sasahara, N; Hamamoto, F [Maritime Safety Agency, Tokyo (Japan); Yoshioka, S [10th Resional Maritime Safety Headquarters, Kagoshima (Japan); Kondo, T [Maritime Safety School, Kyoto (Japan)

    1991-08-15

    This paper reports on the results of investigations on the submarine relief structure off the Enshunada (a sea area which is on the south of the Tenryu River mouth and has about 50km east and west and about 100km north and south) using a bathymetric surveying ship equipped with a narrow multibeam echo sounder. The submarine relief structure of this sea area is clarified into the following topographical districts arranged north to south (each extends roughly in the northeast-southwest direction): the Enshu trough and Tenryu submarine canyon upper valley located in the center thereof, ridges represented by No.l and No.2 Tenryu knolls, the ridge and trough zone where minor ridges and troughes appear complicatedly and repeatedly, and the Nankai trough. The paper contains causes of formation of the Tenryu submarine canyon, the Ryuyo submarine canyon which is located in the northwestern slope of No.2 Tenryu knoll and has a distinct shape, oval-shaped domes scattered in the bottom of Nankai trough, etc. and also opinions on landslide topography seen in the ridge and trough zone. 13 refs., 5 figs., 1 tab.

  17. Oracle Forms migrācija uz Oracle ADF

    OpenAIRE

    Komule, Vanda

    2017-01-01

    Oracle Forms tehnoloģijai ir ilgstoša un veiksmīga vēsture. Oracle Forms instalācijas ir plaši pieejamas visā pasaulē. Savukārt mūsdienu darījuma prasības ir ievērojami mainījušās un Oracle Forms programmatūra tuvojas sava dzīves cikla dabiskām beigām. Šodien vairākas organizācijas vēlas transformēt Oracle Forms lietojumprogrammatūru pilnīgā tīmekļa bāzētā risinājumā. Šim nolūkam Oracle korporācija piedāvā savu risinājumu - Oracle ADF ietvaru, kas bāzēts uz Java EE tehnoloģijām. Autore ir pi...

  18. Calendula officinalis L. saturošo produktu bioloģiskās aktivitātes izvērtējums

    OpenAIRE

    Zepa, Līva

    2016-01-01

    Ārstniecības kliņģerītes ir vienas no senākajiem un pazīstamākajiem ārstniecības augiem pasaulē. Tās ir ātraudzīgas un jau vēsturiski plaši izmantotas tautas medicīnā. Pētījumi par ārstniecības kliņģerīšu lomu veselības saglabāšanā un stiprināšanā, izvērtējot aktīvo vielu saturu un sastāvu tajās, tās var pozitīvi ietekmēt cilvēka organismu gan profilakses nolūkos, gan kā papildus terapija ārstēšanas brīdī. Maģistra darba mērķis bija noskaidrot, kādas un cik daudz aktīvās vielas atrodamas pašg...

  19. Taxonomically Different Co-Microsymbionts of a Relict Legume, Oxytropis popoviana, Have Complementary Sets of Symbiotic Genes and Together Increase the Efficiency of Plant Nodulation.

    Science.gov (United States)

    Safronova, Vera I; Belimov, Andrey A; Sazanova, Anna L; Chirak, Elizaveta R; Verkhozina, Alla V; Kuznetsova, Irina G; Andronov, Evgeny E; Puhalsky, Jan V; Tikhonovich, Igor A

    2018-06-20

    Ten rhizobial strains were isolated from root nodules of a relict legume Oxytropis popoviana Peschkova. For identification of the isolates, sequencing of rrs, the internal transcribed spacer region, and housekeeping genes recA, glnII, and rpoB was used. Nine fast-growing isolates were Mesorhizobium-related; eight strains were identified as M. japonicum and one isolate belonged to M. kowhaii. The only slow-growing isolate was identified as a Bradyrhizobium sp. Two strains, M. japonicum Opo-242 and Bradyrhizobium sp. strain Opo-243, were isolated from the same nodule. Symbiotic genes of these isolates were searched throughout the whole-genome sequences. The common nodABC genes and other symbiotic genes required for plant nodulation and nitrogen fixation were present in the isolate Opo-242. Strain Opo-243 did not contain the principal nod, nif, and fix genes; however, five genes (nodP, nodQ, nifL, nolK, and noeL) affecting the specificity of plant-rhizobia interactions but absent in isolate Opo-242 were detected. Strain Opo-243 could not induce nodules but significantly accelerated the root nodule formation after coinoculation with isolate Opo-242. Thus, we demonstrated that taxonomically different strains of the archaic symbiotic system can be co-microsymbionts infecting the same nodule and promoting the nodulation process due to complementary sets of symbiotic genes.

  20. Pengaruh Pendekatan Cooperative Learning Tipe (TPS Think, Pair, and Share Terhadap Hasil Belajar PKn di Sekolah Dasar

    Directory of Open Access Journals (Sweden)

    Sulistyani Puteri Ramadhani

    2017-12-01

    Full Text Available Tujuan penelitian ini adalah untuk mengetahui pengaruh penggunaan pendekatan cooperative learning tipe think, pair, and share terhadap hasil belajar PKn pada siswa kelas V sekolah dasar. Penelitian ini dilaksanakan di SDN Kebon Baru 10 Pagi dengan sampel penelitian siswa kelas V pada semester II tahun pelajaran 2016-2017. Sampel penelitian menggunakan teknik Simple Random Sampling. Penelitian ini menggunakan metode eksperimen. Adapun teknik pengumpulan data dilakukan menggunakan lembar tes yang dilakukan setelah materi pembelajaran diberikan lembar tes untuk mengetahui hasil belajar PKn siswa, yang sebelumnya telah dilakukan pengujian validitas dan reliabilitas dengan justifikasi ahli dan dianalisis dengan uji normalitas dan uji homogenitas baik kelas kontrol maupun kelas eksperimen. Hasil pengujian normalitas menunjukan bahwa kedua kelas berdistribusi normal. Hasil pengujian homogenitas menunjukan bahwa kedua kelas tersebut homogen. Setelah dilakukan uji persyaratan analisis, maka dilakukan uji hipotesis dengan perhitungan uji-t. Berdasarkan hasil perhitungan uji-t maka hipotesis nol (Ho ditolak dan hipotesis kerja (H1 diterima. Dari perhitungan tersebut maka dapat disimpulkan bahwa penggunaan pendekatan cooperative learning tipe think, pair, and share berpengaruh signifikan terhadap hasil belajar PKn pada siswa kelas V sekolah dasar. Implikasi hasil penelitian ini adalah penggunaan pendekatan cooperative learning tipe think, pair, and share pada pembelajaran PKn dapat  diterapkan guru agar dapat meningkatkan hasil belajar siswa.

  1. GPS sekošanas sistēma

    OpenAIRE

    Striževskis, Andrejs

    2011-01-01

    Šajā darbā ir izskatītas GPS sekošanas iespējas privātās lietošanas sfērā, aprakstītas kartogrāfijas un navigācijas teorētisko pamatu izvēlētās nodaļas un piedāvāts bezmaksas risinājums, kas dod iespēju izmantot sekošanai GPS ierīces ar datora palīdzību un interneta pieslēgumu bez papildus servisiem, kā arī veidot tam nolūkam navigācijas kartes, piesaistot rastra attēlus Zemes ģeogrāfisko koordinātu sistēmai ar polinomiālās transformācijas palīdzību. Atslēgvārdi: GPS sekošana, GIS, navigāc...

  2. Kukuļņemšanas un kukuļdošanas kvalifikācijas problēmas

    OpenAIRE

    Brauere, Jolanta

    2010-01-01

    Bakalaura darba nosaukums ir „Kukuļņemšanas un kukuļdošanas kvalifikācijas problēmas”. Darba mērķis ir izpētīt normatīvos aktus, speciālo juridisko literatūru un judikatūru, nolūkā konstatēt problēmas kukuļņemšanas un kukuļdošanas kvalifikācijā. Lai sasniegtu šo mērķi, darbā tika aplūkota kukuļņemšanas un kukuļdošanas vēsturiskā attīstība, tādējādi sniedzot nelielu ieskatu par kukuļņemšanas un kukuļdošanas juridiskā pamata vēsturiskās attīstības posmiem no 19.gadsimta līdz mūsdienām. Darb...

  3. Abreniešu identitāte atmiņu stāstos

    OpenAIRE

    Rātfeldere, Linda

    2013-01-01

    Izmantojot gan biogrāfiskās intervijas ar abreniešiem, gan muzejos un arhīvos iegūtos materiālus, bakalaura darba "Abreniešu identiāte atmiņu stāstos" mērķis ir caur atmiņu stāstiem pētīt abreniešu identitāti, tās trīs komponentus: vietu, valodu un savstarpējās attiecības. Šim nolūkam, pirmkārt, sniegts Abrenes vēsturiskais, sociālais un kultūras konteksts, plašāk aplūkojot tos aspektus, kas ir būtiski tieši identitātes izpētē. Otrkārt, analizētas abreniešu personiskās atmiņas par Abrenes kul...

  4. CO-PRODUCT ENHANCEMENT AND DEVELOPMENT FOR THE MASADA OXYNOL PROCESS PROCESS

    Energy Technology Data Exchange (ETDEWEB)

    Donald V. Watkins

    2010-06-14

    The focus of this project was an overall process improvement through the enhancement of the co-product streams. The enhancement of the process operations and co-products will increase both ethanol production and the value of other process outputs and reduces the amount of waste byproducts. This leads to a more economical and environmentally sound alternative to landfill disposal of municipal solid waste (MSW). These enhancements can greatly increase the commercial potential for the production of ethanol from MSW by the Masada CES OxyNol process. Both technological and economical issues were considered for steps throughout the conversion process. The research efforts of this project are varied but synergistic. The project investigated many of the operations involved in the Masada process with the overall goal of process improvements. The general goal of the testing was to improve co-product quality, improve conversions efficiencies, minimize process losses, increase energy efficiency, and mitigate process and commercialization risks. The project was divided into 16 subtasks as described in general terms below. All these tasks are interrelated but not necessarily interdependent.

  5. Reactivating the extracellular matrix synthesis of sulfated glycosaminoglycans and proteoglycans to improve the human skin aspect and its mechanical properties

    Directory of Open Access Journals (Sweden)

    Chajra H

    2016-12-01

    Full Text Available Hanane Chajra,1 Daniel Auriol,1 Francine Joly,2 Aurélie Pagnon,3 Magda Rodrigues,4 Sophie Allart,4 Gérard Redziniak,5 Fabrice Lefevre1 1Libragen, Induchem (Givaudan Active Beauty, Toulouse, 2Sephra Pharma, Puteaux, 3Novotec, Bron, 4Centre de Physiopathologie de Toulouse-Purpan, Toulouse, 5Cosmetic Inventions, Antony, France Background: The aim of this study was to demonstrate that a defined cosmetic composition is able to induce an increase in the production of sulfated glycosaminoglycans (sGAGs and/or proteoglycans and finally to demonstrate that the composition, through its combined action of enzyme production and synthesis of macromolecules, modulates organization and skin surface aspect with a benefit in antiaging applications. Materials and methods: Gene expression was studied by quantitative reverse transcription polymerase chain reaction using normal human dermal fibroblasts isolated from a 45-year-old donor skin dermis. De novo synthesis of sGAGs and proteoglycans was determined using Blyscan™ assay and/or immunohistochemical techniques. These studies were performed on normal human dermal fibroblasts (41- and 62-year-old donors and on human skin explants. Dermis organization was studied either ex vivo on skin explants using bi-photon microscopy and transmission electron microscopy or directly in vivo on human volunteers by ultrasound technique. Skin surface modification was investigated in vivo using silicone replicas coupled with macrophotography, and the mechanical properties of the skin were studied using Cutometer. Results: It was first shown that mRNA expression of several genes involved in the synthesis pathway of sGAG was stimulated. An increase in the de novo synthesis of sGAGs was shown at the cellular level despite the age of cells, and this phenomenon was clearly related to the previously observed stimulation of mRNA expression of genes. An increase in the expression of the corresponding core protein of decorin, perlecan

  6. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2009-12-01

    Full Text Available David Brion Davis, Inhuman Bondage: The Rise and Fall of Slavery in the New World (Trevor Burnard Louis Sala-Molins, Dark Side of the Light: Slavery and the French Enlightenment (R. Darrell Meadows Stephanie E. Smallwood, Saltwater Slavery: A Middle Passage from Africa to American Diaspora (Stephen D. Behrendt Ruben Gowricharn, Caribbean Transnationalism: Migration, Pluralization, and Social Cohesion (D. Aliss a Trotz Vilna Francine Bashi, Survival of the Knitted: Immigrant Social Networks in a Stratified World (Riva Berleant Dwaine E. Plaza & Frances Henry (eds., Returning to the Source: The Final Stage of the Caribbean Migration Circuit (Karen Fog Olwig Howard J. Wiarda, The Dutch Diaspora: The Netherlands and Its Settlements in Africa, Asia, and the Americas (Han Jordaan J. Christopher Kovats-Bernat, Sleeping Rough in Port-au-Prince: An Ethnography of Street Children & Violence in Haiti (Catherine Benoît Ginetta E.B. Candelario, Black Behind the Ears: Dominican Racial Identity from Museums to Beauty Shops (María Isabel Quiñones Paul Christopher Johnson, Diaspora Conversions: Black Carib Religion and the Recovery of Africa (Sarah England Jessica Adams, Michael P. Bibler & Cécile Accilien (eds., Just Below South: Intercultural Performance in the Caribbean and the U.S. South (Jean Muteba Rahier Tina K. Ramnarine, Beautiful Cosmos: Performance and Belonging in the Caribbean Diaspora (Frank J. Korom Patricia Joan Saunders, Alien-Nation and Repatriation: Translating Identity in Anglophone Caribbean Literature (Sue N. Greene Mildred Mortimer, Writings from the Hearth: Public, Domestic, and Imaginative Space in Francophone Women’s Fiction of Africa and the Caribbean (Jacqueline Couti Colin Woodard, The Republic of Pirates: Being the True and Surprising Story of the Caribbean Pirates and the Man Who Brought Them Down (Sabrina Guerra Moscoso Peter L. Drewett & Mary Hill Harris, Above Sweet Waters

  7. Knowledge Exchange and Discovery in the Age of Social Media: The Journey From Inception to Establishment of a Parent-Led Web-Based Research Advisory Community for Childhood Disability.

    Science.gov (United States)

    Russell, Dianne J; Sprung, Jennifer; McCauley, Dayle; Kraus de Camargo, Olaf; Buchanan, Francine; Gulko, Roman; Martens, Rachel; Gorter, Jan Willem

    2016-11-11

    % (5/9) of researchers indicated they felt safe to share sensitive or personal information. While researchers shared evidence-based resources and consulted with families to get guidance on specific issues, there was an unexpected benefit of gaining an understanding of what issues were important to families in their daily lives. Parents felt a sense of belonging to this community where they could share their stories but also wanted more researcher participation and clarity on the purpose of the group. The PPR community grew from inception to an established community with active engagement and knowledge exchange. Both parents and researchers described valuable experiences. Researchers should consider social media as a means of engaging families in all phases of research to ensure that research and its outcomes are meaningful to those who need it most. ©Dianne J Russell, Jennifer Sprung, Dayle McCauley, Olaf Kraus de Camargo, Francine Buchanan, Roman Gulko, Rachel Martens, Jan Willem Gorter. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 11.11.2016.

  8. KESETIMBANGAN ADSORPSI FENOL DARI ASAP CAIR TEMPURUNG KELAPA HIBRIDA PADA ARANG AKTIF Adsoprtion Equilibrium of Phenol From Liquid Smoke of Coconut Shell onto Activated Carbon

    Directory of Open Access Journals (Sweden)

    Syahraeni Kadir

    2012-05-01

    Full Text Available The adsorption of liquid smoke phenol of hybrid coconut shell on activated carbon was evaluated at various tempera- ture (30-70 °C and phenol concentration to determine the adsorption capacity and adsorption interaction. The data were evaluated using Langmuir and Freundlich adsorption models. The results showed that the activated carbon ad- sorption capacity increased with an increase in liquid smoke concentration from 0.025 to 1.0 % but it declined due to an increase in the adsorption temperature from 30 to 70 °C. The affinity of phenol onto activated carbon was higher in the high liquid smoke concentration comparing with low concentration. Adsorption capacity decreased when the phe-nol equilibrium concentration (C was 342.78 mg/L, in which it decreased from 32.67 mg/g to 13.02 mg /g. Phenoladsorption onto activated carbon was best fitted to the Freundlich isotherm model than Langmuir isotherm model. Thephenol adsorption capacity of activated carbon at equilibrium concentration (K has decreased from 12.05 mg/g to 9.66 mg/g when the adsorption temperature increased from 30 to 50 °C. The adsorption capacity increased from 13.46 mg/g to 17.02 mg/g at an increase in the temperature from 60 to 70 °C. The value 1/n was above zero, which means that the adsorption interaction was cooperative with the activation energy of 403.43 KJ/mol. In summary, the adsorption was chemisorption. ABSTRAK Adsorpsi fenol dari asap cair tempurung kelapa hibrida pada arang aktif dievaluasi pada berbagai suhu (30-70 °C dan konsentrasi fenol untuk menentukan kapasitas adsorpsi dan mekanisme adsorpsi. Data yang diperoleh dievalusi meng- gunakan model Langmuir dan Freundlich. Data hasil penelitian menunjukkan bahwa kapasitas adsorpsi arang aktif terhadap fenol dari asap cair tempurung kelapa hibrida meningkat sejalan dengan peningkatan konsentrasi asap cair dari 0,025 ke 1,0 %, namun kapasitas adsorpsi menurun akibat peningkatan suhu adsorpsi dari 30 ke 70 °C.  Hal ini

  9. Vinyl Sulfonate/Vinyl Amide Copolymers and Different Surfactants As Suitable Systems in Eorat Higher Temperatures and Salinities Utilisation de mélanges de copolymères vinyl sulfonate/vinyl amide et de différents tensio-actifs en RAP dans des conditions de fortes salinités et de températures élevées

    Directory of Open Access Journals (Sweden)

    Von Halasz S. P.

    2006-11-01

    Full Text Available For enhanced oil recovery flooding processes there will be an increasing demand for polymers having high temperature and electrolyte stability. High molecular weight copolymers based on vinyl sulfonate, vinyl amide, and acryl amide show high performances in matching these demanding requirements. Surfactants are also known that are stable under these conditions, resulting in high deoiling rates. The aim of the present article is to demonstrate the influence of alkylphenol ethoxylates and their corresponding ether sulfonates on VS/VA/AM copolymer solutions. Aqueous solutions of such copolymers were added to varying quantities of nonionic and anionic surfactants at different temperatures using salinity scans. This article discusses the results of experiments with solutions of copolymers and surfactants in terms of compatibility, viscosity yield, flow properties, shear stability, injectability, thermostability, and oil recovery. Solutions of alkylphenol ethoxylates and/or ether sulfonates show nearly the same compatibility within a broad range of temperature and salinity, both with and without polymers. Relatively small amounts of surfactants are able to influence the EOR (Enhanced Oil Recovery properties of the polymer solutions, giving several interesting aspects for improved oil recovery. L'utilisation des polymères en récupération assistée du pétrole a fait apparaître un besoin croissant de polymères stables à haute température et à forte salinité. Les performances des terpolymères vinyl sulfonate/vinyl amide/acrylamide (VS/VA/VM ont montré que ces polymères remplissent de tels critères d'utilisation. On connaît également des tensio-actifs chimiquement stables dans ces mêmes conditions qui pourraient donc permettre d'obtenir des taux de récupération d'huile élevés. L'objectif de ce travail est de mettre en évidence l'influence de la présence d'alkylphénols éthoxyIates et des éthers sulfonates correspondants sur les

  10. Substances toxiques persistantes (PTS dans les corps gras : État des lieux d’après le rapport du programme des Nations-Unies pour l’environnement (PNUE

    Directory of Open Access Journals (Sweden)

    Narbonne Jean François

    2003-07-01

    Full Text Available Depuis plus de trente ans, une attention croissante a été portée sur les risques pour la santé humaine posés par la contamination de l’environnement par les substances toxiques persistantes (PTS. Ces composés persistent pendant de longues périodes dans les compartiments abiotiques et biotiques, sont transportés sur de longues distances depuis leurs points sources et s’accumulent chez l’homme et les organismes via les chaînes alimentaires. En 1997, le PNUE propose une liste initiale de 12 substances appelées polluants organiques persistants (POPs : aldrine, endrine, dieldrine, chordane, DDT, heptachlore, toxaphène, mirex, hexachlorobenzène, PCBs, dioxines (PCDDs, furanes (PCDFs. En 2001, de nouveaux composés sont ajoutés sur la liste des PTS en fonction de leurs caractéristiques comme la liposolubilité, leur résistance à la dégradation, leur forte toxicité ou la constance des apports : hexachlorohexane, PAHs, endosulfan, pentachlorophénol, formes organiques des métaux lourds : mercure, étain et plomb, phtalates, PBDEs\\\\PBBs, chlordécone, alkyl phénols, atrazine. Les sources de PTS sont diverses : (1 Utilisation de produits chimiques industriels comme les pesticides ou les emballages, (2 Réservoirs historiques déjà présents dans l’environnement essentiellement dans les sols et les sédiments ou sous forme de stocks périmés, (3 Sous-produits de process, en particulier comme contaminants indésirables de procédés industriels et de combustion. La France a été associée au rapport de la région IV méditerranéenne. Les niveaux dans les compartiments de l’environnement sont rapportés et l’exposition de l’homme via l’alimentation (vecteur essentiel est estimée en fonction des données collectées. Une évaluation des risques associés a été faite quand les données étaient suffisantes (PAHs, PCBs, PCDD\\\\F, Me Hg. Les lipides apparaissent comme vecteurs majeurs des PTS à travers la cha

  11. Fluoxetine prevents the memory deficits and reduction in hippocampal cell proliferation caused by valproic acid.

    Science.gov (United States)

    Welbat, Jariya Umka; Sangrich, Preeyanuch; Sirichoat, Apiwat; Chaisawang, Pornthip; Chaijaroonkhanarak, Wunnee; Prachaney, Parichat; Pannangrong, Wanassanun; Wigmore, Peter

    2016-12-01

    Valproic acid (VPA), a commonly used antiepileptic drug, has been reported to cause cognitive impairments in patients. In a previous study, using a rodent model, we showed that VPA treatment impaired cognition which was associated with a reduction in the cell proliferation required for hippocampal neurogenesis. The antidepressant fluoxetine has been shown to increase hippocampal neurogenesis and to reverse the memory deficits found in a number of pathological conditions. In the present study we investigated the protective effects of fluoxetine treatment against the impairments in memory and hippocampal cell proliferation produced by VPA. Male Sprague Dawley rats received daily treatment with fluoxetine (10mg/kg) by oral gavage for 21days. Some rats were co-administered with VPA (300mg/kg, twice daily i.p. injections) for 14days from day 8 to day 21 of the fluoxetine treatment. Spatial memory was tested using the novel object location (NOL) test. The number of proliferating cells present in the sub granular zone of the dentate gyrus was quantified using Ki67 immunohistochemistry at the end of the experiment. Levels of the receptor Notch1, the neurotrophic factor BDNF and the neural differentiation marker DCX were determined by Western blotting. VPA-treated rats showed memory deficits, a decrease in the number of proliferating cells in the sub granular zone and decreases in the levels of Notch1 and BDNF but not DCX compared to control animals. These changes in behavior, cell proliferation and Notch1 and BDNF were prevented in animals which had received both VPA and fluoxetine. Rats receiving fluoxetine alone did not show a significant difference in the number of proliferating cells or behavior compared to controls. These results demonstrated that the spatial memory deficits and reduction of cell proliferation produced by VPA can be ameliorated by the simultaneous administration of the antidepressant fluoxetine. Crown Copyright © 2016. Published by Elsevier B

  12. Risk factors related to intimate partner violence police recidivism in Spain

    Directory of Open Access Journals (Sweden)

    Juan José López-Ossorio

    2017-01-01

    Full Text Available Antecedentes/Objetivo: Algunos profesionales, como los policías, tienen la obligación de actuar para prevenir comportamientos violentos, como en la violencia contra la pareja (VCP. Para ello se ayudan de herramientas actuariales dise˜nadas para estimar el riesgo de ocurrencia de nueva violencia después de una denuncia previa (reincidencia en el ámbito policial, atendiendo a aquellos indicadores de riesgo y de protección que estén a su alcance al no ser expertos en evaluación de conductas. Método: Para tratar de afinar más en las valoraciones policiales de riesgo que se realizan en Espa˜na desde el a˜no 2007 y perfeccionar las dos herramientas con que cuenta el Sistema VioGén espa˜nol, Valoración Policial del Riesgo y Evolución del Riesgo (VPR3.1 y VPER3.0, en este trabajo se ha utilizado un dise˜no epidemiológico para estudiar, en una muestra de 6.613 nuevos casos de VCP de Espa˜na, las relaciones empíricas existentes entre 65 indicadores (56 de riesgo y 9 de protección y la reincidencia policial en VCP a seis meses. Resultados: Resultó una tasa de reincidencia del 7,4%, encontrándose asociaciones estadísticamente significativas en 46 indicadores. Conclusiones: Se presenta evidencia empírica sobre indicadores estáticos y nuevos indicadores dinámicos importantes en la gestión de la protección policial de las víctimas. Se discuten las implicaciones prácticas para futuras valoraciones policiales de riesgo.

  13. México: educación pública y formación de un investigador en ciencias sociales

    Directory of Open Access Journals (Sweden)

    Gustavo Garza

    2015-01-01

    Full Text Available En este texto se reproduce la versión completa del discurso pronunciado por Gustavo Garza en la sesión solemne del H. Consejo Universitario de la Benemérita Universidad Autónoma de Puebla, realizada el 20 de noviembre del 2014, en la cual se le otorgó el grado de Doctor Honoris Causa. Su argumento central es que los científicos sociales no surgen por mera genética, vocación o virtuosismo, sino que son producto de las insti - tuciones públicas de investigación universitaria, dentro del contexto social, económico y político en que se desenvuelven, además de ciertos atributos subjetivos. Utiliza su ciclo de vida escolar y de investigador para demostrar dicho planteamiento, siguiendo cro - nológicamente sus estudios y publicaciones principales: Facultad de Economía, Univer - sidad Autónoma de Nuevo León, alma mater primigenia (1962-1967; El Colegio de México, segunda alma mater (1967-1969; formación autodidacta en economía urba - na (1970-1976; Universidad de Cambridge, tercera alma mater (1972-1973; inves - tigador individual, UNAM , cuarta alma mater (1975-1985; dos décadas de libros convencionales (1985-2005; hacia una escuela de economía política urbana (2005- 2014; BUAP , quinta alma mater. Concluye que como una medida para revertir la grave violencia criminal que socava y amenaza con devastar a México, se debe reforzar la calidad académica de las universidades públicas, formando más y mejores estudian - tes e investigadores.

  14. EFFECT OF STORAGE TEMPERATURE PERCENTAGE OF EGG HATCHING OF AEDES AEGYPTI IN LABORATORY=PENGARUH SUHU PENYIMPANAN TERHADAP PRESENTASE TETAS TELUR Aedes aegypti DI LABORATORIUM

    Directory of Open Access Journals (Sweden)

    Riyani Setiyaningsih

    2015-03-01

    Full Text Available EnglishABSTRACTAedes aegypti is the vector of Dengue Hemorrhagic Fever (DHF in Indonesia. Ae. aegypti has a high reproductive capacity, one female mosquitoes can lay 100-150 eggs. Eggs of Ae. aegypti can survive on dry temperatures within a few months, thus increasing the chances of transmission of dengue virus The aim of the study was to determine the effect of temperature on egg hatching percentage of Ae. aegypti. Eggs Ae. aegypti colonization in laboratory results are stored at room temperature and refrigerator temperature. Observations percentage of eggs hatching was observed at month zero, one, two, third, fourth, fifth, and sixth. The results of the study until the sixth month percentage of hatching eggs at room temperature was 63,17, 59,26, 24,33, 13,62, 10, and 0%. While storage on egg hatching refrigerator not occur in the first to sixth.INDONESIANAedes aegypti merupakan vektor Demam Berdarah Dengue (DBD di Indonesia. Ae. aegypti memiliki kemampuan reproduksi yang tinggi, satu ekor nyamuk betina dapat bertelur 100-150 butir telur. Telur Ae. aegypti mampu bertahan hidup pada suhu kering dalam beberapa bulan sehingga memperbesar peluang terjadinnya proses penularan virus DBD. Tujuan penelitian adalah mengetahui pengaruh suhu dan lama penyimpanan terhadap presentase penetasan telur Ae. aegypti. Telur Ae. aegypti hasil kolonisasi di laboratorium disimpan pada suhu ruang dan suhu refrigerator. Pengamatan presentase penetasan telur diamati pada bulan ke nol, kesatu, kedua, ketiga, keempat, kelima, dan keenam. Hasil penelitian pada bulan bertama sampai keenam presentase penetasan telur pada suhu ruang adalah 63,17, 59,26, 24,33, 13,62, 10, dan 0%. Sedangkan penyimpanan pada suhu kukas tidak terjadi penetasan telur pada bulan pertama sampai keenam.

  15. Importancia de la innovación para mejorar la productividad en los sistemas de cría de becerros

    Directory of Open Access Journals (Sweden)

    Hermilo Suárez Domínguez

    2014-01-01

    Full Text Available El objetivo del presente trabajo consistió en destacar la importancia de la innovación como alternativa para resolver la situación de baja tasa de pariciones en los sistemas de cría de becerros en México. Para ello, se analizó información pu - blicada en diversas fuentes, así como obtenida en visitas a distintas unidades de producción. Como resultado, se obtuvo que en 85% de las unidades de producción prevalece un nivel tec - nológico bajo, debido a que la innovación se realiza de manera lenta; ya que las prácticas de manejo zootécnico se han mejorado muy poco en los últimos años, requiriéndose dos vacas para producir un becerro destetado al año, en todas las regiones agroecológicas del país y en cualquier escala de operación. Esta situación se debe a que los productores deciden la adopción de tecnologías con base en la costumbre y las fortalezas de sus saberes empíricos, no en criterios ambientales, económicos o de eficiencia técnica; además de que consideran que la baja productividad es una condición “normal” en los sistemas de cría. Se concluye que la generación, validación y transferencia de tecnología gana - dera todavía enfrenta el desafío de responder a las necesidades identificadas por los productores como premisa para generar impactos favorables en la cría de becerros.

  16. ANALYSIS OF DISEASE MODIFYING DRUGS ADMINISTRATION FREGUENCY AND CAUSES OF THEIR WITHDRAWAL IN RHEUMATOID ARTHRITIS

    Directory of Open Access Journals (Sweden)

    E V Pavlova

    2000-01-01

    Full Text Available Aim of studdy: To assess the frequency of practical application of different basic drugs in rheumatoid arthritis (RA. Material and methods: Tlxe study was conducted basing of questionner of pts and analysis of ycases by randomized sampling among 103 consequent pts (M:F= 13:90 with reliable RA (ARA, 1987 in rheumatologic department of Clinical Hospital Nol in Ekaterinburg. 74% of pts under study demonstrated systemic manifestations: anemia (in 47 pts, lymphadenopathy (in 34, rheumatoid nodules (in 15, Sjogren s syndrome (in 4, nephropathy (in 4, vascular disturbances including Raynaud s phenomenon, capillarites (by 1 pt. Results: In the course of disease basic therapy was prescribed to 88 out of103 (85.4% pts and one and the same patient could take different basic drugs. Aminochinoline drugs prevailed, after them more frequent were immunodepressants and gold preparations. More rarely pts had sulfasalazin, cuprenil and wobenzym. In general, in 133 out of 184 cases of prescribing basic drugs they were canceled. The reason for cancellation were: prevalently absence of the drug in the pharmaceutical stores (in 48 cases averagely in 8 months of taking the drug; then they insufficient efficacy (44 cases averagely in 1.3 year. In 18 cases pts themselves stopped treatment averagely in 3.5 months of drug taking. Conclusion: In the majority of cases of basic drugs cancellation in RA the cause is their absence in sail especially on free of charge prescription. Cases ofself-cancellation of the drug demonstrate the need of explaining to pts the necessity> of long-term taking disease-modifying drugs.

  17. Surface analysis monitoring of polyelectrolyte deposition on Ba0.5Sr0.5TiO3 thin films

    International Nuclear Information System (INIS)

    Morales-Cruz, Angel L.; Fachini, Estevao R.; Miranda, Felix A.; Cabrera, Carlos R.

    2007-01-01

    Thin films are currently gaining interest in many areas such as integrated optics, sensors, friction, reducing coatings, surface orientation layers, and general industrial applications. Recently, molecular self-assembling techniques have been applied for thin film deposition of electrically conducting polymers, conjugated polymers for light-emitting devices, nanoparticles, and noncentrosymmetric-ordered second order nonlinear optical (NOL) devices. Polyelectrolytes self-assemblies have been used to prepare thin films. The alternate immersion of a charged surface in polyannion and a polycation solution leads usually to the formation of films known as polyelectrolyte multilayers. These polyanion and polycation structures are not neutral. However, charge compensation appears on the surface. This constitutes the building driving force of the polyelectrolyte multilayer films. The present approach consists of two parts: (a) the chemisorption of 11-mercaptoundecylamine (MUA) to construct a self-assembled monolayer with the consequent protonation of the amine, and (b) the deposition of opposite charged polyelectrolytes in a sandwich fashion. The approach has the advantage that ionic attraction between opposite charges is the driving force for the multilayer buildup. For our purposes, the multilayer of polyelectrolytes depends on the quality of the surface needed for the application. In many cases, this approach will be used in a way that the roughness factor defects will be diminished. The polyelectrolytes selected for the study were: polystyrene sulfonate sodium salt (PSS), poly vinylsulfate potassium salt (PVS), and polyallylamine hydrochloride (PAH), as shown in . The deposition of polyelectrolytes was carried out by a dipping procedure with the corresponding polyelectrolyte. Monitoring of the alternate deposition of polyelectrolyte bilayers was done by surface analysis techniques such as X-ray photoelectron spectroscopy (XPS), specular reflectance infrared (IR), and

  18. Peptide domains involved in the localization of the porcine reproductive and respiratory syndrome virus nucleocapsid protein to the nucleolus

    International Nuclear Information System (INIS)

    Rowland, Raymond R.R.; Schneider, Paula; Fang Ying; Wootton, Sarah; Yoo, Dongwan; Benfield, David A.

    2003-01-01

    The nucleocapsid (N) protein of porcine reproductive and respiratory syndrome virus (PRRSV) is the principal component of the viral nucleocapsid and localizes to the nucleolus. Peptide sequence analysis of the N protein of several North American isolates identified two potential nuclear localization signal (NLS) sequences located at amino acids 10-13 and 41-42, which were labeled NLS-1 and NLS-2, respectively. Peptides containing NLS-1 or NLS-2 were sufficient to accumulate enhanced green fluorescent protein (EGFP) in the nucleus. The inactivation of NLS-1 by site-directed mutagenesis or the deletion of the first 14 amino acids did not affect N protein localization to the nucleolus. The substitution of key lysine residues with uncharged amino acids in NLS-2 blocked nuclear/nucleolar localization. Site-directed mutagenesis within NLS-2 identified the sequence, KKNKK, as forming the core localization domain within NLS-2. Using an in vitro pull-down assay, the N protein was able to bind importin-α, importin-β nuclear transport proteins. The localization pattern of N-EGFP fusion peptides represented by a series of deletions from the C- and N-terminal ends of the N protein identified a region covering amino acids 41-72, which contained a nucleolar localization signal (NoLS) sequence. The 41-72 N peptide when fused to EGFP mimicked the nucleolar-cytoplasmic distribution of native N. These results identify a single NLS involved in the transport of N from the cytoplasm and into nucleus. An additional peptide sequence, overlapping NLS-2, is involved in the further targeting of N to the nucleolus

  19. Genes Whose Gain or Loss-Of-Function Increases Skeletal Muscle Mass in Mice: A Systematic Literature Review

    Directory of Open Access Journals (Sweden)

    Sander A. J. Verbrugge

    2018-05-01

    Full Text Available Skeletal muscle mass differs greatly in mice and humans and this is partially inherited. To identify muscle hypertrophy candidate genes we conducted a systematic review to identify genes whose experimental loss or gain-of-function results in significant skeletal muscle hypertrophy in mice. We found 47 genes that meet our search criteria and cause muscle hypertrophy after gene manipulation. They are from high to small effect size: Ski, Fst, Acvr2b, Akt1, Mstn, Klf10, Rheb, Igf1, Pappa, Ppard, Ikbkb, Fstl3, Atgr1a, Ucn3, Mcu, Junb, Ncor1, Gprasp1, Grb10, Mmp9, Dgkz, Ppargc1a (specifically the Ppargc1a4 isoform, Smad4, Ltbp4, Bmpr1a, Crtc2, Xiap, Dgat1, Thra, Adrb2, Asb15, Cast, Eif2b5, Bdkrb2, Tpt1, Nr3c1, Nr4a1, Gnas, Pld1, Crym, Camkk1, Yap1, Inhba, Tp53inp2, Inhbb, Nol3, Esr1. Knock out, knock down, overexpression or a higher activity of these genes causes overall muscle hypertrophy as measured by an increased muscle weight or cross sectional area. The mean effect sizes range from 5 to 345% depending on the manipulated gene as well as the muscle size variable and muscle investigated. Bioinformatical analyses reveal that Asb15, Klf10, Tpt1 are most highly expressed hypertrophy genes in human skeletal muscle when compared to other tissues. Many of the muscle hypertrophy-regulating genes are involved in transcription and ubiquitination. Especially genes belonging to three signaling pathways are able to induce hypertrophy: (a Igf1-Akt-mTOR pathway, (b myostatin-Smad signaling, and (c the angiotensin-bradykinin signaling pathway. The expression of several muscle hypertrophy-inducing genes and the phosphorylation of their protein products changes after human resistance and high intensity exercise, in maximally stimulated mouse muscle or in overloaded mouse plantaris.

  20. Identification of gene expression profiling associated with erlotinib-related skin toxicity in pancreatic adenocarcinoma patients

    Energy Technology Data Exchange (ETDEWEB)

    Caba, Octavio, E-mail: ocaba@ujaen.es [Department of Health Sciences, University of Jaen, Jaen (Spain); Irigoyen, Antonio, E-mail: antonioirigoyen@yahoo.com [Department of Medical Oncology, Virgen de la Salud Hospital, Toledo (Spain); Jimenez-Luna, Cristina, E-mail: crisjilu@ugr.es [Institute of Biopathology and Regenerative Medicine (IBIMER), Center of Biomedical Research (CIBM), University of Granada, Granada (Spain); Benavides, Manuel, E-mail: manuel.benavides.sspa@juntadeandalucia.es [Department of Medical Oncology, Virgen de la Victoria Hospital, Malaga (Spain); Ortuño, Francisco M., E-mail: fortuno@ugr.es [Department of Computer Architecture and Computer Technology, Research Center for Information and Communications Technologies, University of Granada, Granada (Spain); Gallego, Javier, E-mail: j.gallegoplazas@gmail.com [Department of Medical Oncology, General Universitario de Elche Hospital, Alicante (Spain); Rojas, Ignacio, E-mail: irojas@ugr.es [Department of Computer Architecture and Computer Technology, Research Center for Information and Communications Technologies, University of Granada, Granada (Spain); Guillen-Ponce, Carmen, E-mail: carmen.guillen@salud.madrid.org [Department of Medical Oncology, Ramón y Cajal University Hospital, Madrid (Spain); Torres, Carolina, E-mail: ctorres@uic.edu [Department of Medicine, Division of Gastroenterology and Hepatology, University of Illinois at Chicago, Chicago, IL (United States); Aranda, Enrique, E-mail: enrique.aranda@imibic.org [Maimonides Institute of Biomedical Research (IMIBIC), Reina Sofía Hospital, University of Córdoba, Córdoba (Spain); Prados, Jose, E-mail: jcprados@ugr.es [Institute of Biopathology and Regenerative Medicine (IBIMER), Center of Biomedical Research (CIBM), University of Granada, Granada (Spain)

    2016-11-15

    Erlotinib is an epidermal growth factor receptor (EGFR) tyrosine kinase inhibitor that showed activity against pancreatic ductal adenocarcinoma (PDAC). The drug's most frequently reported side effect as a result of EGFR inhibition is skin rash (SR), a symptom which has been associated with a better therapeutic response to the drug. Gene expression profiling can be used as a tool to predict which patients will develop this important cutaneous manifestation. The aim of the present study was to identify which genes may influence the appearance of SR in PDAC patients. The study included 34 PDAC patients treated with erlotinib: 21 patients developed any grade of SR, while 13 patients did not (controls). Before administering any chemotherapy regimen and the development of SR, we collected RNA from peripheral blood samples of all patients and studied the differential gene expression pattern using the Illumina microarray platform HumanHT-12 v4 Expression BeadChip. Seven genes (FAM46C, IFITM3, GMPR, DENND6B, SELENBP1, NOL10, and SIAH2), involved in different pathways including regulatory, migratory, and signalling processes, were downregulated in PDAC patients with SR. Our results suggest the existence of a gene expression profiling significantly correlated with erlotinib-induced SR in PDAC that could be used as prognostic indicator in this patients. - Highlights: • Skin rash (SR) is the most characteristic side effect of erlotinib in PDAC patients. • Erlotinib-induced SR has been associated with a better clinical outcome. • Gene expression profiling was used to determine who will develop this manifestation. • 7 genes involved in different pathways were downregulated in PDAC patients with SR. • Our profile correlated with erlotinib-induced SR in PDAC could be used for prognosis.

  1. Finansial Analysis of Wanayasa Tilapia Culture in Mekarsari Farmer Group

    Directory of Open Access Journals (Sweden)

    I. Diatin

    2007-01-01

    Full Text Available This research aims to discover the general overview of the Nila Wanayasa's seeding business which conduct by Mekarsari's Conductors Group in Tanjungsari Village, to analyze the business' rent, to analyze the investment eligibility and to analyze the sensitivity of the price fluctuation of production factors, in this case is feed.  The business eligibility and its sensitivity judged by investment criteria i.e. NPV, Net B/C, and IRR.  The result shows the NPV is IDR 225,116,401.83, Net B/C is 19.38, and IRR is 707%.  The sensitivity analysis which using the switching value methods shows that the business is eligible to be continued with increasing price of feed until 800.917%, because of the NPV is zero, Net B/C is 1, and IRR is equal to the rate.  Keywords:  financial analysis, NPV, Net B/C, IRR, Nila Wanayasa's Culture   ABSTRAK Penelitian ini bertujuan untuk mengetahui kelayakan ekonomi usaha budidaya ikan nila Wanayasa yang dilakukan oleh kelompok tani Mekarsari, Desa Tanjungsari, Purwakarta.  Kriteria kelayakan usaha dan faktor sensitivitas yang diamati meliputi NPV, B/C net, dan IRR.  Hasil penelitian menunjukkan bahwa nilai NPV adalah sebesar Rp 225.116.401,83, B/C net sebesar 19,38, dan IRR 707%.  Analisa sensitivitas menggunakan metode "switching value" menunjukkan bahwa usaha petani layak dilanjutkan sampai harga pakan meningkat  800,92%, karena nilai NPV adalah nol, B/C net 1, dan IRR sama dengan tingkat suku bunga yang berlaku. Kata kunci:  analisis finansial, NPV, B/C, IRR, Nila Wanayasa

  2. Influence des conditions d'élevage et de sulfitage des vins rouges en barriques sur leur teneur en acide acétique et en éthyl-phenols

    Directory of Open Access Journals (Sweden)

    Pascal Chatonnet

    1993-12-01

    En plus de la dose, les conditions de sulfitage des vins et des barriques sont également importantes. L'apport d'une quantité de SO2 non inférieure à 7 g par fût sous forme gazeuse dans un fût vide permet simultanément la désinfection des douelles et le sulfitage des vins. A dosage identique, avec un sulfitage direct du vin, le développement de Brettanomyces intermedius n'est pas inhibé et les vins risquent de présenter un caractère phénolé désagréable en fin d'élevage. Par ailleurs, les sulfitages à la mèche ou à la pastille ne possèdent pas la même efficacité. Si à quantité de soufre identique le méchage à la pastille procure un sulfitage presque deux fois plus important, selon l'origine et les méthodes de fabrication employées, les pastilles de soufre possèdent une stabilité au vieillissement variable se traduisant par des sulfitages irréguliers en fonction de leur âge et de leurs conditions de stockage. La présence d'une charge non combustible hygroscopique entrant dans la composition de certaines pastilles de soufre est responsable de cette instabilité.

  3. On the acquisition of liquids in European Portuguese: empirical contributions for the identification of clinical markers in phonological disorders

    Directory of Open Access Journals (Sweden)

    Ana Margarida Ramalho

    2017-08-01

    Full Text Available O conhecimento acerca da aquisição dos constituintes fonológicos das crianças com alterações fonológicas é ainda relativamente escasso. Os resultados disponíveis na literatura provêm maioritariamente de estudos com tarefas que recorrem à repetição de pseudopalavras. Neste trabalho, foi usado como instrumento de recolha de dados o CLCP-PE, construído à luz da fonologia não linear, de forma a analisar o impacto das variáveis constituência silábica, acento de palavra, posição na palavra e extensão de palavra na produção de dois dos segmentos mais problemáticos no desenvolvimento fo¬nológico em PE: /l/ e /ɾ/. Resultados de crianças portuguesas com desenvolvimento típico serão comparados com os de crianças com desenvolvimento atípico (PEL e PSF, de forma a discutir o uso de /l/ e /ɾ/ em diferentes constituintes prosódicos como potenciais marcadores clínicos em PE. Os resultados obtidos mostraram um efeito significativo de todas as variáveis testadas nas crianças com desenvolvimento típico, tendo sido evidente a presença do efeito das variáveis constituência silábica, posição na palavra e extensão de palavra nas crianças com desenvolvimento atípico.   --- DOI: http://dx.doi.org/10.12957/matraga.2017.28714

  4. Committees

    Science.gov (United States)

    2012-11-01

    Leadership Team of the IAHR Committee for Hydraulic Machinery and Systems Eduard EGUSQUIZA, UPC Barcelona, Spain, Chair François AVELLAN, EPFL-LMH, Switzerland, Past Chair Richard K FISHER, Voith Hydro Inc., USA, Past Chair Fidel ARZOLA, Edelca, Venezuela Michel COUSTON, Alstom Hydro, France Niklas DAHLBÄCKCK, Vatenfall, Sweden Normand DESY, Andritz VA TECH Hydro Ltd., Canada Chisachi KATO, University of Tokyo, Japan Andrei LIPEJ, Turboinstitut, Slovenija Torbjørn NIELSEN, NTNU, Norway Romeo SUSAN-RESIGA, 'Politehnica' University Timisoara, Romania Stefan RIEDELBAUCH, Stuggart University, Germany Albert RUPRECHT, Stuttgart University, Germany Qing-Hua SHI, Dong Fang Electrical Machinery Co., China Geraldo TIAGO, Universidade Federal de Itajubá, Brazil International Advisory Committee Shouqi YUAN (principal) Jiangsu University China QingHua SHI (principal) Dong Fang Electrical Machinery Co. China Fidel ARZOLA EDELCA Venezuela Thomas ASCHENBRENNER Voith Hydro GmbH & Co. KG Germany Anton BERGANT Litostroj Power doo Slovenia B C BHAOYAL Research & Technology Centre India Hermod BREKKE NTNU Norway Stuart COULSON Voith Hydro Inc. USA Paul COOPER Fluid Machinery Research Inc USA V A DEMIANOV Power Machines OJSC Russia Bart van ESCH Technische Universiteit Eindhoven Netherland Arno GEHRER Andritz Hydro Graz Austria Akira GOTO Ebara Corporation Japan Adiel GUINZBURG The Boeing Company USA D-H HELLMANN KSB AG Germany Ashvin HOSANGADI Combustion Research and Flow Technology USA Byung-Sun HWANG Korea Institute of Material Science Korea Toshiaki KANEMOTO Kyushu Institute of Technology Japan Mann-Eung KIM Korean Register of Shipping Korea Jiri KOUTNIK Voith Hydro GmbH & Co. KG Germany Jinkook LEE Eaton Corporation USA Young-Ho LEE Korea Maritime University Korea Woo-Seop LIM Hyosung Goodsprings Inc Korea Jun MATSUI Yokohama National University Japan Kazuyoshi Mitsubishi H I Ltd, Japan MIYAGAWA Christophe NICOLET Power Vision Engineering Srl Switzerland Maryse PAGE Hydro

  5. ANALISA PEMBERLAKUAN TARIF GULA DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Lily Koesuma Widiastuty

    2001-01-01

    Full Text Available The Indonesian government's decision to erase BULOG's sugar monopoly and apply a zero percent import tariff for sugar in January 1998 caused the local sugar industry to be threatened. The fact that imported sugar was cheaper than local sugar showed the inefficiency of the local sugar industry in Indonesia. This caused many sugar factories to nearly go bankrupt because they could not compete with the imported sugar. After much protest, the government retracted its decision to free the sugar market applied a 25% import tariff on sugar. This research shows that sugar importers, owners of sugar factories and the government enjoy the benefits of the tariff but that consumers and farmers do not. This study evaluates demand and supply of sugar in Indonesia before and after the government applied the import tariff. Results of welfare analysis using consumer and producer surplus show that it is better for the government to erase the tariff to make the sugar industry more efficient and protect consumers from loss. Abstract in Bahasa Indonesia : Keputusan pemerintah Indonesia untuk mencabut monopoli BULOG dalam pengadaan gula dan menerapkan tarif impor gula sebesar nol persen pada bulan Januari 1998 mengakibatkan industri gula lokal terancam. Kenyataan bahwa saat itu gula impor lebih murah daripada harga gula lokal menunjukkan ketidakefisienan dari industri gula lokal di Indonesia. Hal ini menyebabkan banyak pabrik gula domestik terancam bangkrut karena tidak dapat bersaing dengan gula impor. Setelah terjadi protes, pemerintah Indonesia mencabut keputusan tersebut dan menggantikannya dengan tarif impor gula sebesar 25%. Penelitian ini menunjukkan bahwa hanya importir gula, pemililk pabrik gula serta pemerintah yang menikmati keuntungan dari kebijakan tarif tersebut tetapi sebaliknya para konsumen dan para petani tebu tidak mengalami keuntungan. Studi ini menganalisa permintaan dan penawaran gula di Indonesia sebelum dan sesudah diterapkan tarif impor gula

  6. EVENT, Explosive Transients in Flow Networks

    International Nuclear Information System (INIS)

    Andrae, R.W.; Tang, P.K.; Bolstad, J.W.; Gregory, W.S.

    1985-01-01

    1 - Description of problem or function: A major concern of the chemical, nuclear, and mining industries is the occurrence of an explosion in one part of a facility and subsequent transmission of explosive effects through the ventilation system. An explosive event can cause performance degradation of the ventilation system or even structural failures. A more serious consequence is the release of hazardous materials to the environment if vital protective devices such as air filters, are damaged. EVENT was developed to investigate the effects of explosive transients through fluid-flow networks. Using the principles of fluid mechanics and thermodynamics, governing equations for the conservation of mass, energy, and momentum are formulated. These equations are applied to the complete network subdivided into two general components: nodes and branches. The nodes represent boundaries and internal junctions where the conservation of mass and energy applies. The branches can be ducts, valves, blowers, or filters. Since in EVENT the effect of the explosion, not the characteristics of the explosion itself, is of interest, the transient is simulated in the simplest possible way. A rapid addition of mass and energy to the system at certain locations is used. This representation is adequate for all of the network except the region where the explosion actually occurs. EVENT84 is a modification of EVENT which includes a new explosion chamber model subroutine based on the NOL BLAST program developed at the Naval Ordnance Laboratory, Silver Spring, Maryland. This subroutine calculates the confined explosion near-field parameters and supplies the time functions of energy and mass injection. Solid-phase or TNT-equivalent explosions (which simulate 'point source' explosions in nuclear facilities) as well as explosions in gas-air mixtures can be simulated. The four types of explosions EVENT84 simulates are TNT, hydrogen in air, acetylene in air, and tributyl phosphate (TBP or 'red oil

  7. ADAPTASI PERIKANAN PUKAT CINCIN DI LAUT JAWA DAN IMPLIKASINYA TERHADAP PENGELOLAAN

    Directory of Open Access Journals (Sweden)

    Suherman Banon Atmaja

    2014-11-01

    Full Text Available Usaha perikanan akan mengalami fluktuasi terkait dengan dinamika faktor alam, sedangkan nelayan mempunyai kemampuan yang lentur dan adaptif dalam kelangsungan usahanya. Tujuan utama makalah ini adalah membahas tentang kemampuan adaptasi perikanan purse seine untuk bertahan dari usaha perikanan tangkap. Pemetaan rekaman data sistem pemantauan kapal (VMS purse seine pelagis kecil tahun 2012 dilakukan berdasarkan kriteria kecepatan kapal nol adalah waktu melakukan aktifitas penangkapan. Daerah penangkapan perikanan pukat cincin pada saat ini telah menyebar semakin luas, tidak terbatas di wilayah teritorial dan perairan nusantara, tetapi sudah sampai ke wilayah Samudera (ZEEI. Jumlah hari laut pada perikanan cantrang kurang dari sebulan memperoleh rata – rata pendapatan nelayan ABK hampir dua kali lipat dari pada ABK pukat cincin yang beroperasi lebih dari sebulan. Rotasi penggunaan alat tangkap di Laut Jawa adalah suatu kondisi yang muncul ke permukaan sebagai sinyal pergeseran populasi ikan dari karakteristik sumber daya yang multi-spesies. Fenomena hasil tangkapan yang tidak tercatat dan dilaporkan menyebabkan pendugaan stok ikan dengan akurat yang rendah akan menimbulkan ketidakpastian dalam penyusunan rekomendasi. Tersedianya sistem pemantauan kapal perlu didukung oleh kegiatan validasi hasil tangkapan yang didaratkan, untuk itu sangat perlu meningkatkan keterlibatkan enumerator dan observer di atas kapal serta penguatan sistem log-book yang sedang berjalan.   The fishing business will fluctuate as a result of high connectivity with the dynamic and nature of environmental factors, in the other side, experience fishers have flexible and adaptive capabilities in order to sustain their business. The objective of this paper is to describe the purse seine fishery adaptability to survive from long term fishing. Plotting data on recorded vessel monitoring system (VMS of small pelagic purse seine in 2012 were applied based on the criteria of the

  8. PENGARUH KUALITAS PRODUK TERHADAP KEPUTUSAN PEMBELIAN PADA TOKO KERAJINAN KULIT KARTIKA MAGETAN

    Directory of Open Access Journals (Sweden)

    Sunarto Sunarto

    2015-07-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui kualitas produk pada toko kerajinan kulit Kartika Magetan dan untuk mengetahui keputusan pembelian pada Toko Kerajinan Kulit Kartika Magetan serta mengetahui ada tidaknya pengaruh kualitas produk yang dihasilkan terhadap keputusan pembelian pada Toko Kerajinan Kulit Kartika Magetan. Dalam penelitian ini menggunakan metode penelitian kuantitatif dengan desain penelitian kausal. Penentuan sampel dalam penelitian ini menggunakan teknik pengambilan sampel Non Probability Sampling yang meliputi sampling kuota (quota sampling. Sampling kuota adalah teknik untuk menentukan sampel dari populasi yang mempunyai ciri-ciri tertentu sampai jumlah kuota yang diinginkan. Sedangkan teknik pengumpulan datanya meng- gunakan metode pengumpulan data kuesioner. Dalam menganalisis data menggunakan metode statistik dengan rumus regresi linier sederhana dan korelasi produk moment. Hasil penelitian ini menunjukan bahwa kualitas produk berpengaruh terhadap keputusan pembelian. Hal ini berdasarkan atas hasil perhitungan regresi linier sederhana yang telah dilakukan dapat diperoleh persamaan Y = 9,5013 + 0,7607X yang artinya jika variabel kualitas produk (X dinaikkan sebesar 1% maka variabel kualitas produk akan bertambah 0,7607%. Dengan nilai konstanta 9,5013 menunjukkan bahwa keputusan pembelian pada Toko Kerajinan Kulit Kartika Magetan akan konstan apabila kualitas produk (X sama dengan nol (tidak ada, dengan asumsi faktor lain tetap atau tidak berubah nilainya. Selain itu didukung dengan uji determinasi yang digunakan untuk mengetahui seberapa besar prosentase sumbangan kualitas produk terhadap keputusan pembelian. Berdasarkan hasil perhitungan yang telah dilakukan untuk uji fisher diperoleh nilai fhitung  (21,735 sedangkan ftabel  (4,41. Hal ini berarti bahwa fhitung  (21,735 > ftabel  (4,41. Atas dasar uji Fisher tersebut dapat disimpulkan Ho tolak, artinya ada pengaruh secara keseluruhan kualitas produk dengan keputusan

  9. Structural inheritance and coastal geomorphology in SW Brittany, France: An onshore/offshore integrated approach

    Science.gov (United States)

    Raimbault, Céline; Duperret, Anne; Le Gall, Bernard; Authemayou, Christine

    2018-04-01

    The Variscan crystalline basement exposed along the SW Brittany coast recorded extensive long-term planation processes during Mesozoic times. Detailed onshore-offshore mapping (600 km2) in the Penmarc'h-Concarneau granitic coastal area reveals a km-scale, deeply fractured submarine rocky shelf. High-resolution offshore imagery (bathymetry and seismic reflection dataset), combined to structural field investigations, on these surfaces allow us to identify a preserved network of both ductile and brittle structures. The inherited fault pattern is dominated by the N160°E-trending and long-lived Concarneau-Toulven fault zone (CTFS) that separates two distinct morphostructural blocks, and strongly influences the seaward limit of the Concarneau submarine rocky shelf, as well as the linear coastline of the Concarneau embayment. The structural imprint of the CTFS decreases progressively westwards with respect to a composite network of large-scale N50°E- and N140°E-oriented faults bounding the seaward edge of the Penmarc'h rocky shelf. The latter in turn splits into three large-scale blocks along N50°E- (La Torche Fault - LTF), N140°E- (Saint Guénolé Fault - SGF) and N160°E-trending normal faults. The morphostructural evolutionary model applied here to the Penmarc'h-Concarneau granitic coastal area resulted from the combined effects of structural Variscan inheritance and post-Variscan tectonics. Paleo-stress analysis of striated fault planes indicates three main Cenozoic tectonic events, inferred to have operated from Eocene to post-Oligocene times. The 3D-architecture of the Concarneau embayment, as a rocky shelf partially sealed with quaternary sediments, chiefly resulted from the reactivation of the CTFS during Eocene and Oligocene times. Further west, the surface of the Penmarc'h rocky shelf was tilted southeastward by the brittle reactivation of the LTF, and dissected by a horst-graben network post-Oligocene in age. The present-day morphology of the Penmarc'h and

  10. Degradation of vitamin C in a product made from mango (Mangifera indica L. and whey protein

    Directory of Open Access Journals (Sweden)

    Fernando Alonso Mendoza-Corvis

    2017-01-01

    Full Text Available This study aimed to determine the kinetics of vitamin C degradation in a product made from mango pulp (Mangifera indica L. and whey protein powder, in order to determine the effect of temperature on its conservation and further evaluate the behavior of the L*, a*, b* and the total color difference (ΔE in the powder product. Vitamin C was determined by the aoac 967.21/90 method using 2,6-dichlorophenol indophenol, and the color was quantified with a HunterLab Color Flex EZ colorimeter. Vitamin C showed greater stability in the powder product ResumoEsta pesquisa procurou determinar a cinética de degradação da vitamina C em um produto em pó elaborado a base de polpa de manga (Mangifera indica L. var. Hilacha e lactisoro, com o fim de conhecer o efeito da temperatura na sua conservação e ademais avaliar o comportamento dos parâmetros L*, a*, b* e a diferença total da cor (ΔE no produto. A vitamina C determinou-se mediante o método aoac 967.21/90, com 2,6-diclorofenol indofe-nol; enquanto que a cor se quantificou com um colorímetro cor Flex EZ marca HunterLab. A vitamina C exibiu maior estabilidade no produto em pó armazenado a uma temperatura de 4 °C, stored at 4 °C with a concentration at the end of the eighth sampling week of 13.94 ± 1.2 mg/10 0 g-1 sample and showing a first order degradation kinetics with k1 values of 0.014 and 0.041 mg/100 g/week at temperatures of 4 °C and 28 °C, respec-tively. The greatest variations in color occurred in samples stored at 28 °C, indicating the influence of the temperature change on the product compo-nents. In addition, L*, a* and b* parameters were less affected under storage temperature of 4 °C, and their values correspond to a second degree polynomial.

  11. Tribological Evaluation of Candidate Gear Materials Operating Under Light Loads in Highly Humid Conditions

    Science.gov (United States)

    Dellacorte, Christopher; Thomas, Fransua; Leak, Olivia Ann

    2015-01-01

    A series of pin-on-disk sliding wear tests were undertaken to identify candidate materials for a pair of lightly loaded timing gears operating under highly humid conditions. The target application involves water purification and thus precludes the use of oil, grease and potentially toxic solid lubricants. The baseline sliding pair is austenitic stainless steel operating against a carbon filled polyimide. The test load and sliding speed (4.9 N, 2.7 m/s) were chosen to represent average contact conditions of the meshing gear teeth. In addition to the baseline materials, the hard superelastic NiTiNOL 60 (60NiTi) was slid against itself, against the baseline polyimide, and against 60NiTi onto which a commercially deposited dry film lubricant (DFL) was applied. The alternate materials were evaluated as potential replacements to achieve a longer wear life and improved dimensional stability for the timing gear application. An attempt was also made to provide solid lubrication to self-mated 60NiTi by rubbing the polyimide against the disk wear track outside the primary 60NiTi-60NiTi contact, a method named stick or transfer-film lubrication. The selected test conditions gave repeatable friction and wear data and smooth sliding surfaces for the baseline materials similar to those in the target application. Friction and wear for self-mated stainless steel were high and erratic. Self-mated 60NiTi gave acceptably low friction (approx. 0.2) and modest wear but the sliding surfaces were rough and potentially unsuitable for the gear application. Tests in which 60NiTi pins were slid against DFL coated 60NiTi and DFL coated stainless steel gave low friction and long wear life. The use of stick lubrication via the secondary polyimide pin provided effective transfer film lubrication to self-mated 60NiTi tribological specimens. Using this approach, friction levels were equal or lower than the baseline polyimide-stainless combination and wear was higher but within data scatter observed

  12. Perbandingan Regresi Binomial Negatif dan Regresi Conway-Maxwell-Poisson dalam Mengatasi Overdispersi pada Regresi Poisson

    Directory of Open Access Journals (Sweden)

    Lusi Eka Afri

    2017-03-01

    Full Text Available Regresi Binomial Negatif dan regresi Conway-Maxwell-Poisson merupakan solusi untuk mengatasi overdispersi pada regresi Poisson. Kedua model tersebut merupakan perluasan dari model regresi Poisson. Menurut Hinde dan Demetrio (2007, terdapat beberapa kemungkinan terjadi overdispersi pada regresi Poisson yaitu keragaman hasil pengamatan keragaman individu sebagai komponen yang tidak dijelaskan oleh model, korelasi antar respon individu, terjadinya pengelompokan dalam populasi dan peubah teramati yang dihilangkan. Akibatnya dapat menyebabkan pendugaan galat baku yang terlalu rendah dan akan menghasilkan pendugaan parameter yang bias ke bawah (underestimate. Penelitian ini bertujuan untuk membandingan model Regresi Binomial Negatif dan model regresi Conway-Maxwell-Poisson (COM-Poisson dalam mengatasi overdispersi pada data distribusi Poisson berdasarkan statistik uji devians. Data yang digunakan dalam penelitian ini terdiri dari dua sumber data yaitu data simulasi dan data kasus terapan. Data simulasi yang digunakan diperoleh dengan membangkitkan data berdistribusi Poisson yang mengandung overdispersi dengan menggunakan bahasa pemrograman R berdasarkan karakteristik data berupa , peluang munculnya nilai nol (p serta ukuran sampel (n. Data dibangkitkan berguna untuk mendapatkan estimasi koefisien parameter pada regresi binomial negatif dan COM-Poisson.   Kata Kunci: overdispersi, regresi binomial negatif, regresi Conway-Maxwell-Poisson Negative binomial regression and Conway-Maxwell-Poisson regression could be used to overcome over dispersion on Poisson regression. Both models are the extension of Poisson regression model. According to Hinde and Demetrio (2007, there will be some over dispersion on Poisson regression: observed variance in individual variance cannot be described by a model, correlation among individual response, and the population group and the observed variables are eliminated. Consequently, this can lead to low standard error

  13. Establishment of Myotis myotis cell lines--model for investigation of host-pathogen interaction in a natural host for emerging viruses.

    Directory of Open Access Journals (Sweden)

    Xiaocui He

    Full Text Available Bats are found to be the natural reservoirs for many emerging viruses. In most cases, severe clinical signs caused by such virus infections are normally not seen in bats. This indicates differences in the virus-host interactions and underlines the necessity to develop natural host related models to study these phenomena. Due to the strict protection of European bat species, immortalized cell lines are the only alternative to investigate the innate anti-virus immune mechanisms. Here, we report about the establishment and functional characterization of Myotis myotis derived cell lines from different tissues: brain (MmBr, tonsil (MmTo, peritoneal cavity (MmPca, nasal epithelium (MmNep and nervus olfactorius (MmNol after immortalization by SV 40 large T antigen. The usefulness of these cell lines to study antiviral responses has been confirmed by analysis of their susceptibility to lyssavirus infection and the mRNA patterns of immune-relevant genes after poly I:C stimulation. Performed experiments indicated varying susceptibility to lyssavirus infection with MmBr being considerably less susceptible than the other cell lines. Further investigation demonstrated a strong activation of interferon mediated antiviral response in MmBr contributing to its resistance. The pattern recognition receptors: RIG-I and MDA5 were highly up-regulated during rabies virus infection in MmBr, suggesting their involvement in promotion of antiviral responses. The presence of CD14 and CD68 in MmBr suggested MmBr cells are microglia-like cells which play a key role in host defense against infections in the central nervous system (CNS. Thus the expression pattern of MmBr combined with the observed limitation of lyssavirus replication underpin a protective mechanism of the CNS controlling the lyssavirus infection. Overall, the established cell lines are important tools to analyze antiviral innate immunity in M. myotis against neurotropic virus infections and present a valuable

  14. Establishment of Myotis myotis cell lines--model for investigation of host-pathogen interaction in a natural host for emerging viruses.

    Science.gov (United States)

    He, Xiaocui; Korytář, Tomáš; Zhu, Yaqing; Pikula, Jiří; Bandouchova, Hana; Zukal, Jan; Köllner, Bernd

    2014-01-01

    Bats are found to be the natural reservoirs for many emerging viruses. In most cases, severe clinical signs caused by such virus infections are normally not seen in bats. This indicates differences in the virus-host interactions and underlines the necessity to develop natural host related models to study these phenomena. Due to the strict protection of European bat species, immortalized cell lines are the only alternative to investigate the innate anti-virus immune mechanisms. Here, we report about the establishment and functional characterization of Myotis myotis derived cell lines from different tissues: brain (MmBr), tonsil (MmTo), peritoneal cavity (MmPca), nasal epithelium (MmNep) and nervus olfactorius (MmNol) after immortalization by SV 40 large T antigen. The usefulness of these cell lines to study antiviral responses has been confirmed by analysis of their susceptibility to lyssavirus infection and the mRNA patterns of immune-relevant genes after poly I:C stimulation. Performed experiments indicated varying susceptibility to lyssavirus infection with MmBr being considerably less susceptible than the other cell lines. Further investigation demonstrated a strong activation of interferon mediated antiviral response in MmBr contributing to its resistance. The pattern recognition receptors: RIG-I and MDA5 were highly up-regulated during rabies virus infection in MmBr, suggesting their involvement in promotion of antiviral responses. The presence of CD14 and CD68 in MmBr suggested MmBr cells are microglia-like cells which play a key role in host defense against infections in the central nervous system (CNS). Thus the expression pattern of MmBr combined with the observed limitation of lyssavirus replication underpin a protective mechanism of the CNS controlling the lyssavirus infection. Overall, the established cell lines are important tools to analyze antiviral innate immunity in M. myotis against neurotropic virus infections and present a valuable tool for a

  15. Establishment of Myotis myotis Cell Lines - Model for Investigation of Host-Pathogen Interaction in a Natural Host for Emerging Viruses

    Science.gov (United States)

    He, Xiaocui; Korytář, Tomáš; Zhu, Yaqing; Pikula, Jiří; Bandouchova, Hana; Zukal, Jan; Köllner, Bernd

    2014-01-01

    Bats are found to be the natural reservoirs for many emerging viruses. In most cases, severe clinical signs caused by such virus infections are normally not seen in bats. This indicates differences in the virus-host interactions and underlines the necessity to develop natural host related models to study these phenomena. Due to the strict protection of European bat species, immortalized cell lines are the only alternative to investigate the innate anti-virus immune mechanisms. Here, we report about the establishment and functional characterization of Myotis myotis derived cell lines from different tissues: brain (MmBr), tonsil (MmTo), peritoneal cavity (MmPca), nasal epithelium (MmNep) and nervus olfactorius (MmNol) after immortalization by SV 40 large T antigen. The usefulness of these cell lines to study antiviral responses has been confirmed by analysis of their susceptibility to lyssavirus infection and the mRNA patterns of immune-relevant genes after poly I:C stimulation. Performed experiments indicated varying susceptibility to lyssavirus infection with MmBr being considerably less susceptible than the other cell lines. Further investigation demonstrated a strong activation of interferon mediated antiviral response in MmBr contributing to its resistance. The pattern recognition receptors: RIG-I and MDA5 were highly up-regulated during rabies virus infection in MmBr, suggesting their involvement in promotion of antiviral responses. The presence of CD14 and CD68 in MmBr suggested MmBr cells are microglia-like cells which play a key role in host defense against infections in the central nervous system (CNS). Thus the expression pattern of MmBr combined with the observed limitation of lyssavirus replication underpin a protective mechanism of the CNS controlling the lyssavirus infection. Overall, the established cell lines are important tools to analyze antiviral innate immunity in M. myotis against neurotropic virus infections and present a valuable tool for a

  16. MITRA Virtual laboratory for operative application of satellite time series for land degradation risk estimation

    Science.gov (United States)

    Nole, Gabriele; Scorza, Francesco; Lanorte, Antonio; Manzi, Teresa; Lasaponara, Rosa

    2015-04-01

    Geoinformation 2441-446 2. G Calamita, A Lanorte, R Lasaponara, B Murgante, G Nole 2013 Analyzing urban sprawl applying spatial autocorrelation techniques to multi-temporal satellite data. Urban and Regional Data Management: UDMS Annual 2013, 161 3. R Lasaponara 2013 Geospatial analysis from space: Advanced approaches for data processing, information extraction and interpretation International Journal of Applied Earth Observations and Geoinformation 20 . 1-3 4. R Lasaponara, A Lanorte 2011 Satellite time-series analysis International Journal of Remote Sensing 33 (15), 4649-4652 5. G Nolè, M Danese, B Murgante, R Lasaponara, A Lanorte Using spatial autocorrelation techniques and multi-temporal satellite data for analyzing urban sprawl Computational Science and Its Applications-ICCSA 2012, 512-527

  17. Analyse de la dégradation thermique du Poly(éther éther cétone)

    Science.gov (United States)

    Courvoisier, Emilie; Bicaba, Yoann; Colin, Xavier

    2018-03-01

    La dégradation thermique du PEEK a été étudiée à l'état caoutchoutique dans de larges intervalles de température (entre 180 et 320 °C) et de pression partielle d'oxygène (entre 0,21 et 50 bars). Tout d'abord, les mécanismes de vieillissement thermique ont été analysés et élucidés par spectroscopie IRTF et par calorimétrie différentielle (DSC) sur des films de PEEK suffisamment minces (entre 10 et 60 μm d'épaisseur) pour s'affranchir totalement des effets de la diffusion d'oxygène. L'oxydation se produit sur les cycles aromatiques provoquant la croissance de cinq nouvelles bandes d'absorption IR centrées à 3650, 3525, 1780, 1740 et 1718 cm-1 et attribuées aux vibrations d'élongation des liaisons O-H du phénol et de l'acide benzoïque, et des liaisons C-O de l'anhydride benzoïque, du benzoate de phényle et de la fluorénone respectivement. De plus, l'oxydation conduit à une large prédominance de la réticulation sur les coupures de chaîne (augmentation de Tg) empêchant le recuit du PEEK, en particulier lorsque la température d'exposition est supérieure au pied du pic de fusion. Enfin, les conséquences de l'oxydation sur les propriétés élastiques ont été analysées et élucidées par micro-indentation sur des sections droites préalablement polies de plaquettes de PEEK de 3 mm d'épaisseur. Les variations du module d'Young et du taux de cristallinité se corrèlent parfaitement, vérifiant ainsi la relation de Tobolsky.

  18. Analisis Kelayakan Finansial Usaha Budidaya Bambu

    Directory of Open Access Journals (Sweden)

    Husnul Khotimah

    2015-12-01

    Full Text Available Budidaya bambu diperlukan untuk menambah populasi bambu yang cenderung berkurang yang disebabkan oleh beralihnya fungsi lahan yang digunakan untuk pemukiman atau diganti dengan komoditi tanaman lain yang dianggap lebih menguntungkan. Sementara itu kebutuhan bahan baku bambu terus meningkat sejalan dengan pertumbuhan penduduk dan perkembangan kemajuan ilmu pengetahuan. Budidaya bambu bermanfaat selain untuk menjaga ketersediaan suplai juga untuk meningkatkan kualitas bambu untuk memenuhi permintaan pasar. Tulisan ini mengkaji analisis finansial dari penanaman bambu. Kajian finansial dibutuhkan untuk menunjukkan bahwa upaya penanaman atau budidaya bambu ini layak atau tidak secara finansial untuk dilakukan. Data yang digunakan adalah data hasil penelitian di perusahaan perkebunan bambu PT XYZ di Lampung. Hasil penelitian menunjukkan bahwa nilai NPV (Rp 36.644.364,08 lebih besar dari nol, Net B/C (2,56 lebih besar dari satu, IRR (11 % lebih besar dari suku bunga 6 %, serta payback period pada tahun ke-9 umur proyek 15 tahun. Berdasarkan kriteria indikator kelayakan finansial dapat disimpulkan bahwa usaha budidaya bambu layak secara finansial untuk diusahakan. Katakunci: Hasil Hutan Bukan Kayu (HHBK, budidaya bambu, studi kelayakan, analisis finansial   Financial analysis and feasibity study of bamboo cultivation  Abstract Bamboo cultivation is necessary to increase the population of bamboo clumps. The bamboo clumps tend to decrease due to the shift of used lands for residential or replaced by other crop comodities, which are considered more profitable. On the other hand, the need of bamboo for raw materials remain increase in line with population growth and the development of science. The important of the bamboo cultivation are to maintain the availability of its supply and to improve the quality of bamboo, which meet the market demands. This paper examined financial analysis of bamboo cultivation. Financial study was necessary to show whether

  19. Évaluation de l’activité hémostatique in vitro de l’extrait aqueux des feuilles de Marrubium vulgare L.

    Directory of Open Access Journals (Sweden)

    Nabil GHEDADBA

    2016-05-01

    Full Text Available L'objectif de cette étude est d’évaluer in vitro l’activité hémostatique des métabolites secondaires des feuilles de Marrubium vulgare. L’analyse qualitative de l’extrait aqueux (EAQ par la chromatographie sur couche mince a révélé la présence de la quercétine, la rutine et le kaempférol. La quantification des phénols totaux par la méthode de Folin Ciocalteu et des flavonoïdes par la méthode AlCl3 a donné des valeurs élevées avec l’EAQ : 175 ± 0,80 mg EAG/100g de MS, 23,86 ± 0,36 mg EQ/100g de MS. De plus, le dosage des tanins condensés par la méthode de la vanilline a montré que l’EAQ contient la valeur la plus élevée : 16,55 ± 0,03 mg E-Catéchine/100g de MS. L’évaluation de l’activité hémostatique par la méthode de recalcification du plasma décalcifié nous a permis de découvrir l’effet anticoagulant de l’EAQ lyophilisé des feuilles de M. vulgare. Une corrélation linéaire positive entre les deux paramètres étudiés (la teneur en tanins condensés et l’activité hémostatique (r = 0,96 ont permis de mettre en évidence un rôle probable de ces composés qui sont des vaso-constricteurs puissants dans l’activité hémostatique.

  20. POSIBILIDADES DE UTILIZACIÓN DE LA GEOLOCALIZACIÓN Y REALIDAD AUMENTADA EN EL ÁMBITO EDUCATIVO

    Directory of Open Access Journals (Sweden)

    Javier Fombona Cadavieco

    2017-01-01

    Full Text Available La reciente implantación de las tecnologías portátiles digitales en la socie - dad, y especialmente entre los jóvenes, supone un desafío para los docentes, y podría ser una oportunidad para obtener un mayor aprovechamiento acadé - mico. Este artículo presenta una investigación sobre el uso educativo de apli - caciones de Geolocalización y Realidad Aumentada con dispositivos digitales móviles en niveles de Enseñanza Secundaria, Bachillerato y Formación Profe - sional. Se trata de una investigación para averiguar si es posible emplear estos recursos en los dispositivos móviles del alumnado para obtener un beneficio y mejora educativa. El trabajo se inicia con una revisión de estos desarrollos tec - nológicos desde una dimensión formativa. A continuación se realiza un macro estudio descriptivo y cuantitativo entre 1832 alumnos en el que analizamos el tipo de dispositivos que poseen; para posteriormente analizar la opinión del profesorado sobre la funcionalidad y utilidad didáctica de estos desarrollos. Los resultados clarifican la tipología y penetración de los dispositivos entre los tres niveles educativos analizados, y los datos apuntan la posibilidad de imple - mentar estas tecnologías ya que sus equipos disponen de sistemas operativos avanzados y hardware GPS apropiado. Desde la perspectiva docente se pueden superar las reticencias a su uso con la incorporación inicial en tareas fuera del centro y en actividades no presenciales. Junto a las características de desloca - lización espacio/temporal propias del m-learning, surgen rasgos innovadores en la metodología educativa derivados de estrategias que impulsan las rela - ciones colaborativas, no competitivas. La Realidad Aumentada aparece como elemento con alto poder motivador en las tareas, abre puertas a la exploración autónoma, no lineal, de mundos virtuales que incorporan actualmente un ele - vado componente sorpresivo para el usuario. Por otro lado la

  1. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1995-07-01

    -Idsa E. Alegría Ortega, Francine Jácome, Diversidad cultural y tensión regional: América Latina y el Caribe. Caracas: Nueva Sociedad, 1993. 143 pp. -Barbara L. Solow, Ira Berlin ,Cultivation and culture: Labor and the shaping of slave life in the Americas. Charlottesville: University Press of Virginia, 1993. viii + 388 pp., Philip D. Morgan (eds -Andrew J. O'Shaughnessy, Karen Ordahl Kupperman, Providence Island, 1630-1641: The other puritan colony. Cambridge: Cambridge University Press, 1993. xiii + 393 pp. -Armando Lampe, Johannes Meier, Die Anfänge der Kirche auf den Karibischen Inseln: Die Geschichte der Bistümer Santo Domingo, Concepción de la Vega, San Juan de Puerto Rico und Santiago de Cuba von ihrer Entstehung (1511/22 bis zur Mitte des 17. Jahrhunderts. Immensee: Neue Zeitschrift für Missionswissenschaft, 1991. xxxiii + 313 pp. -Edward L. Cox, Carl C. Campbell, Cedulants and capitulants; The politics of the coloured opposition in the slave society of Trinidad, 1783-1838. Port of Spain, Trinidad: Paria Publishing, 1992. xv + 429 pp. -Thomas J. Spinner, Jr., Basdeo Mangru, Indenture and abolition: Sacrifice and survival on the Guyanese sugar plantations. Toronto: TSAR, 1993. xiii + 146 pp. -Rosemarijn Hoefte, Lila Gobardhan-Rambocus ,Immigratie en ontwikkeling: Emancipatie van contractanten. Paramaribo: Anton de Kom Universiteit, 1993. 262 pp., Maurits S. Hassankhan (eds -Juan A. Giusti-Cordero, Teresita Martínez-Vergne, Capitalism in colonial Puerto Rico: Central San Vicente in the late nineteenth century. Gainesville: University Press of Florida, 1992. 189 pp. -Jean Pierre Sainton, Henriette Levillain, La Guadeloupe 1875 -1914: Les soubresauts d'une société pluriethnique ou les ambiguïtés de l'assimilation. Paris: Autrement, 1994. 241 pp. -Michèle Baj Strobel, Solange Contour, Fort de France au début du siècle. Paris: L'Harmattan, 1994. 224 pp. -Betty Wood, Robert J. Stewart, Religion and society in post-emancipation Jamaica. Knoxville

  2. Effects of elevated CO2 on forest soil CH4 consumption in Changbai Mountains%CO2浓度增加对长白山森林土壤甲烷氧化影响

    Institute of Scientific and Technical Information of China (English)

    关键; 张颖; 史荣久; 李慧; 韩斯琴; 徐慧

    2012-01-01

    Elevated atmospheric CO2 concentration may affect the oxidation rate of methane ( CH4) in forest soil. In this study, the effects of a 6-year exposure to elevated CO2 concentration (500 μnol · mol-1 ) on the soil microbial process of CH4 oxidation under Quercus mongolica seedlings were investigated with open top chamber (OTC) , and specific 16S rRNA and pmoA gene fragment primers were adopted to analyze the diversity and abundance of soil methanotrophs. Comparing with that under ambient CO2 and open-air, the soil methane consumption under elevated atmospheric CO2 during growth season was reduced by 4% and 22% , respectively. The specific 16S rRNA PCR-DGGE analysis showed that under elevated CO2, the community structure of methane-oxidizing bacteria ( MOB) changed, and the diversity index decreased. Elevated CO2 concentration had no distinct effects on the abundance of Type Ⅰ MOB, but decreased the amount of Type Ⅱ MOB significantly. The pmoA gene copy number under elevated CO2 concentration decreased by 15% and 46% , respectively, as compared with that under ambient CO2 and open-air. Our results suggested that elevated atmospheric CO2 decreased the abundance and activity of soil methanotrophs, and the main cause could be the increase of soil moisture content.%大气CO2浓度升高可能对森林土壤的甲烷(CH4)氧化速率产生影响.本文采用开顶箱技术,对连续6年高浓度CO2(500 μmol·mol-1)处理的长白山森林典型树种蒙古栎树下土壤CH4氧化速率进行研究,并利用CH4氧化菌的16S rRNA特异性引物以及CH4单加氧酶功能基因引物分析了土壤中CH4氧化菌的群落结构与数量.结果表明:CO2浓度增高后,生长季土壤甲烷氧化量与对照和裸地相比分别降低了4%和22%;基于16S rRNA特异性引物的DGGE分析表明,CO2浓度增高导致两类甲烷氧化菌的多样性指数降低;CO2浓度增高对土壤中Ⅰ类甲烷氧化菌数量无显著影响,而使土壤中Ⅱ类甲烷氧

  3. 醇类-汽油混合燃料的喷雾特性%Spray Characteristics of Various Alcohol-Gasoline Blends

    Institute of Scientific and Technical Information of China (English)

    何邦全; 都成君

    2012-01-01

    The spray characteristics and fuel injection rate of a multi-hole injector of a direct injection gasoline engine were investigated on test benches when the alcohol-gasoline blends containing 10% and 30% volume fraction of etha-nol, 10% and 30% volume fraction of n-butanol and their base gasoline were used, respectively. The results show that, with the increase of injection pressure, the transient fuel injection rates of alcohol-gasoline blends increase, and their variations are dependent on the fuels tested. In the meantime, spray penetration of various fuels increases with injection pressure, and the differences of individual spray image at the same time in a single injection increase. The spray penetration of alcohol-gasoline blends is close to that of gasoline at high ambient pressure. The spray cone angles of different fuels after the initial stage of injection are much affected by ambient pressure in the constant chamber. At low ambient pressure, the spray cone angles of gasoline are greater than those of alcohol-gasoline blends. On the contrary, at high ambient pressure, the spray cone angles of alcohol-gasoline blends are bigger than those of gasoline except the case in which the blends containing 30% volume fraction of ethanol are used.%在试验台上,研究了使用汽油醇类混合燃料,其中醇类燃料体积分数分别为10%的乙醇-汽油、30%的乙醇-汽油、10%的正丁醇-汽油和30%的正丁醇-汽油时,直喷汽油机多孔喷油器的喷油率和喷雾特性.结果表明,随着喷油压力的提高,醇类-汽油混合燃料的瞬时喷油率增大,且瞬时喷油率波动性依赖于燃料.同时,喷油压力的提高使得喷雾贯穿距离加大,单次喷油后同一时刻的喷雾差异性变大.在高背压,相同喷油压力下醇类-汽油混合燃料的贯穿距离与汽油接近.背压大小对不同燃料喷油初期的喷雾锥角影响较大.低背压时,汽油的喷雾锥角高于醇类-汽油混

  4. HUBUNGAN PANJANG BADAN LAHIR TERHADAP PERKEMBANGAN ANAK USIA 12 BULAN

    Directory of Open Access Journals (Sweden)

    Fitrah Ernawati

    2015-04-01

    diolah adalah data panjang badan, umur dan tingkat perkembangan. Data stunting didapatkan berdasarkan z-skor tinggi badan terhadap umur, sedangkan data perkembangan anak didapatkan mengguankan Bailey’s Test III. Analisis data menggunakan uji korelasi Spearman. Hasil penelitian menunjukkan sebanyak 9,5 persen bayi dengan berat badan lahir rendah (BBLR dan 22 persen stunting. Nilai z-skor panjang badan terhadap umur pada bayi baru lahir berkolerasi dengan perkembangan motorik dan sosial emosi sejak bayi berumur nol bulan, yaitu rho=0,33; p=0,004 untuk motorik dan rho=0,244 dengan p=0,036 untuk sosial emosi. Sedangkan korelasi terhadap perkembangan bahasa baru tampak pada saat bayi berumur satu bulan yaitu rho=0,29 dengan p=0,031 dan korelasi terhadap perkembangan kognitif terjadi pada usia dua bulan rho=0,318 dengan p=0,011. Pada anak lahir stunting median perkembangan bahasa lebih rendah dibandingkan kelompok yang normal. [Penel Gizi Makan 2014, 37(2: 109-118]Kata kunci : stunting, status gizi, perkembangan anak

  5. Applying Support Vector Machine in classifying satellite images for the assessment of urban sprawl

    Science.gov (United States)

    murgante, Beniamino; Nolè, Gabriele; Lasaponara, Rosa; Lanorte, Antonio; Calamita, Giuseppe

    2013-04-01

    , in south eastern Italy (Puglia region). Bari, one of the major cities of southern Italy, is characterized by a considerable urban sprawl. The analysis is focused on a rectangular shaped region covering the urban area of three different cities, namely Polignano a Mare and Monopoli (and Conversano minority part) which, in 2011, had a population density comprised in the range of 140-319 people per Km2(istat ). The area of interest has a surface of approximately 253 Km2 , is characterized by three urban areas (Polignano a Mare, Conversano and Monopoli) and has a coastline of almost 17 Km. References Lanorte, A., Danese M., Lasaponara R., Murgante B. (2011) "Multiscale mapping of burn area and severity using multisensor satellite data and spatial autocorrelation analysis" International Journal of Applied Earth Observation and Geoinformation, Elsevier, doi:10.1016/j.jag.2011.09.005 Murgante B. Danese M. (2011) "Urban versus Rural: the decrease of agricultural areas and the development of urban zones analyzed with spatial statistics" Special Issue on "Environmental and agricultural data processing for water and territory management" International Journal of Agricultural and Environmental Information Systems (IJAEIS) volume 2(2) pp. 16-28 IGI Global, ISSN 1947-3192, DOI: 10.4018/jaeis.2011070102. Murgante, B., Las Casas, G., Danese, M., (2012), "Analyzing Neighbourhoods Suitable for Urban Renewal Programs with Autocorrelation Techniques" In Burian J. (Eds.) "Advances in Spatial Planning" InTech - Open Access DOI: 10.5772/33747 ISBN:978-953-51-0377-6 Nolè G., Danese M., Murgante B., Lasaponara R., Lanorte, A., (2012) "Using Spatial Autocorrelation Techniques and Multi-temporal Satellite Data for Analyzing Urban Sprawl" Lecture Notes in Computer Science vol. 7335, pp. 512-527. Springer-Verlag, Berlin. ISSN: 0302-9743, doi: 10.1007/978-3-642-31137-6_39

  6. 正交设计优选鼻炎灵胶囊的提取工艺%Optimization for the Extraction of Biyanling Capsules with Orthogonal Design

    Institute of Scientific and Technical Information of China (English)

    陆萍; 谭兴起; 郭良君; 倪东杰; 韦庆

    2012-01-01

    目的 用正交试验优选鼻炎灵胶囊的最佳提取工艺条件.方法 以绿原酸为研究指标,对鼻炎灵胶囊的质量控制方法进行了研究,确定合理的提取工艺.采用正交设计法,考察提取次数、加水量、提取时间对鼻炎灵胶囊中绿原酸的含量的影响.用高效液相法测定绿原酸含量,Symmetry C18色谱柱(3.9 mm×150 mm,5 μm),以乙腈-0.4%磷酸(12:88)为流动相;检测波长为327 nm;流速:1.0 mL·min-1;理论塔板数按绿原酸峰计算应不得低于3000,分离度大于1.5.结果 鼻炎灵胶囊最佳提取工艺为中药材和水煎煮2次,第一次加12倍量水,煎煮2.0 h,第二次加10倍量水,煎煮1.5 h,绿原酸含量达10.7 mg·g-1.结论 该工艺简便易行,绿原酸提取率高,稳定性好.%Objective To opiimize the exlraclion process of biyanling capsules with orthogonal Lesl. Methods The chlorogenic acid was Laken as the indicator Lo sludy the quality conlrol of biyanling capsules and delermine the ralional exlraclion process. The orthogonal design was adopled Lo invesligale the impacls of the exlraclion frequency, waler adding amounl and the exlraclion lime on the conlenl of chlorogenic acid in biyanling capsules. HPLC ( high performance liquid chromalography) was used lo delermine the conlenl of chlorogenic acid,in which,color column; Symmetry C18(3. 9 mm × 150 mm,5 μm) ; mobile phase: aceloni-trile -0.4% phosphoric acid(12: 88) ;wavelength;327 nm;flow rale:l mL · Min-1 ; the number of theoreli-cal plales according lo the peak of chlorogenic acid:nol less than 3000;resolution;larger than 1.5. Results The best exlraclion process of biyanling capsules; waler decoding Iwice for herbal malerials, adding waler of 12 limes in the first decoclion for 2. 0 h;adding waler of 10 limes for the second decoclion for 1. 5 h. The conlenl of chlorogenic acid reached 10. 7 mg · G-1. Conclusion The process is sample in operalion and ensures the high exlraclion and slable properly of

  7. NMR and molecular modeling: application to wine ageing

    Science.gov (United States)

    Saucier, C.; Pianet, I.; Laguerre, M.; Glories, Y.

    1998-02-01

    Red wine contains polyphenols called tannins which are very important for its taste and longevity. These polymers consist in repeating units of catechin and its epimer epicatechin. During ageing, slow condensation reactions take place which lead to new chemical structures. Among the possible reactions, we have focused our attention on acetaldehyde cross-linking. Catechin was used as a model for the production of polymers with acetaldehyde. Two reaction product fractions have been isolated by liquid chromatography. Mass measurement indicated that these fractions contain dimers. NMR (1D and 2D) and molecular modelling were then used to study the structure and conformations of these products. The first product consist in a pure dimer with the two catechin moieties connected with an ethyl bridge on the carbon 6 and 8. The second fraction was a mixture of two dimers (50/50). NMR measurements showed that it could be two symmetrical dimers involving the same carbon for each catechin moiety (6 or8). Le vin rouge contient des polyphénols appelés tanins qui sont très importants pour son goût et sa longévité. Il s'agit principalement de polymères de catéchine et d'épicatéchine. Durant le vieillissement du vin, des réactions de condensation interviennent lentement et conduisent à de nouvelles structures. Parmi les réactions possibles, nous avons plus spécialement étudié la polymérisation par pontage avec l'éthanal. La catéchine a été utilisée comme modèle de tannin et mise en présence d'éthanal en milieu acide proche du vin. Deux fractions de produits de réaction ont été isolées par chromatographie liquide. La spectrométrie de masse a révélé la présence de dimères. La RMN (1D et 2D) et la modélisation moléculaire ont ensuite été utilisées pour déterminer la structure et la conformation de ces produits. La première fraction a été identifiée comme étant un dimère de deux unités catéchines reliées par un pont éthyle par leur

  8. Tratamento de sementes com fungicidas relacionado com o controle de patógenos e rendimento de milho Seed treatment with fungicides related to the control of pathogens and corn yield

    Directory of Open Access Journals (Sweden)

    Wilmar Cório da Luz

    1998-12-01

    Full Text Available Os experimentos de milho foram realizados em la boratório; em casa de vegetação e a campo, em Passo Fundo, Rio Grande do Sul, sob presença natural de patógenos, nos anos de 1994 e 1995. Os híbridos usados foram: Braskaib XL 561 em 1994 e Braskaib XL 330 em 1995. Os tratamentos com diferentes concentrações de ingrediente ativo, formulações e doses para 100kg de sementes foram: testemunha; thiram 60 P + iprodione 20 P (150 + 50g; thiram 35 PM + carboxin 35 PM + metalaxyl 35 PM (150 + 700 + 100g, em 1994, e (thiram + carboxin 20 SC (200ml + metalaxyl 35 PM (100g em 1995; thiram 35 PM + carboxin 35 PM (100 + 100g, em 1994 e (thiram + carboxin 20 SC (200ml em 1995; thiram 70 P (150g; imawlil 5 L (150ml; captem 75 P + thiabendawle 10 P (150 + 100g: triadimenol 25 P (160g; captan 75 PM (150g e metalaxyl 35 PM (100g, em 1994 e (50g, em 1995. Os fungicidas foram aplicados misturan do-se cada produto com 250g de sementes dentro de um saco de plástico e agitando-o manualmente por cinco minutos. Todos os tratamentos químicos apresentaram eficiência no controle de Fusarium moniliforme, entretanto metalaxyl e captan em geral foram menos eficientes. Com exceção de metalaxyl, todos os produtos químicos controlaram Cephalosporium acremonium spp. Captan foi menos eficiente que os tratamentos que apresentaram controle em 1994 e apresentou eficiência semelhante a triadime nol e captan + thiabendawle para este fungo, em 1995. Todos os tratamentos, exceto o metalaxyl e o captan (em 1995, no campo aumentaram a emergência das plantas. Thiran e suas misturas também promoveram melhor controle de Penicillium spp. e de Aspergilius spp. e proporcionaram aumentos de rendimento de 13,5% a 14,8% em 1994 e 9,8% a 13,5% em 1995.Experiments were conducted in laboratory, green house and in the field in Passo Fundo, State of Rio Grande do Sul, Braül, under natural presence of pathogens. Com hybrids used were: Braskaib XL 561, and Braskaib XL 330 in 1994 and 1995

  9. Using Open data in analyzing urban growth: urban density and change detection

    Science.gov (United States)

    murgante, Beniamino; Nolè, Gabriele; Lasaponara, Rosa; Lanorte, Antonio

    2013-04-01

    input point data (vector), a density continuous raster as an output. In this case, the intensity of phenomenon will be given by buildings volume. References • Bailey T. C., Gatrell A. C. (1995). Interactive spatial data analysis. Prentice Hall. • Danese M., Lazzari M., Murgante B. (2009). "Geostatistics in Historical Macroseismic Data Analysis" Transactions on Computational Sciences VI, LNCS Vol. 5730, pp. 324-341, Springer-Verlag, Berlin ISSN: 1611-3349, doi:10.1007/978-3-642-10649-1_19 • Nolè G., Danese M., Murgante B., Lasaponara R., Lanorte, A., (2012) "Using Spatial Autocorrelation Techniques and Multi-temporal Satellite Data for Analyzing Urban Sprawl" Lecture Notes in Computer Science vol. 7335, pp. 512-527. Springer-Verlag, Berlin. ISSN: 0302-9743, doi: 10.1007/978-3-642-31137-6_39 • Murgante, B., Las Casas, G., Danese, M., (2012), "Analyzing Neighbourhoods Suitable for Urban Renewal Programs with Autocorrelation Techniques" In Burian J. (Eds.) "Advances in Spatial Planning" InTech — Open Access DOI: 10.5772/33747 ISBN:978-953-51-0377-6 • Lanorte, A., Danese M., Lasaponara R., Murgante B. (2011) "Multiscale mapping of burn area and severity using multisensor satellite data and spatial autocorrelation analysis" International Journal of Applied Earth Observation and Geoinformation, Elsevier, doi:10.1016/j.jag.2011.09.005 • O'Sullivan D., Unwin D., (2002). Geographic Information Analysis. John Wiley & Sons • Yang, X., Lo, C. P.: Using a time series of satellite imagery to detect land use and land cover changes in the Atlanta, Georgia metropolitan area. Int. J. Rem. Sensing 23, pp. 1775--1798 (2002) • Yuan, F., Sawaya, K.,.Loeffelholz, B. C., Bauer, M. E.: Land cover classification and change analysis of the Twin Cities (Minnesota) Metropolitan Area by multitemporal Landsat remote sensing. Rem. Sensing Environ. 98, pp. 317--328 (2005)

  10. ISOLOK VALVE ACCEPTANCE TESTING FOR DWPF SME SAMPLING PROCESS

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, T.; Hera, K.; Coleman, C.; Jones, M.; Wiedenman, B.

    2011-12-05

    the two locations were compared to determine if the contents of the tank were well mixed. The Coliwasa sampler is a tube with a stopper at the bottom and is designed to obtain grab samples from specific locations within the drum contents. A position paper (4) was issued to address the prototypic flow loop issues and simulant selections. A statistically designed plan (5) was issued to address the total number of samples each sampler needed to pull, to provide the random order in which samples were pulled and to group samples for elemental analysis. The TTR required that the Isolok sampler perform as well as the Hydragard sampler during these tests to ensure the acceptability of the Isolok sampler for use in the DWPF sampling cells. Procedure No.L9.4-5015 was used to document the sample parameters and process steps. Completed procedures are located in R&D Engineering job folder 23269.

  11. Caracterización preliminar de la "comunidad" de reptiles de un sector de la Serranía del Perijá, Colombia

    Directory of Open Access Journals (Sweden)

    Hernández Ruz José

    2001-12-01

    community of the Serranía del Perijá is more related to the Caribbean and Andean faunas than to the Chocoan and Arnazonian. There were no differences among the flanks colombiano y venezolano of the Serranía del Perijá. In this paper, nine species are added to the fauna ofreptiles ofthe area: six of saurian, A tneiva bifrontata, Ano! is auratus, A nol is apoll inaris, Leposoma rugiceps, Stenocercus erythrogaster and Lepidoblepharis sp. and three of snakes Chironius monticola, Rhadinaeafulviceps, Stenorrhina degenardtii.

  12. Environmentally Benign Stab Detonators

    Energy Technology Data Exchange (ETDEWEB)

    Gash, A E

    2006-07-07

    implementation of energetic sol-gel coated metallic multilayers, as new small IIDs will result in dramatically reduced environmental risks and improved worker and user safety risks without any sacrifice in the performance of the device. The proposed effort is designed to field an IID that is free of toxic (e.g., tetrazene) and heavy metal constituents (e.g., lead styphnate, lead azide, barium nitrate, and antimony sulfides) present in the NOL-130 initiating mixture and in the lead azide transfer charge of current stab detonators. The preferred materials for this project are nanocomposites consisting of thin foils of metallic multilayers, composed of nanometer thick regions of different metals, coated with a sol-gel derived energetic material. The favored metals for the multilayers will be main-group and early transition metals such as, but not limited to, boron, aluminum, silicon, titanium, zirconium, and nickel. Candidate sol-gel energetic materials include iron (III) oxide/aluminum nanocomposites. It should be noted that more traditional materials than sol-gel might also be used with the flash metals. The metallic multilayers undergo an exothermic transition to a more stable intermetallic alloy with the appropriate mechanical or thermal stimulus. This exothermic transition has sufficient output energy to initiate the more energy dense sol-gel energetic material, or other candidate materials. All of the proposed initiation mix materials and their reaction by products have low toxicity, are safe to handle and dispose of, and provide much less environmental and health concerns than the current composition. We anticipate that the technology and materials proposed here will be produced successfully in production scale with very competitive costs with existing IIDs, when amortized over the production lifetime. The sol-gel process is well known and used extensively in industry for coatings applications. All of the proposed feedstock components are mass-produced and have relatively

  13. PEMODELAN PERSAMAAN NEWTON-EULER PADA PENGEMBANGAN PROSTHETIC TANGAN KOSMETIK DALAM MENENTUKAN BESARNYA DAYA PADA SISTEM KABEL EXTERNAL

    Directory of Open Access Journals (Sweden)

    Lobes Herdiman

    2012-01-01

    Full Text Available Pengembangan  komponen telapak tangan prosthetic terdiri dari metacarpal, metacarpal pollicis, dan jari tangan. Bahan yang digunakan yaitu nylon, jumlah komponen sebanyak 87 dan berat 175 gram. Kemampuan ibu jari dan jari telunjuk memegang peranan penting dalam melakukan 6 model gerakan. Posisi ujung phalanx media-distalis ibu jari dan jari telunjuk bertemu pada satu titik, sehingga mampu melakukan gerakan dasar tangan. Pengujian dengan eksperimen empiris pada pengembangan prosthetic tangan kosmetik dilakukan untuk mengetahui rotasi dari titik koordinat pada sendi pada saat aktivitas pemegangan. Sumbu koordinat ruang dan sistem dimana sumbu x, y, dan z, dengan titik nol ditetapkan pada pangkal poros utama. Model mekanisme prosthetic tangan kosmetik dengan sistem penarikan pada kendali kabel eksternal. Pengukuran tekanan pada ibu jari dengan jari telunjuk sebesar 493 gram yang dilakukan dengan alat dial indicator, pengukuran tekanan ibu jari dengan jari tengah sebesar 487 gram. Pengujian beban tarikan kabel untuk membuka jari menjadi terbuka penuh sebesar 4.291 gram dengan alat force gauge. Persamaan Newton-Euler menghasilkan besarnya torsi melalui persamaan forward (maju dan backward (mundur. Rotasi matriks yang disimbolkan xRx+1, dengan x adalah titik mulai dan x+1 adalah titik tujuan. Titik koordinat pada tiap ruas sebagai degree of freedom pada tiga titik, yaitu titik 0, titik 1, dan titik 2. Perhitungan matriks rotasi menggunakan titik awal (origin dan titik tujuan (destination. Titik 0 jari ditentukan pada sendi metacarpophalangeal, titik 1 pada sendi interphalangeal proximalis, dan titik 2 pada ujung komponen phalanx media-distalis sebagai end effector dimana ω0 = v0 = 0 dan gravitasi g = 9,8062 m/s2. Besarnya torsi maksimal dicapai pada gerakan spherical sebesar 10,00449 N.m, dengan mengkonversikan besaran torsi ke daya maka dicapai sebesar untuk gerakan spherical sebesar 12,5046 watt, dan daya terkecil pada gerakan lateral dan tip

  14. Epuration des eaux usées de raffinerie par le procédé biologique des lits bactériens. Problèmes pratiques de l'exploitation Purifying Refinery Waste Water by the Bacterial Bed Biological Process. Practical Operational Problems

    Directory of Open Access Journals (Sweden)

    Leising M.

    2006-11-01

    Full Text Available Le traitement des eaux de raffinerie par le procédé des Iits bactériens constitue une solution intéressante. Néanmoins, il subsiste actuellement des problèmes pratiques d'exploitation, en particulier la tendance au colmatage des lits bactériens existants qui résulte d'un encrassement incontrôlé des garnissages en vrac. Après étude, il est confirmé que les hydrocarbures, les matières en suspension contenus dans l'effluent et une mauvaise évacuation de la biomasse sont à l'origine du problème. L'examen des possibilités de lutte contre ce phénomène permet de distinguer des mesures curatives et des mesure préventives. Les mesures curatives qui consistent à régénérer le garnissage par augmentation de la charge hydraulique, nettoyage chimique, ou nettoyage manuel ne donnent pas entière satisfaction. Parmi tes mesures préventives, l'une des méthodes consiset à réduire la charge polluante de l'effluent : les eaux usées phénolées sont dessalées, les eaux de désulfuration du gas oil (DGO et fluid cracking catalytic (FCC sont strippées, les soudes sont réinjectées dans le brut, les huiles récupérées juste en aval de leur rejet, les traitements primaires sont optimisés, notamment par installation de racleurs et de tambours oléophiles sur les séparateurs API et par un meilleur choix de floculants. Néanmoins, l'expérience montre que cette méthode ne permet que de retarder l'échéance du colmatage. Le meilleur moyen de lutte réside dans le choix du matériau de garnissage, ainsi que le montrent les essais pilotes comparatifs réalisés par l'Institut National de Recherche Chimique Appliquée (lRCHA et Compagnie Française de Raffinage (CFR. Ces essais, qui ont portés sur l'évolution de la densité du garnissage, les performances épuratoires et la qualité des boues montrent que le Cloisonyle, garnissage tubulaire, est probablement le matériau le mieux adapté. Refinery waste-water treatment by trickling

  15. Influence of Low Molecular Weight Polymers on the Rheology of Bentonite Suspensions Influence de polymères de faible masse moléculaire sur la rhéologie de suspensions de bentonite

    Directory of Open Access Journals (Sweden)

    Rossi S.

    2006-12-01

    oxyde de polypropylène -oxyde de polyéthylène nonylphénol avec longueur de chaîne EO variable et une série composée d'un copolymère à bloc ABA d'oxyde de polypropylène- oxyde de polyéthylène avec longueur de chaîne EO variable. Les isothermes d'adsorption de suspensions d'argile dilué ont montré une plus grande teneur en polymère de plus faible masse moléculaire (en µmol/m² dans chaque série. La quantité adsorbée augmente dans la proportion de NPE > PEO > PE. Les mesures de taux de rupture et contrainte de la rupture oscillatoire et de la rupture stabilisée des suspensions d'argile concentrée (3 à 6%/v facilitent l'interprétation des interactions de particule. Le seuil d'écoulement, la viscosité plastique et le module élastique ont montré un maximum pour une couverture superficielle de 50% environ par les polymères NPE, suivi d'une diminution provoquée par la stabilisation de la suspension. Dans le cas des polymères PE, ces paramètres ont diminué de manière continue au fur et à mesure du recouvrement de la particule d'argile. L'étalonnage du module élastique avec une teneur d'argile croissante permet de calculer l'exposant n à partir de la loi de puissance G' = kon qui donne une description qualitative du degré de dispersion des différents polymères. Les résultats préliminaires de l'effet de la température et de la pression sur les suspensions de bentonite et polymère sont également présentés.

  16. Development and Experimental Study of Phantoms for Mapping Skin Chromophores

    Directory of Open Access Journals (Sweden)

    Silapetere A.

    2014-06-01

    Full Text Available Mūsdienās multispektrālās attēlošanas iekārtas izmanto ādas parametru un fizioloģisko procesu aprakstīšanai gan pētniecības, gan diagnostikas nolūkiem. Iekārtu darbības uzlabošanai ir nepieciešams labāk saprast gaismas mijiedarbību ar audiem, kā arī veikt šo iekārtu kalibrēšanu ar ādas maketu. Redzamā un tuvā infrasarkanā optiskā diapazona spektroskopijā ir svarīgi ādas maketi, kas simulē audu slāņaino struktūru un ķīmiskās īpašības, kā arī maketi, kas ir bioloģiski līdzvērtīgi. Šajā pētījumā tika izveidots ādas makets no bioloģiskām un ķīmiski sintezētām struktūrām. Ādas maketa izveidei tika izmantota fibrīna matrica ar dermālo un epidermālo šūnu piejaukumu, lai imitētu ādas slāņaino struktūru. Fibrīna matrica tiek veidota no 0,47 ml asins plazmas, 0,4 ml fizioloģiskā šķīduma, 0,8 μl treneksāmskābes un 89,4 μl kalcija glukanāta. Izveidoto matricu ievieto šūnu inkubatorā, lai tā polimerizētos. Nākošais slānis tiek veidots ar dermālo šūnu piejaukumu (180-270 šūnas, un pēdējais fibrīna matriksa slānis tiek veidots ar epidermālo šūnu piejaukumu (270 šūnas un šūnu augšanu veicinošu serumu (FBS. Šūnu kultivēšanai nepieciešamas vismaz divas nedēļas. Šajā slāņainajā struktūrā ir iespējams pievienot ādas hromoforu simulējošus iekļāvumus. Optiskajā diapazonā no 450-900 nm ādas hromoforas, kurām ir visizteiktākais spektrs, ir bilirubīns, melanīns un hemoglobīns. Lai simulētu ādas hromoforu spektrālās īpašības, tika izmantots sintezēts bilirubīns, eritrocītu masa un nigrozīns. Lai izpētītu šī maketa iekārtu kalibrēšanas potenciālu, tika izveidoti 76 paraugi, kur katros 24 paraugos bija pievienots viens no absorbentiem ar dažādām koncentrācijām. Pilna ādas maketa audzēšanai nepieciešamas divas nedēļas, lai ātrāk tiktu iegūti pirmie rezultāti tika veidoti maketi bez dermālo un epiderm

  17. Journal Abstracts

    Directory of Open Access Journals (Sweden)

    Mete Korkut Gülmen

    1996-07-01

    kanına difüzyon daha azdı. Sol böbrek ve sol akciğer, sağ böbrek ve sağ akciğerden daha fazla etkilenmişti, aynısı sol ve sağ psoas kasları için de doğmdur. En az etkilenenler ise karaciğerin ön lobu ve akciğer apeksleridir. Bu olay karaciğerde ve vücut organlarından alınan kanlarda ilaç konsantrasyonlarını, sonuç olarakta karaciğer/kan ilaç oranlarını anlamlı olarak etkileyebilmektedir. Mideden postmortem ilaç difüzyonunıın etkilerini azaltmak için, örneklerin periferik kan damarlarından, bir ekstremitedeki iskelet kaslarından, karaciğer sağ lobunun derin bölgelerinden ve akciğerin tabanından çok apeklerinden alınması önerilmektedir. POSTMORTEM ETANOL ÜRETİMİ VE DEĞERLENDİRMEYİ ETKİLEYEN FAKTÖRLER Postmortem production of ethanol and factors that influence interpretation Pounder DJ, Cox DE, Kuroda N. Am J Forensic Med Pathol. 1996; 17(1: 8-20. Etanol incelemesi adli toksikoloji laboratuvarlarında en sık yapılan incelemedir. Postmortem etanol incelemesi sıklıkla postmortem etanol üretimi sebebi ile zorlaşmaktadır. Bir çok bakteri türleri, kültür mantarları ve küf mantarları çeşitli maddelerden etanol üretebilmektedir. Ölüm ve otopsi yapılması arasındaki süre ve saklama sıcaklığı arttıkça etanol sentezi olasılığı da artmaktadır. Postmortem alkol üretimi ve antemoıtem alkol aliminin ayırımı sıklıkla zor olmaktadır. Bu derlemede postmortem etanol sentezinin tanınma kriterleri ve postmortem etanol bulgularının yommlanmasında dikkate alınacak faktörler sunulmuştur. Kriterler olgu hikayesi, örneklerin saklama şartları, var olan mikrop tipleri, eta- nolün atipik sıvı ve doku dağılımı, etanol konsantrasyonu, diğer alkol ve uçucu maddelerin tespit edilmesidir. Elde edilebilen tüm bilgilerin dikkatlice değerlendirilmesi ile etanolün antemortem veya postmortem kaynaklı olduğunun geçerli bir yorumu yapılabilmektadir. KAPALI KAFA TRAVMASI SONUCUNDA GEL