10 CFR 1017.29 - Civil penalty.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Civil penalty. 1017.29 Section 1017.29 Energy DEPARTMENT... INFORMATION Violations § 1017.29 Civil penalty. Link to an amendment published at 74 FR 66033, Dec. 14, 2009... subject to a civil penalty under this part: (1) 10 CFR Part 1017—Identification and Protection of...
Quantitative analysis of energy metabolism in human muscle using SLOOP 31P-MR-spectroscopy
International Nuclear Information System (INIS)
Beer, M.; Koestler, H.; Buchner, S.; Sandstede, J.; Hahn, D.
2002-01-01
Objective: Energy metabolism is vital for regular muscle function. In humans, in vivo analysis using 31 P-MR-spectroscopy (MRS) is mostly restricted to semiquantitative parameters due to technical demands. We applied spatial localization with optimal pointspread function (SLOOP) for quantification in human skeletal and cardiac muscle. Subjects/Methods: 10 healthy volunteers and 4 patients with myotonic dystrophy type 1 were examined using a 1.5 T system (Magnetom VISION) and chemical shift imaging (CSI) for data collection. Concentrations of PCr, ATP and P i as well as PCr/ATP ratios were calculated by SLOOP. Results: Concentrations of PCr, ATP and P i were 29.9±3.4, 7.1±0.9 and 5.7±1.2 [mmol/kg] in normal skeletal muscle, corresponding to previously published studies. Two of the patients with a duration of disease longer than 10 years and a pronounced muscle weakness showed a significant decrease of PCr and ATP in skeletal muscle below 10 and 5 mmol/kg. One of these patients had an additional reduction of PCr in cardiac muscle. (orig.) [de
31 CFR 29.511 - Demand letters.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Demand letters. 29.511 Section 29.511... Overpayments § 29.511 Demand letters. Except as provided in § 29.516(e), before starting collection action to recover an overpayment, the Benefits Administrator must send a demand letter that informs the debtor in...
29 CFR 20.10 - Responsibilities of the Chief Financial Officer.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Responsibilities of the Chief Financial Officer. 20.10... to Credit Reporting Agencies § 20.10 Responsibilities of the Chief Financial Officer. The Chief... guidelines and instructions, which he or she may deem appropriate. The Chief Financial Officer shall also...
Bimodal MR-PET agent for quantitative pH imaging
Frullano, Luca; Catana, Ciprian; Benner, Thomas; Sherry, A. Dean; Caravan, Peter
2010-01-01
Activatable or “smart” magnetic resonance contrast agents have relaxivities that depend on environmental factors such as pH or enzymatic activity, but the MR signal depends on relaxivity and agent concentration – two unknowns. A bimodal approach, incorporating a positron emitter, solves this problem. Simultaneous positron emission tomography (PET) and MR imaging with the biomodal, pH-responsive MR-PET agent GdDOTA-4AMP-F allows direct determination of both concentration (PET) and T1 (MRI), and hence pH. PMID:20191650
7 CFR 29.1044 - Orange Red (FR).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Orange Red (FR). 29.1044 Section 29.1044 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Type 92) § 29.1044 Orange Red (FR). A yellowish red. [42 FR 21092, Apr. 25, 1977. Redesignated at 47 FR...
2010-09-03
... FEDERAL ENERGY REGULATORY COMMISSION 18 CFR Part 35 [Docket No. RM10-17-000] Demand Response... for determining when to compensate demand response providers and the allocation of costs associated with demand response. DATES: The technical conference will be held at the Federal Energy Regulatory...
Open Automated Demand Response Communications Specification (Version 1.0)
Energy Technology Data Exchange (ETDEWEB)
Piette, Mary Ann; Ghatikar, Girish; Kiliccote, Sila; Koch, Ed; Hennage, Dan; Palensky, Peter; McParland, Charles
2009-02-28
The development of the Open Automated Demand Response Communications Specification, also known as OpenADR or Open Auto-DR, began in 2002 following the California electricity crisis. The work has been carried out by the Demand Response Research Center (DRRC), which is managed by Lawrence Berkeley National Laboratory. This specification describes an open standards-based communications data model designed to facilitate sending and receiving demand response price and reliability signals from a utility or Independent System Operator to electric customers. OpenADR is one element of the Smart Grid information and communications technologies that are being developed to improve optimization between electric supply and demand. The intention of the open automated demand response communications data model is to provide interoperable signals to building and industrial control systems that are preprogrammed to take action based on a demand response signal, enabling a demand response event to be fully automated, with no manual intervention. The OpenADR specification is a flexible infrastructure to facilitate common information exchange between the utility or Independent System Operator and end-use participants. The concept of an open specification is intended to allow anyone to implement the signaling systems, the automation server or the automation clients.
7 CFR 29.3068 - Tannish-red color (FR).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Tannish-red color (FR). 29.3068 Section 29.3068 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... Type 93) § 29.3068 Tannish-red color (FR). A light red shaded toward tan. [24 FR 8771, Oct. 29, 1959...
Gamma spectroscopy of 33Cl and 29P fed in 32S(p,γ)33Cl and 28Si(p,γ)29P reactions
International Nuclear Information System (INIS)
Aleonard, M.-M.
1975-01-01
The properties of the levels of the A=4N+1 33 Cl and 29 P nuclei were studied via the 32 S(p,γ) 33 Cl and 28 Si(p,γ) 29 P reactions. Absolute and relative resonance strength measurements were performed in chlorine and phosphorus isotopes with 80cm 3 Ge(Li) detector and natural targets of sulfur or silicon compounds. Three new resonances were observed in the 32 S(p,γ) 33 Cl reaction at E(p)=1588, 1748 and 1880keV and a doublet clearly shown at E(p) approximately equal to 1900keV. The Q-value of the reaction, as well as the energies, γ-branching, and mean lifetimes of the levels below E(x)=4.78MeV were measured. The spins of the E(x)=2.35, 3.82, 3.97 and 4.78MeV levels were determined. A comparison of the γ-ray transition strengths is made against mirror transitions and shell-model or weak coupling model predictions, for positive and negative parity states. Resonance strengths and decays of 29 P levels populated via the 28 Si(p,γ) 29 P reaction were measured for E(p)=0.4 to 2.28MeV. Pecular attention was paid to the E(x)=3447 and 4642keV levels. Resonance strengths as well as γ-branching, mean lifetimes and angular distributions lead to the following characteristics: E(x)=3447keV, J(π)=7/2 - , tau=13+-(9)7fs; E(x)=4642keV, J(π)=3/2 + , 5/2-9/2, tau=52+-20fs. Comparison of the mirror levels characteristics in 29 Si and 29 P favours a J(π)=9/2 + assignment for the E(x)=4642keV level [fr
Pupillary Response to Cognitive Demand in Parkinson's Disease: A Pilot Study.
Kahya, Melike; Moon, Sanghee; Lyons, Kelly E; Pahwa, Rajesh; Akinwuntan, Abiodun E; Devos, Hannes
2018-01-01
Previous studies have shown that pupillary response, a physiological measure of cognitive workload, reflects cognitive demand in healthy younger and older adults. However, the relationship between cognitive workload and cognitive demand in Parkinson's disease (PD) remains unclear. The aim of this pilot study was to examine the pupillary response to cognitive demand in a letter-number sequencing (LNS) task between 16 non-demented individuals with PD (age, median (Q1-Q3): 68 (62-72); 10 males) and 10 control participants (age: 63 (59-67); 2 males), matched for age, education, and Montreal Cognitive Assessment (MOCA) scores. A mixed model analysis was employed to investigate cognitive workload changes as a result of incremental cognitive demand for both groups. As expected, no differences were found in cognitive scores on the LNS between groups. Cognitive workload, exemplified by greater pupil dilation, increased with incremental cognitive demand in both groups ( p = 0.003). No significant between-group ( p = 0.23) or interaction effects were found ( p = 0.45). In addition, individuals who achieved to complete the task at higher letter-number (LN) load responded differently to increased cognitive demand compared with those who completed at lower LN load ( p demand in non-demented people with PD and healthy controls. Further research is needed to investigate the pupillary response to incremental cognitive demand of PD patients with dementia compared to non-demented PD and healthy controls. Highlights -Pupillary response reflects cognitive demand in both non-demented people with PD and healthy controls-Although not significant due to insufficient power, non-demented individuals with PD had increased cognitive workload compared to the healthy controls throughout the testing-Pupillary response may be a valid measure of cognitive demand in non-demented individuals with PD-In future, pupillary response might be used to detect cognitive impairment in individuals with PD.
Demand response in energy markets
International Nuclear Information System (INIS)
Skytte, K.; Birk Mortensen, J.
2004-11-01
Improving the ability of energy demand to respond to wholesale prices during critical periods of the spot market can reduce the total costs of reliably meeting demand, and the level and volatility of the prices. This fact has lead to a growing interest in the short-run demand response. There has especially been a growing interest in the electricity market where peak-load periods with high spot prices and occasional local blackouts have recently been seen. Market concentration at the supply side can result in even higher peak-load prices. Demand response by shifting demand from peak to base-load periods can counteract the market power in the peak-load. However, demand response has so far been modest since the current short-term price elasticity seems to be small. This is also the case for related markets, for example, green certificates where the demand is determined as a percentage of the power demand, or for heat and natural gas markets. This raises a number of interesting research issues: 1) Demand response in different energy markets, 2) Estimation of price elasticity and flexibility, 3) Stimulation of demand response, 4) Regulation, policy and modelling aspects, 5) Demand response and market power at the supply side, 6) Energy security of supply, 7) Demand response in forward, spot, ancillary service, balance and capacity markets, 8) Demand response in deviated markets, e.g., emission, futures, and green certificate markets, 9) Value of increased demand response, 10) Flexible households. (BA)
Pupillary Response to Cognitive Demand in Parkinson’s Disease: A Pilot Study
Directory of Open Access Journals (Sweden)
Melike Kahya
2018-04-01
Full Text Available Previous studies have shown that pupillary response, a physiological measure of cognitive workload, reflects cognitive demand in healthy younger and older adults. However, the relationship between cognitive workload and cognitive demand in Parkinson’s disease (PD remains unclear. The aim of this pilot study was to examine the pupillary response to cognitive demand in a letter-number sequencing (LNS task between 16 non-demented individuals with PD (age, median (Q1–Q3: 68 (62–72; 10 males and 10 control participants (age: 63 (59–67; 2 males, matched for age, education, and Montreal Cognitive Assessment (MOCA scores. A mixed model analysis was employed to investigate cognitive workload changes as a result of incremental cognitive demand for both groups. As expected, no differences were found in cognitive scores on the LNS between groups. Cognitive workload, exemplified by greater pupil dilation, increased with incremental cognitive demand in both groups (p = 0.003. No significant between-group (p = 0.23 or interaction effects were found (p = 0.45. In addition, individuals who achieved to complete the task at higher letter-number (LN load responded differently to increased cognitive demand compared with those who completed at lower LN load (p < 0.001, regardless of disease status. Overall, the findings indicated that pupillary response reflects incremental cognitive demand in non-demented people with PD and healthy controls. Further research is needed to investigate the pupillary response to incremental cognitive demand of PD patients with dementia compared to non-demented PD and healthy controls.Highlights-Pupillary response reflects cognitive demand in both non-demented people with PD and healthy controls-Although not significant due to insufficient power, non-demented individuals with PD had increased cognitive workload compared to the healthy controls throughout the testing-Pupillary response may be a valid measure of cognitive demand in
Tateishi, Ukihide; Miyake, Mototaka; Nagaoka, Tomoaki; Terauchi, Takashi; Kubota, Kazunori; Kinoshita, Takayuki; Daisaki, Hiromitsu; Macapinlac, Homer A
2012-04-01
To clarify whether fluorine 18 ((18)F) fluorodeoxyglucose (FDG) positron emission tomography (PET)/computed tomography (CT) and dynamic contrast-enhanced (DCE) magnetic resonance (MR) imaging performed after two cycles of neoadjuvant chemotherapy (NAC) can be used to predict pathologic response in breast cancer. Institutional human research committee approval and written informed consent were obtained. Accuracy after two cycles of NAC for predicting pathologic complete response (pCR) was examined in 142 women (mean age, 57 years: range, 43-72 years) with histologically proved breast cancer between December 2005 and February 2009. Quantitative PET/CT and DCE MR imaging were performed at baseline and after two cycles of NAC. Parameters of PET/CT and of blood flow and microvascular permeability at DCE MR were compared with pathologic response. Patients were also evaluated after NAC by using Response Evaluation Criteria in Solid Tumors (RECIST) 1.1 based on DCE MR measurements and European Organization for Research and Treatment of Cancer (EORTC) criteria and PET Response Criteria in Solid Tumors (PERCIST) 1.0 based on PET/CT measurements. Multiple logistic regression analyses were performed to examine continuous variables at PET/CT and DCE MR to predict pCR, and diagnostic accuracies were compared with the McNemar test. Significant decrease from baseline of all parameters at PET/CT and DCE MR was observed after NAC. Therapeutic response was obtained in 24 patients (17%) with pCR and 118 (83%) without pCR. Sensitivity, specificity, and accuracy to predict pCR were 45.5%, 85.5%, and 82.4%, respectively, with RECIST and 70.4%, 95.7%, and 90.8%, respectively, with EORTC and PERCIST. Multiple logistic regression revealed three significant independent predictors of pCR: percentage maximum standardized uptake value (%SUV(max)) (odds ratio [OR], 1.22; 95% confidence interval [CI]: 1.11, 1.34; P PET/CT is superior to DCE MR for the prediction of pCR (%SUV(max) [90.1%] vs %κ
MR-guided facet joint injection therapy using an open 1.0-T MRI system: an outcome study
International Nuclear Information System (INIS)
Freyhardt, Patrick; Bucourt, Maximilian de; Maurer, Martin; Renz, Diane; Gebauer, Bernhard; Hamm, Bernd; Streitparth, Florian; Hartwig, Tony; Teichgraeber, Ulf K.M.
2013-01-01
To evaluate the accuracy, safety and efficacy of magnetic resonance imaging (MRI)-guided facet joint injection therapy using a 1.0-T open MRI. One hundred and sixty-six facet joint blocks in 45 patients with lower back pain were performed under MR fluoroscopic guidance using a proton-density-weighted turbo-spin-echo sequence. An in-room monitor, wireless MR-mouse for operator-controlled multiplanar navigation, a flexible surface coil and MR-compatible 20-G needle were used. Clinical outcome was evaluated by questionnaire before intervention and after 1 week, 3, 6 and 12 months using a numerical visual analogue scale (VAS). All facet joint blocks were considered technically successful with distribution of the injectant within and/or around the targeted facet joint. No major complications occurred. The final outcome analysis included 38 patients. An immediate effect was reported by 63 % of the patients. A positive mid-/long-term effect was seen in 13 patients (34 %) after 6 months and in 9 patients (24 %) after 12 months. Mean VAS was reduced from 7.1 ± 1.7 (baseline) to 3.5 ± 2.2, 4.1 ± 3.0, 3.8 ± 2.9 and 4.6 ± 2.9 at 1 week, 3, 6 and 12 months (P < 0.01). MR-guided facet joint injection therapy of the lumbosacral spine is accurate, safe and efficient in the symptomatic treatment of lower back pain. (orig.)
Immunoprotection of recombinant Eg.P29 against Echinococcus granulosus in sheep.
Wang, Hao; Li, Zihua; Gao, Fu; Zhao, Jiaqing; Zhu, Mingxing; He, Xin; Niu, Nan; Zhao, Wei
2016-06-01
This study aims to investigate the immunoprotection of recombinant Eg.P29 (rEg.P29) vaccine and analyze the underlying mechanism in sheep. Three groups of male sheep were immunized subcutaneously with rEg.P29 and PBS, Freund's complete adjuvant as controls, respectively. After prime-boost vaccination, the sheep were challenged with encapsulated Echinococcus granulosus eggs. The percentage of protection in sheep was determined 36 weeks after the infection. Humoral immune response was analyzed for specific IgG, IgG1, IgG2, IgM and IgE levels. Moreover, cytokines including interferon (IFN)-γ, interleukin (IL)-2, IL-4,and IL-10 were also evaluated. Immunization with rEg.P29 induced protective immune responses up to 94.5 %, compared with immunoadjuvant group. The levels of specific IgG, IgG1, IgG2, and IgE as well as IFN-γ, IL-2, and IL-4 significantly increased after two immunizations (P granulosus infection.
International Nuclear Information System (INIS)
Beer, M.; Buchner, S.; Fuchs, J.; Machann, W.; Ritter, C.O.; Beissert, M.; Darge, K.; Hahn, D.; Koestler, H.; Wirbelauer, J.
2007-01-01
Purpose: Cardiomyopathy is a rare but life-threatening disease in children and adolescents. Recent studies reported morphological, functional or metabolic alterations of the heart. We discuss a combined MR imaging and 31 P MR spectroscopy (MRS) protocol allowing the analysis of interdependencies between these parameters. Since normal values of cardiac MR parameters in this age group are not available, we included studies of age-matched healthy adolescents. Materials and Methods: 2D-CINE was used to assess left ventricular (LV) parameters. Additional 3D-Chemical Shift Imaging (3D-CSI) and Spectral Localization with Optimal Pointspread Function (SLOOP) reconstruction allowed quantification of the cardiac energy metabolism. Patients (n = 4; all male; age 16.8 ± 2.9 years) were included on the basis of an echocardiographic diagnosis of possible cardiomyopathy. The same protocol was applied to healthy young volunteers (n = 4; 1 female, 3 male; age 15.5 ± 0.6 years). Results: The patients had a significantly higher LV mass index compared to the control group (147 ± 41 g/m2 versus 97 ± 16 g/m2; p = 0.04). The other LV parameters (including LV EF with 59 ± 22 % versus 67 ± 10 %) showed no significant differences. The phosphocreatine to adenosine triphosphate ratio (PCr/ATP-ratio) of the patients was reduced to 1.71 ± 0.40 versus 2.44 ± 0.30 (p = 0.01), combined with a tendency towards decreased PCr concentrations of 9.1 ± 2.5 versus 7.9 ± 1.0 mmol/kg. Conclusion: The combination of 31 P MR spectroscopy and MR imaging allows quantitative determination of morphologic, functional and metabolic alterations in adolescents with suspected cardiomyopathy in one examination procedure. The reduction of energy metabolism combined with unaltered global function may indicate a primary role of metabolism in the pathogenesis of cardiomyopathies in adolescents. (orig.)
International Nuclear Information System (INIS)
Uematsu, Takayoshi; Yuen, Sachiko; Kasami, Masako
2010-01-01
To retrospectively evaluate the magnetic resonance (MR) imaging findings of breast cancer before neoadjuvant chemotherapy (NAC) and to compare findings of chemosensitive breast cancer with those of chemoresistant breast cancer. The MR imaging findings before NAC in 120 women undergoing NAC were reviewed. The MR imaging findings were compared with the pathological findings and responses. A complete response (pCR) and marked response were achieved in 12 and 35% of 120 breast cancers in 120 women respectively. Breast cancers with a pCR or marked response were classified as chemosensitive breast cancer. The remaining 64 breast cancers (53%) were classified as chemoresistant breast cancer. Large tumour size, a lesion without mass effect, and very high intratumoural signal intensity on T2-weighted MR images were significantly associated with chemoresistant breast cancer. Lesions with mass effect and washout enhancement pattern were significantly associated with chemosensitive breast cancer. Areas with very high intratumoural signal intensity on T2-weighted images corresponded pathologically to areas of intratumoural necrosis. Several MR imaging features of breast cancer before NAC can help predict the efficacy of NAC. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Uematsu, Takayoshi; Yuen, Sachiko [Shizuoka Cancer Center Hospital, Breast Imaging and Breast Intervention Section, Naga-izumi, Shizuoka (Japan); Kasami, Masako [Shizuoka Cancer Center Hospital, Department of Pathology, Naga-izumi, Shizuoka (Japan)
2010-10-15
To retrospectively evaluate the magnetic resonance (MR) imaging findings of breast cancer before neoadjuvant chemotherapy (NAC) and to compare findings of chemosensitive breast cancer with those of chemoresistant breast cancer. The MR imaging findings before NAC in 120 women undergoing NAC were reviewed. The MR imaging findings were compared with the pathological findings and responses. A complete response (pCR) and marked response were achieved in 12 and 35% of 120 breast cancers in 120 women respectively. Breast cancers with a pCR or marked response were classified as chemosensitive breast cancer. The remaining 64 breast cancers (53%) were classified as chemoresistant breast cancer. Large tumour size, a lesion without mass effect, and very high intratumoural signal intensity on T2-weighted MR images were significantly associated with chemoresistant breast cancer. Lesions with mass effect and washout enhancement pattern were significantly associated with chemosensitive breast cancer. Areas with very high intratumoural signal intensity on T2-weighted images corresponded pathologically to areas of intratumoural necrosis. Several MR imaging features of breast cancer before NAC can help predict the efficacy of NAC. (orig.)
29 CFR 3.10 - Methods of payment of wages.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Methods of payment of wages. 3.10 Section 3.10 Labor Office... IN WHOLE OR IN PART BY LOANS OR GRANTS FROM THE UNITED STATES § 3.10 Methods of payment of wages. The payment of wages shall be by cash, negotiable instruments payable on demand, or the additional forms of...
Huang, Yu-Sen; Chen, Jenny Ling-Yu; Hsu, Feng-Ming; Huang, Jei-Yie; Ko, Wei-Chun; Chen, Yi-Chang; Jaw, Fu-Shan; Yen, Ruoh-Fang; Chang, Yeun-Chung
2018-01-01
To evaluate the response in patients undergoing SBRT using dynamic contrast-enhanced (DCE) integrated magnetic resonance positron emission tomography (MR-PET). Stereotactic body radiation therapy (SBRT) is efficacious as a front-line local treatment for non-small cell lung cancer (NSCLC). We prospectively enrolled 19 lung tumors in 17 nonmetastatic NSCLC patients who were receiving SBRT as a primary treatment. They underwent DCE-integrated 3T MR-PET before and 6 weeks after SBRT. The following image parameters were analyzed: tumor size, standardized uptake value (SUV), apparent diffusion coefficient, K trans , k ep , v e , v p , and iAUC 60 . Chest computed tomography (CT) was performed at 3 months after SBRT. SBRT treatment led to tumor changes including significant decreases in the SUV max (-61%, P PET SUV max was correlated with the MR k ep mean (P = 0.002) and k ep SD (P 10 (P = 0.083). In patients with NSCLC who are receiving SBRT, DCE-integrated MR-PET can be used to evaluate the response after SBRT and to predict the local treatment outcome. 2 Technical Efficacy: Stage 1 J. Magn. Reson. Imaging 2018;47:191-199. © 2017 International Society for Magnetic Resonance in Medicine.
Does responsive pricing smooth demand shocks?
Pascal, Courty; Mario, Pagliero
2011-01-01
Using data from a unique pricing experiment, we investigate Vickrey’s conjecture that responsive pricing can be used to smooth both predictable and unpredictable demand shocks. Our evidence shows that increasing the responsiveness of price to demand conditions reduces the magnitude of deviations in capacity utilization rates from a pre-determined target level. A 10 percent increase in price variability leads to a decrease in the variability of capacity utilization rates between...
Ontario demand response scenarios
International Nuclear Information System (INIS)
Rowlands, I.H.
2005-09-01
Strategies for demand management in Ontario were examined via 2 scenarios for a commercial/institutional building with a normal summertime peak load of 300 kW between 14:00 and 18:00 during a period of high electricity demand and high electricity prices. The first scenario involved the deployment of a 150 kW on-site generator fuelled by either diesel or natural gas. The second scenario involved curtailing load by 60 kW during the same periods. Costs and benefits of both scenarios were evaluated for 3 groups: consumers, system operators and society. Benefits included electricity cost savings, deferred transmission capacity development, lower system prices for electricity, as well as environmental changes, economic development, and a greater sense of corporate social responsibility. It was noted that while significant benefits were observed for all 3 groups, they were not substantial enough to encourage action, as the savings arising from deferred generation capacity development do not accrue to individual players. The largest potential benefit was identified as lower prices, spread across all users of electricity in Ontario. It was recommended that representative bodies cooperate so that the system-wide benefits can be reaped. It was noted that if 10 municipal utilities were able to have 250 commercial or institutional customers engaged in distributed response, then a total peak demand reduction of 375 MW could be achieved, representing more than 25 per cent of Ontario's target for energy conservation. It was concluded that demand response often involves the investment of capital and new on-site procedures, which may affect reactions to various incentives. 78 refs., 10 tabs., 5 figs
International Nuclear Information System (INIS)
Wu Honglin; Chen Junkun; Zhang Zongjun; Lu Guangming; Chen Ziqian; Wang Wei; Ji Xueman; Tang Xiaojun; Li Lin
2005-01-01
Objective: To compare the accuracy of MR imaging scores with MR perfusion imaging in pre-operative grading of intracranial gliomas. Methods: Thirty patients with intracranial gliomas (8 low-grade and 22 high-grade, according to WHO criteria) were examined with MR perfusion imaging pre-operatively. The lesions were evaluated by using an MR imaging score based on nine criteria. rCBV of the lesions were calculated by comparing the CBV of the lesion and that of contralateral normal white matter. The scores and ratios in high-grade and low-grade tumours were compared. Results: The MR imaging score of low grade (grades I and II) gliomas (0.67±0.29) were significantly lower than that of grades III (1.32 ± 0.47) (t=-3.48, P=0.003) and IV (1.56 ± 0.20) (t=-7.36, P=0.000) gliomas. There was no statistical difference when MR imaging scores of grades III and IV gliomas (t=-1.39, P=0.182) were compared. The maximum rCBV ratio of low grade (grades I and II) gliomas (2.38 ± 0.66 ) were significantly lower than that of grades III (5.81 ± 3.20) (t=-3.57, P=0.003) and IV (6.99 ± 2.47) (t=-5.09, P=0.001). There was no statistical difference when rCBV ratios of grades III and IV (t =-0.93, P=0.365) gliomas were compared. The accuracy of MR imaging scores in the noninvasive grading of untreated gliomas was all most the same as that of MR perfusion imaging (90.00% vs 89.29%). Conclusion: The MR imaging scores and MR perfusion imaging are two very useful tools in the evaluation of the histopathologic grade of cerebral gliomas. The overall accuracy in the noninvasive grading of gliomas may be imp roved if MR imaging scores and MR perfusion imaging are combined. (authors)
Advanced design of fast reactor-membrane reformer (FR-MR)
International Nuclear Information System (INIS)
Tashimo, M.; Hori, I.; Yasuda, I.; Shirasaki, Y.; Kobayashi, K.
2004-01-01
A new plant concept of nuclear-produced hydrogen is being studied using a Fast Reactor-Membrane Reformer (FR-MR). The conventional steam methane reforming (SMR) system is a three-stage process. The first stage includes the reforming, the second contains a shift reaction and the third is the separation process. The reforming process requires high temperatures of 800 ∼ 900 deg C. The shift process generates heat and is performed at around 200 deg C. The membrane reforming has only one process stage under a nonequilibrium condition by removing H2 selectively through a membrane tube. The steam reforming temperature can be decreased from 800 deg C to 550 deg C, which is a remarkable benefit offered by the non-equilibrium condition. With this new technology, the reactor type can be changed from a High Temperature Gas-cooled Reactor (HTGR) to a Fast Reactor (FR). A Fast Reactor-Membrane Reformer (FR-MR) is composed of a nuclear plant and a hydrogen plant. The nuclear plant is a sodium-cooled Fast Reactor with mixed oxide fuel and with a power of 240 MWt. The heat transport system contains two circuits, the primary circuit and the secondary circuit. The membrane reformer units are set in the secondary circuit. The heat, supplied by the sodium, can produce 200 000 Nm 3 /h by 2 units. There are two types of membranes. One is made of Pd another one (advanced) is made of, for example V, or Nb. The technology for the Pd membrane is already established in a small scale. The non-Pd type is expected to improve the performance. (author)
Directory of Open Access Journals (Sweden)
Rodrigo Pereira da Silva
2010-07-01
Full Text Available Acute cardiovascular responses to different high-velocity resistance exercise proto-cols were compared in untrained older women. Twelve apparently healthy volunteers (62.6 ± 2.9 years performed three different protocols on the bench press (BP and leg press (LP. All protocols consisted of three sets of 10 repetitions performed with a 10RM load and 2 min of rest between sets. The continuous protocol (CP consisted of 10 repetitions with no pause between repetitions. The discontinuous protocols were performed with a pause of five (DP5 or 15 (DP15 seconds between the fifth and sixth repetition. Heart rate (HR, systolic blood pressure (SBP, and rate pressure product (RPP were assessed at baseline and at the end of all exercise sets. Factorial ANOVA was used to compare the cardiovascular response among different protocols. Compared to baseline, HR, SBP and RPP were, respectively, 22.3%, 23.2% and 51.2% (p < 0.05 higher for BP exercise, and 41.7%, 43.0% and 102.9% (p < 0.05 higher for LP exercise after the third set in all protocols. For BP exercise, HR and RPP were 5.6% and 8.2% (p < 0.05 lower in DP5 and DP15, respectively, compared to CP. For LP exercise, HR, SBP and RPP were, respectively, 5.2%, 8.0% and 14.8% lower in DP5 compared to CP. In conclusion, discontinuous high-velocity resistance exercise seems to have a lower cardiovascular demand than continuous resistance exercise in older women.
International Nuclear Information System (INIS)
Priola, Adriano Massimiliano; Priola, Sandro Massimo; Gned, Dario; Veltri, Andrea; Giraudo, Maria Teresa
2018-01-01
To prospectively evaluate usefulness of the apparent diffusion coefficient (ADC) in differentiating anterior mediastinal lymphoma from nonsuppressing normal thymus on chemical-shift MR, and to look at the relationship between patient age and ADC. Seventy-three young subjects (25 men, 48 women; age range, 9-29 years), who underwent chemical-shift MR and diffusion-weighted MR were divided into a normal thymus group (group A, 40 subjects), and a lymphoma group (group B, 33 patients). For group A, all subjects had normal thymus with no suppression on opposed-phase chemical-shift MR. Two readers measured the signal intensity index (SII) and ADC. Differences in SII and ADC between groups were tested using t-test. ADC was correlated with age using Pearson correlation coefficient. Mean SII±standard deviation was 2.7±1.8% for group A and 2.2±2.4% for group B, with no significant difference between groups (P=.270). Mean ADC was 2.48±0.38 x 10 -3 mm 2 /s for group A and 1.24±0.23 x 10 -3 mm 2 /s for group B. A significant difference between groups was found (P<.001), with no overlap in range. Lastly, significant correlation was found between age and ADC (r=0.935, P<.001) in group A. ADC of diffusion-weighted MR is a noninvasive and accurate parameter for differentiating lymphoma from nonsuppressing thymus on chemical-shift MR in young subjects. (orig.)
Zhang, Jingbo; Hricak, Hedvig; Shukla-Dave, Amita; Akin, Oguz; Ishill, Nicole M; Carlino, Lauren J; Reuter, Victor E; Eastham, James A
2009-11-01
To assess the diagnostic accuracy of endorectal magnetic resonance (MR) imaging and MR spectroscopic imaging for prediction of the pathologic stage of prostate cancer and the presence of clinically nonimportant disease in patients with clinical stage T1c prostate cancer. The institutional review board approved-and waived the informed patient consent requirement for-this HIPAA-compliant study involving 158 patients (median age, 58 years; age range, 40-76 years) who had clinical stage T1c prostate cancer, had not been treated preoperatively, and underwent combined 1.5-T endorectal MR imaging-MR spectroscopic imaging between January 2003 and March 2004 before undergoing radical prostatectomy. On the MR images and combined endorectal MR-MR spectroscopic images, two radiologists retrospectively and independently rated the likelihood of cancer in 12 prostate regions and the likelihoods of extracapsular extension (ECE), seminal vesicle invasion (SVI), and adjacent organ invasion by using a five-point scale, and they determined the probability of clinically nonimportant prostate cancer by using a four-point scale. Whole-mount step-section pathology maps were used for imaging-pathologic analysis correlation. Receiver operating characteristic curves were constructed and areas under the curves (AUCs) were estimated nonparametrically for assessment of reader accuracy. At surgical-pathologic analysis, one (0.6%) patient had no cancer; 124 (78%) patients, organ-confined (stage pT2) disease; 29 (18%) patients, ECE (stage pT3a); two (1%) patients, SVI (stage pT3b); and two (1%) patients, bladder neck invasion (stage pT4). Forty-six (29%) patients had a total tumor volume of less than 0.5 cm(3). With combined MR imaging-MR spectroscopic imaging, the two readers achieved 80% accuracy in disease staging and AUCs of 0.62 and 0.71 for the prediction of clinically nonimportant cancer. Clinical stage T1c prostate cancers are heterogeneous in pathologic stage and volume. MR imaging may
Coordination of Energy Efficiency and Demand Response
Energy Technology Data Exchange (ETDEWEB)
Goldman, Charles; Reid, Michael; Levy, Roger; Silverstein, Alison
2010-01-29
This paper reviews the relationship between energy efficiency and demand response and discusses approaches and barriers to coordinating energy efficiency and demand response. The paper is intended to support the 10 implementation goals of the National Action Plan for Energy Efficiency's Vision to achieve all cost-effective energy efficiency by 2025. Improving energy efficiency in our homes, businesses, schools, governments, and industries - which consume more than 70 percent of the nation's natural gas and electricity - is one of the most constructive, cost-effective ways to address the challenges of high energy prices, energy security and independence, air pollution, and global climate change. While energy efficiency is an increasingly prominent component of efforts to supply affordable, reliable, secure, and clean electric power, demand response is becoming a valuable tool in utility and regional resource plans. The Federal Energy Regulatory Commission (FERC) estimated the contribution from existing U.S. demand response resources at about 41,000 megawatts (MW), about 5.8 percent of 2008 summer peak demand (FERC, 2008). Moreover, FERC recently estimated nationwide achievable demand response potential at 138,000 MW (14 percent of peak demand) by 2019 (FERC, 2009).2 A recent Electric Power Research Institute study estimates that 'the combination of demand response and energy efficiency programs has the potential to reduce non-coincident summer peak demand by 157 GW' by 2030, or 14-20 percent below projected levels (EPRI, 2009a). This paper supports the Action Plan's effort to coordinate energy efficiency and demand response programs to maximize value to customers. For information on the full suite of policy and programmatic options for removing barriers to energy efficiency, see the Vision for 2025 and the various other Action Plan papers and guides available at www.epa.gov/eeactionplan.
Vasani, Roshan B; Szili, Endre J; Rajeev, Gayathri; Voelcker, Nicolas H
2017-07-04
Chronic wounds are a major socio-economic problem. Bacterial infections in such wounds are a major contributor to lack of wound healing. An early indicator of wound infection is an increase in pH of the wound fluid. Herein, we describe the development of a pH-responsive drug delivery device that can potentially be used for wound decontamination in situ and on-demand in response to an increase in the pH of the wound environment. The device is based on a porous silicon film that provides a reservoir for encapsulation of an antibiotic within the pores. Loaded porous silicon is capped with dual plasma polymer layers of poly(1,7-octadiene) and poly(acrylic acid), which provide a pH-responsive barrier for on-demand release of the antibiotic. We demonstrate that release of the antibiotic is inhibited in aqueous buffer at pH 5, whereas the drug is released in a sustainable manner at pH 8. Importantly, the released drug was bacteriostatic against the Pseudomonas aeruginosa wound pathogen. In the future, incorporation of the delivery device into wound dressings could potentially be utilized for non-invasive decontamination of wounds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
MR investigation of recurrent cholesteatomas
International Nuclear Information System (INIS)
Doyon, D.; Chan, K.Y.; Attia, M.; Halimi, P.; Sigal, R.; Bobin, S.; Sterkers, J.M.
1989-01-01
Nine cases of recurrent petrous cholesteatomas have been studied by a 1.5 T MR unit. Gadolinium was injected in 1 case. In all cases, comparison between MR, CT and clinical findings were made. MR allows for accurate topographic study and assessment of cholesteatomas extension, in particular in the posterior fossa and skull base. Relationships with the internal carotid artery and the jugular vein are clearly depicted [fr
Valuation of dynamic MR imaging for diagnosis of pituitary microadenomas
International Nuclear Information System (INIS)
Lu Wu; Zhou Shengli; Liu Yusheng
2003-01-01
Objective: To evaluate the use of keyhole dynamic magnetic resonance (MR) imaging in evaluation of pituitary microadenomas. Methods: Fifty-three patients with pituitary microadenomas proved by operation or clinical findings such as headache, amenorrhea, lactating, fat or acromegaly were retrospectively studied on dynamic MR, conventional contrast enhanced MR, and unenhanced MR. Then the image data were analyzed by two experienced doctors who didn't know the details and three degrees were made as follows: grade 0, no evidence of the tumor; grade I, asymmetry signals in the pituitary; and grade II, nodulated or sheets signals in the pituitary. The grading data were compared with statistical methods. Results: In dynamic MR grading system: grade 0 was revealed in 1 patient, grade I in 29 patients and grade II in 23 patients. In conventional enhanced MR: grade 0 in 26 patients, grade I in 17 patients and grade II in 10 patients. In conventional unenhanced MR: grade 0 in 39 patients, grade I in 10 patients and grade II in 4 patients. The diagnostic rate of dynamic MR, conventional enhanced MR, and unenhanced MR was 98.1%, 51.9%, and 26.4%, respectively. (P < 0.005). Dynamic MR can increase the grade of tumor compared to the other two, which is significant statistically. Conclusion: Keyhole dynamic MR can increase the diagnostic accuracy of pituitary microadenomas while decreasing the uncertainty. So dynamic MR should become a routine examination for pituitary microadenoma when suspected by clinical findings but negative in conventional MR
Rasmussen, Erin B; Reilly, William; Buckley, Jessica; Boomhower, Steven R
2012-02-01
Research on free-food intake suggests that cannabinoids are implicated in the regulation of feeding. Few studies, however, have characterized how environmental factors that affect food procurement interact with cannabinoid drugs that reduce food intake. Demand analysis provides a framework to understand how cannabinoid blockers, such as rimonabant, interact with effort in reducing demand for food. The present study examined the effects rimonabant had on demand for sucrose in obese Zucker rats when effort to obtain food varied and characterized the data using the exponential ("essential value") model of demand. Twenty-nine male (15 lean, 14 obese) Zucker rats lever-pressed under eight fixed ratio (FR) schedules of sucrose reinforcement, in which the number of lever-presses to gain access to a single sucrose pellet varied between 1 and 300. After behavior stabilized under each FR schedule, acute doses of rimonabant (1-10mg/kg) were administered prior to some sessions. The number of food reinforcers and responses in each condition was averaged and the exponential and linear demand equations were fit to the data. These demand equations quantify the value of a reinforcer by its sensitivity to price (FR) increases. Under vehicle conditions, obese Zucker rats consumed more sucrose pellets than leans at smaller fixed ratios; however, they were equally sensitive to price increases with both models of demand. Rimonabant dose-dependently reduced reinforcers and responses for lean and obese rats across all FR schedules. Data from the exponential analysis suggest that rimonabant dose-dependently increased elasticity, i.e., reduced the essential value of sucrose, a finding that is consistent with graphical depictions of normalized demand curves. Copyright © 2011 Elsevier Inc. All rights reserved.
Computer-aided breast MR image feature analysis for prediction of tumor response to chemotherapy
International Nuclear Information System (INIS)
Aghaei, Faranak; Tan, Maxine; Liu, Hong; Zheng, Bin; Hollingsworth, Alan B.; Qian, Wei
2015-01-01
Purpose: To identify a new clinical marker based on quantitative kinetic image features analysis and assess its feasibility to predict tumor response to neoadjuvant chemotherapy. Methods: The authors assembled a dataset involving breast MR images acquired from 68 cancer patients before undergoing neoadjuvant chemotherapy. Among them, 25 patients had complete response (CR) and 43 had partial and nonresponse (NR) to chemotherapy based on the response evaluation criteria in solid tumors. The authors developed a computer-aided detection scheme to segment breast areas and tumors depicted on the breast MR images and computed a total of 39 kinetic image features from both tumor and background parenchymal enhancement regions. The authors then applied and tested two approaches to classify between CR and NR cases. The first one analyzed each individual feature and applied a simple feature fusion method that combines classification results from multiple features. The second approach tested an attribute selected classifier that integrates an artificial neural network (ANN) with a wrapper subset evaluator, which was optimized using a leave-one-case-out validation method. Results: In the pool of 39 features, 10 yielded relatively higher classification performance with the areas under receiver operating characteristic curves (AUCs) ranging from 0.61 to 0.78 to classify between CR and NR cases. Using a feature fusion method, the maximum AUC = 0.85 ± 0.05. Using the ANN-based classifier, AUC value significantly increased to 0.96 ± 0.03 (p < 0.01). Conclusions: This study demonstrated that quantitative analysis of kinetic image features computed from breast MR images acquired prechemotherapy has potential to generate a useful clinical marker in predicting tumor response to chemotherapy
Computer-aided breast MR image feature analysis for prediction of tumor response to chemotherapy
Energy Technology Data Exchange (ETDEWEB)
Aghaei, Faranak; Tan, Maxine; Liu, Hong; Zheng, Bin, E-mail: Bin.Zheng-1@ou.edu [School of Electrical and Computer Engineering, University of Oklahoma, Norman, Oklahoma 73019 (United States); Hollingsworth, Alan B. [Mercy Women’s Center, Mercy Health Center, Oklahoma City, Oklahoma 73120 (United States); Qian, Wei [Department of Electrical and Computer Engineering, University of Texas, El Paso, Texas 79968 (United States)
2015-11-15
Purpose: To identify a new clinical marker based on quantitative kinetic image features analysis and assess its feasibility to predict tumor response to neoadjuvant chemotherapy. Methods: The authors assembled a dataset involving breast MR images acquired from 68 cancer patients before undergoing neoadjuvant chemotherapy. Among them, 25 patients had complete response (CR) and 43 had partial and nonresponse (NR) to chemotherapy based on the response evaluation criteria in solid tumors. The authors developed a computer-aided detection scheme to segment breast areas and tumors depicted on the breast MR images and computed a total of 39 kinetic image features from both tumor and background parenchymal enhancement regions. The authors then applied and tested two approaches to classify between CR and NR cases. The first one analyzed each individual feature and applied a simple feature fusion method that combines classification results from multiple features. The second approach tested an attribute selected classifier that integrates an artificial neural network (ANN) with a wrapper subset evaluator, which was optimized using a leave-one-case-out validation method. Results: In the pool of 39 features, 10 yielded relatively higher classification performance with the areas under receiver operating characteristic curves (AUCs) ranging from 0.61 to 0.78 to classify between CR and NR cases. Using a feature fusion method, the maximum AUC = 0.85 ± 0.05. Using the ANN-based classifier, AUC value significantly increased to 0.96 ± 0.03 (p < 0.01). Conclusions: This study demonstrated that quantitative analysis of kinetic image features computed from breast MR images acquired prechemotherapy has potential to generate a useful clinical marker in predicting tumor response to chemotherapy.
MR cholangiopancreatography. Comparison of images obtained with 1.0 and 1.5 tesla units
International Nuclear Information System (INIS)
Yasui, Masayasu; Ito, Katsuyoshi; Koike, Shinji; Matsunaga, Naofumi
2002-01-01
The purpose of this study was to compare the image quality and visualization obtained in MR cholangiopancreatography (MRCP) using different high-field strength (1.0 vs. 1.5 Tesla) MR units and to assess the effect of field strength on MRCP. This study population included 10 healthy volunteers and 37 patients suspected of having pancreatobiliary diseases. MRCP images were obtained using two MR units with different high-field strengths (1.0 and 1.5 Tesla), with half-Fourier acquisition single-shot turbo spin-echo (HASTE) and rapid acquisition by relaxation enhancement (RARE) sequences. The image quality and visualization of each portion of the pancreatobiliary system were graded and recorded using a four-point scale. Additionally, the signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) were measured. The SNR and CNR in HASTE sequences acquired with the 1.5 Tesla (T) unit were significantly higher than those acquired with the 1.0 T unit (p=0.001). In qualitative analysis, there were no statistically significant differences in image quality or visualization of the ducts in either HASTE or RARE sequences between 1.0 T and 1.5 T. Our study showed that visual image quality provided by MRCP was equivalent at 1.0 and 1.5 T. (author)
Energy Technology Data Exchange (ETDEWEB)
Haller, Joerg [Department of Radiology, Hanusch Hospital, Heinrich Collin-Strasse 30, A-1140 Vienna (Austria); Ludwig Boltzmann Institute for Osteology, Hanusch Hospital, Heinrich Collin-Strasse 30, A-1140 Vienna (Austria); Bernt, Reinhard [Department of Radiology, Hanusch Hospital, Heinrich Collin-Strasse 30, A-1140 Vienna (Austria)]. E-mail: reinhard.bernt@wgkk.sozvers.at; Seeger, Thomas [Department of Trauma Surgery, Hanusch Hospital, Heinrich Collin-Strasse 30, A-1140 Vienna (Austria); Weissenbaeck, Alexander [Department of Trauma Surgery, Hanusch Hospital, Heinrich Collin-Strasse 30, A-1140 Vienna (Austria); Tuechler, Heinrich [Ludwig Boltzmann Institute for Hematology, Hanusch Hospital, Heinrich Collin-Strasse 30, A-1140 Vienna (Austria); Resnick, Donald [Department of Radiology, VA Medical Center, UCSD, 3350 La Jolla Village Dr, San Diego, CA 92161 (United States)
2006-06-15
Objective: To clarify the role of MR-imaging in the diagnosis of anterior ankle impingement syndromes. Materials and methods: We prospectively examined 51 consecutive patients with chronic ankle pain by MR-imaging. Arthroscopy was performed in 29 patients who previously underwent non-enhanced MR-imaging; in 11 patients, indirect MR-arthrography additionally was performed. MR-examinations were correlated with clinical findings; MR and arthroscopy scores were statistically compared, agreement was measured. Results: Arthroscopy demonstrated granulation tissue in the lateral gutter (38%) and anterior recess (31%), lesions of the anterior tibiofibular (31%) and the anterior talofibular ligament (21%) as well as intraarticular bodies (10%). Stenosing tenosynovitis and a ganglionic cyst were revealed as extraarticular causes for chronic ankle pain by MR-examination (17%). Agreement of MR-imaging and arthroscopy was fair for the anterior talofibular ligament and the anterior joint cavity (kappa 0.40). Major discrepancy was found for non-enhanced MR scans (kappa 0.49) when compared with indirect MR-arthrography (kappa 0.03) in the anterior cavity. The sensitivity for lesions of the anterior talofibular and calcaneofibular ligament and the anterior cavity (0.91-0.87) detected by MR-imaging was superior in comparison to lesions of the anterior tibiofibular ligament and anteromedial cavity (0.50-0.24). Conclusion: MR-imaging provides additional information about the mechanics of chronic ankle impingement rather than an accurate diagnosis of this clinical entity. The method is helpful in differentiating extra- from intra-articular causes of ankle impingement. Indirect MR-arthrography has little or no additional value in patients with ankle impingement syndrome.
International Nuclear Information System (INIS)
Haller, Joerg; Bernt, Reinhard; Seeger, Thomas; Weissenbaeck, Alexander; Tuechler, Heinrich; Resnick, Donald
2006-01-01
Objective: To clarify the role of MR-imaging in the diagnosis of anterior ankle impingement syndromes. Materials and methods: We prospectively examined 51 consecutive patients with chronic ankle pain by MR-imaging. Arthroscopy was performed in 29 patients who previously underwent non-enhanced MR-imaging; in 11 patients, indirect MR-arthrography additionally was performed. MR-examinations were correlated with clinical findings; MR and arthroscopy scores were statistically compared, agreement was measured. Results: Arthroscopy demonstrated granulation tissue in the lateral gutter (38%) and anterior recess (31%), lesions of the anterior tibiofibular (31%) and the anterior talofibular ligament (21%) as well as intraarticular bodies (10%). Stenosing tenosynovitis and a ganglionic cyst were revealed as extraarticular causes for chronic ankle pain by MR-examination (17%). Agreement of MR-imaging and arthroscopy was fair for the anterior talofibular ligament and the anterior joint cavity (kappa 0.40). Major discrepancy was found for non-enhanced MR scans (kappa 0.49) when compared with indirect MR-arthrography (kappa 0.03) in the anterior cavity. The sensitivity for lesions of the anterior talofibular and calcaneofibular ligament and the anterior cavity (0.91-0.87) detected by MR-imaging was superior in comparison to lesions of the anterior tibiofibular ligament and anteromedial cavity (0.50-0.24). Conclusion: MR-imaging provides additional information about the mechanics of chronic ankle impingement rather than an accurate diagnosis of this clinical entity. The method is helpful in differentiating extra- from intra-articular causes of ankle impingement. Indirect MR-arthrography has little or no additional value in patients with ankle impingement syndrome
International Nuclear Information System (INIS)
Shu Min; Du Lianjun; Ding Xiaoyi; Lu Yong; Yan Ling; Jiang Hao; Chen Kemin
2009-01-01
Objective: To determine the utility of diffusion-weighted magnetic resonance imaging (MR DWI) in detecting tumor necrosis with histological correlation after neoadjuvant chemotherapy. Methods: Conventional MRI and DWI were obtained from 36 patients with histological proven osteosarcoma. Magnetic resonance examinations were performed in all patients before and after 4 cycles of preoperative neoadjuvant chemotherapy. Apparent diffusion coefficients (ADC) were calculated. The degree of tumor necrosis was assessed using the histological Huvos classification after chemotherapy. t-test was performed for testing changes in ADC value between the 2 groups. P value less than 0.05 were considered as a statistically significant difference. Results: The differences in ADC between viable [(1.06 ± 0.30)x10 -3 mm 2 /s] and necrotic [(2.39 ± 0.44)x10 -3 mm 2 /s] tumor were significant (t = 3.515, P -3 mm 2 /s to (2.27 ± 0.20)x10 -3 mm 2 s, the corresponding value in poor responses was increased from (1.45 ± 0.11)x10 -3 mm 2 /s to (1.83 ± 0.16)x10 -3 mm 2 /s. There was significant difference in changes of ADC values between good responses and poor responses (t = 4.981, P < 0.01). Conclusion: Diffusion-weighted MRI permits recognition of tumor necrosis induced by chemotherapy in osteosarcoma. DWI is correlated directly with tumor necrosis. They have potential utility in evaluating the preoperative chemotherapy response in patients with primary osteosarcoma. (authors)
Energy Technology Data Exchange (ETDEWEB)
Godfrey, Edmund M. [St James' Hospital, Leeds (United Kingdom); St James' Hospital, Department of Radiology, Leeds (United Kingdom); Patterson, Andrew J.; Priest, Andrew N.; Davies, Susan E.; Joubert, Ilse; Krishnan, Anant S.; Shaw, Ashley S.; Alexander, Graeme J.; Allison, Michael E.; Griffiths, William J.H.; Gimson, Alexander E.S. [Addenbrooke' s Hospital, Cambridge (United Kingdom); Griffin, Nyree [St Thomas' s Hospital, London (United Kingdom); Lomas, David J. [University of Cambridge, Department of Radiology, Cambridge (United Kingdom)
2012-12-15
Conventional imaging techniques are insensitive to liver fibrosis. This study assesses the diagnostic accuracy of MR elastography (MRE) stiffness values and the ratio of phosphomonoesters (PME)/phosphodiesters (PDE) measured using {sup 31}P spectroscopy against histological fibrosis staging. The local research ethics committee approved this prospective, blinded study. A total of 77 consecutive patients (55 male, aged 49 {+-} 11.5 years) with a clinical suspicion of liver fibrosis underwent an MR examination with a liver biopsy later the same day. Patients underwent MRE and {sup 31}P spectroscopy on a 1.5 T whole body system. The liver biopsies were staged using an Ishak score for chronic hepatitis or a modified NAS fibrosis score for fatty liver disease. MRE increased with and was positively associated with fibrosis stage (Spearman's rank = 0.622, P < 0.001). PME/PDE was not associated with fibrosis stage (Spearman's rank = -0.041, p = 0.741). Area under receiver operating curves for MRE stiffness values were high (range 0.75-0.97). The diagnostic utility of PME/PDE was no better than chance (range 0.44-0.58). MRE-estimated liver stiffness increases with fibrosis stage and is able to dichotomise fibrosis stage groupings. We did not find a relationship between {sup 31}P MR spectroscopy and fibrosis stage. circle Magnetic resonance elastography (MRE) and MR spectroscopy can both assess the liver. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Sittek, H.; Perlet, C.; Kessler, M.; Reiser, M. [Institut fuer Radiologische Diagnostik, Klinikum Grossenhadern, Ludwig-Maximilians-Univ., Muenchen (Germany); Untch, M. [Klinik und Poliklinik fuer Frauenheilkunde und Geburtshilfe, Klinikum Grossenhadern, Ludwig-Maximilians-Univ., Muenchen (Germany)
1998-12-31
Material and Methods: We carried out 1505 MR mammographoes in 1357 patients. Biopsy was indicated in 413 cases. Among the malignancies, 23/214 (10%) were ILC. MR-M was performed with a 1.0 T whole body MRI system with a dynamic FLASH-3D sequence. Relative signal enhancement within lesions detected and morphologic pattern of contrast enhancement (mep) were determined. Three types of mep were distinguished: type 1 without contrast enhancement, type 2 with focal contrast enhancement, and type 3 with diffuse contrast enhancement of the glandular body. Results: Within MR-M alone, 19/23 (82.6%) of ILC were detected due to a mep type 2. Four ILC were false negative on MR-M (2 cases show mep type 1 or mep type 3). The sensitivity of Mx alone was 86.9% (20/23). When both Mx and MR-M were combined, all 23 ILC were detected. The addition of MR-M to Mx may increase sensitivity to about 100% in the detection of ILC. (orig.) [Deutsch] Material und Methode: Im Zeitraum 05/1993 bis 06/1996 fuehrten wir bei 1357 Patientinnen 1505 MR-Mammographien durch. In 413 Faellen wurde eine Probeexzision indiziert. Die histologische Untersuchung ergab in 214 Faellen einen malignen Tumor. Darunter befanden sich 23 ILC. Die MR-M wurden an einem 1,0 T MRT-System (Impact, Siemens, Erlangen) mit einer dynamischen FLASH 3D Sequenz durchgefuehrt. Neben dem prozentualen Anstieg der Signalintensitaet innerhalb einer Laesion haben wir fuer die Diagnostik folgende morphologische Befundmuster (BM) unterschieden: Typ 1: Keine Aufnahme, Typ 2: Fokale Aufnahme, Typ 3: Diffuse Aufnahme des Druesenkoerpers in der MR-M. Ergebnisse: Mit der MR-M konnten 19/23 (82,6%) der ILC anhand einer fokalen Zunahme der Signalintensitaet richtig positiv erkannt werden (BM Typ 2). Vier der ILC waren in der MR-M falsch negativ. In zwei Faellen (2/23) war keine Zunahme der Signalintensitaet zu verzeichnen (BM Typ 1). In zwei weiteren Faellen (2/23) maskierte eine diffuse Signalintensitaetszunahme des Druesenkoerpers (BM Typ 3
Questionnaire responses concerning safety issues in MR examination
International Nuclear Information System (INIS)
Yamaguchi-Sekino, Sachiko; Nakai, Toshiharu; Muranaka, Hiroyuki
2011-01-01
Recently, the rising numbers of medical implants and scanners with higher static magnetic field have increased safety concerns for magnetic resonance (MR) examination. To determine future safety focus, we distributed anonymous questionnaires to 3250 members of the Japanese Society for Magnetic Resonance in Medicine (JSMRM) and received 978 responses. Safety issues on the questionnaire concentrated on the handling of patients with implants (Q7-18, appendix), acoustic trauma due to scanning (Q19-21, appendix), and MR compatibility within the scanner room (Q22-25, appendix). Ninety-three percent of respondents indicated they had encountered cases with implants or medical materials of unknown MR compatibility; 21.7% reported heating problems and 15.0%, nerve stimulation problems, in patients with implants during MR examination. Although 88.7% of respondents recognized the term ''MR compatibility'', 68.2% indicated limited detailed understanding of the term. Eleven percent had had cases with suspected acoustic injury from MR scanner noise. Scanner noise levels were not clarified in any way in 37.4% cases, but 69.5% applied ear protection to patients. Labeling of ''MR compatibility'' of equipment brought into the MR scanner room was reported by 71.9%. More than 50% experienced MR compatibility issues related to equipment brought into the MR scanner room. With regard to safety issues on metallic objects which are implanted in MR workers, 88.1% indicated they would continue current operations even the implant is inside the body. Respondents identified lectures and seminars by professional societies, safety training by manufacturers, and information from the Internet and literature as the 3 main sources for up-dating safety information for MR examination. (author)
78 FR 21928 - Demand Response Coalition v. PJM Interconnection, L.L.C.; Notice of Complaint
2013-04-12
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL13-57-000] Demand Response... Demand Response Coalition \\1\\ (Complainant) filed a formal complaint against the PJM Interconnection, L.L... Plan Enhancements'') violate section 205 of the FPA and are therefore unenforceable. \\1\\ The Demand...
Energy Technology Data Exchange (ETDEWEB)
Blankenhorn, M. [Psychiatrische Universitaetsklinik, Ulm (Germany). Abteilung III; Bachert, P.; Kaick, G. van [Deutsches Krebsforschungszentrum Heidelberg (Germany). Forschungsschwerpunkt Radiologische Diagnostik; Semmler, W. [Freie Univ. Berlin (Germany). Inst. fuer Diagnostikforschung; Ende, G. [Zentralinstitut fuer Seelische Gesundheit, Mannheim (Germany). NMR-Forschung in der Psychiatrie; Tronnier, V. [Neurochirurgische Klinik, Klinikum der Universitaet, Heidelberg (Germany); Sartor, K. [Neurologische Klinik, Klinikum der Universitaet, Heidelberg (Germany). Abt. Neuroradiologie
1999-06-01
Purpose: {sup 31}P MR spectroscopic imaging ({sup 31}P SI) was evaluated in a clinical study as a method for monitoring presurgical devascularization of meningiomas. The aim was to assess noninvasively metabolic alterations in tumor and in healthy brain tissue before and after embolization. Methods: Localized {sup 31}P MR spectra of the brain were obtained by means of 2D-SI (voxel size: 36 cm{sup 3}) using a 1,5-T whole-body MR tomograph. Results: Eleven of 19 patients with intracranial meningiomas examined in this study underwent preoperative embolization therapy; eight patients were examined before and after treatment. After embolization, alterations of pH and of the concentrations of high-energy phosphates (nucleoside-5`triphosphate=NTP, phosphocreatine=PCr), inorganic phosphate (P{sub i}), and membrane constituents were observed in the tumors. A tendency of [P{sub i}] increase and decrease of [NTP], [PCr], and pH predominated, which is explained by ischemic processes after tumor devascularization. Conclusion: {sup 31}P SI is applicable in clinical studies and detects alterations of phosphate metabolism in a meningioma after embolization. (orig.) [Deutsch] Ziel: Die {sup 31}P-MR-spektroskopische Bildgebung ({sup 31}P-SI) wurde im Rahmen der praeoperativen Embolisationstherapie von Patienten mit Meningeomen als Methode zur Therapieverlaufskontrolle klinisch geprueft. Ziel der Studie war die nichtinvasive Erfassung von Veraenderungen im Metabolismus der Tumoren vor und nach Embolisation im Vergleich zum gesunden Hirngewebe. Methoden: Lokalisierte {sup 31}P-MR-Spektren des Gehirns wurden mit 2D-SI (Voxelgroesse: 36 cm{sup 3}) an einem 1,5-T-Ganzkoerper-MR-Tomographen aufgenommen. Ergebnisse: Elf von insgesamt 19 untersuchten Patienten unterzogen sich einer praeoperativen Embolisation, bei acht Patienten konnte eine Verlaufskontrolle durchgefuehrt werden. Nach Embolisation wurden Veraenderungen des pH und der Konzentrationen von energiereichen Phosphaten (Nukleosid
The business value of demand response for balance responsible parties
Jonsson, Mattias
2014-01-01
By using IT-solutions, the flexibility on the demand side in the electrical systems could be increased. This is called demand response and is part of the larger concept called smart grids. Previous work in this area has concerned the utilization of demand response by grid owners. In this thesis the focus will instead be shifted towards the electrical companies that have balance responsibility, and how they could use demand response in order to make profits. By investigating electrical applian...
IL-29 Enhances CXCL10 Production in TNF-α-stimulated Human Oral Epithelial Cells.
Hosokawa, Yoshitaka; Hosokawa, Ikuko; Shindo, Satoru; Ozaki, Kazumi; Matsuo, Takashi
2017-08-01
Interleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family. It was recently detected in the gingival crevicular fluid of periodontitis patients. However, the role of IL-29 in the pathogenesis of periodontal disease remains unknown. The aim of this study was to examine the effects of IL-29 on C-X-C motif chemokine ligand 10 (CXCL10) production in human oral epithelial cells. We measured CXCL10 production in TR146 cells, which is a human oral epithelial cell line, using an enzyme-linked immunosorbent assay. We used a Western blot analysis to detect IL-29 receptor expression and the phosphorylation levels of signal transduction molecules, including p38 mitogen-activated protein kinases (MAPK), signal transducer and activator of transcription 3 (STAT3), and nuclear factor (NF)- κB p65, in the TR146 cells. The TR146 cells expressed the IL-29 receptor. IL-29 induced CXCL10 production in the TR146 cells. IL-29 significantly enhanced CXCL10 production in tumor necrosis factor (TNF)-α-stimulated TR146 cells. The p38 MAPK, STAT3, and NF-κB pathways were found to be related to the IL-29-induced enhancement of CXCL10 production in TNF-α-stimulated TR146 cells. IL-29 promotes T helper 1-cell accumulation in periodontal lesions by inducing CXCL10 production in oral epithelial cells.
Energy Technology Data Exchange (ETDEWEB)
Block, W.; Traeber, F.; Kuhl, C.K.; Keller, E.; Rink, H.; Schild, H.H. [Bonn Univ. (Germany). Radiologische Klinik; Lamerichs, R. [Philips Medical Systems, Best (Netherlands); Karitzky, J. [Bonn Univ. (Germany). Neurologische Klinik
1998-03-01
Purpose: {sup 31}P-MR spectroscopy of skeletal muscle under ecercise was used to obtain the range of normal variation and comparison was made for different neuromascular diseases. Methods: 41 examinations of 24 volunteers and 41 investigations in 35 patients were performed on 1.5 T MR systems (Gyroscan S15 und S15/ACSII, Philips). Localised {sup 31}P-MR spectra of the calf muscle were obtained in time series with a resolution of 12 s. Results: Two types of muscle energy metabolism were identified from the pattern of spectroscopic time course in volunteers: While the first group was characterised by a remarkable decline to lower pH values during exercise, the second group showed only small pH shifts (minimum pH: 6.48{+-}0.13 vs 6.87{+-}0.07, p<10{sup -6}) although comparable workload conditions were maintained. The pH-values correlated well with blood lactate analysis. Patients with metabolic disorders and chronic fatigue syndrome (CFS) showed decreased resting values of PCr/(PCr+P{sub i}) and increased pH levels during exercise. PCr recovery was significantly delayed (0.31 vs 0.65 min{sup -1}, p<0.00005) in metabolic muscle disorders but was normal in CFS patients. Conclusion: Findings in volunteers indicate utilisation of different metabolic pathways which seems to be related to the fibre type composition of muscle. Reduced resting levels for PCr/(PCr+P{sub i}), altered pH time courses, and decreased PCr recovery seem to be helpful indicators for diagnosis of metabolic muscle disorders. (orig./MG) [Deutsch] Ziel: Bestimmung der Bandbreite des gesunden Energiestoffwechsels der peripheren Skelettmuskulatur mit Hilfe der {sup 31}P-MR-Spektroskopie als Grundlage der Diagnostik neuromuskulaerer Erkrankungen. Methoden: In Mehrfachuntersuchungen an 24 Probanden und 35 Patienten in 1,5 T MR-Systemen (Gyroscan S15 und S15/ACSII, Philips) wurden {sup 31}P-MR-Spektren unter Belastung akquiriert. Ergebnisse: Die Probanden liessen sich streng in zwei Gruppen einteilen
Energy Technology Data Exchange (ETDEWEB)
Starke, Michael R [ORNL; Kirby, Brendan J [ORNL; Kueck, John D [ORNL; Todd, Duane [Alcoa; Caulfield, Michael [Alcoa; Helms, Brian [Alcoa
2009-02-01
Demand response is the largest underutilized reliability resource in North America. Historic demand response programs have focused on reducing overall electricity consumption (increasing efficiency) and shaving peaks but have not typically been used for immediate reliability response. Many of these programs have been successful but demand response remains a limited resource. The Federal Energy Regulatory Commission (FERC) report, 'Assessment of Demand Response and Advanced Metering' (FERC 2006) found that only five percent of customers are on some form of demand response program. Collectively they represent an estimated 37,000 MW of response potential. These programs reduce overall energy consumption, lower green house gas emissions by allowing fossil fuel generators to operate at increased efficiency and reduce stress on the power system during periods of peak loading. As the country continues to restructure energy markets with sophisticated marginal cost models that attempt to minimize total energy costs, the ability of demand response to create meaningful shifts in the supply and demand equations is critical to creating a sustainable and balanced economic response to energy issues. Restructured energy market prices are set by the cost of the next incremental unit of energy, so that as additional generation is brought into the market, the cost for the entire market increases. The benefit of demand response is that it reduces overall demand and shifts the entire market to a lower pricing level. This can be very effective in mitigating price volatility or scarcity pricing as the power system responds to changing demand schedules, loss of large generators, or loss of transmission. As a global producer of alumina, primary aluminum, and fabricated aluminum products, Alcoa Inc., has the capability to provide demand response services through its manufacturing facilities and uniquely through its aluminum smelting facilities. For a typical aluminum smelter
International Nuclear Information System (INIS)
Wagner, S.; Chew, W.M.; Semelka, R.; Tomei, E.; Caputo, G.; O'Sullivan, M.; Chatterjee, K.; Parmley, W.W.; Wolfe, C.L.; Higgins, C.B.
1989-01-01
The purpose of the study was to use MR imaging and P-31 spectroscopy for the functional and metabolic characterization of patients with hypertrophic cardiomyopathy (HCM). Nine patients with HCM underwent combined P-31 spectroscopy (one-dimensional chemical shift imaging) and MR imaging at 1.5 T. MR imaging localized the distribution of ventricular hypertrophy and cine MR imaging quantitated cardiac volumes, contractility, and left ventricular mass. The phosphodiester/phosphocreatine ratio (PDE/PCr) in six HCM patients was not different from normal, but in three patients it was significantly (P <.01) higher. This finding could not be attributed to contractible abnormalities, the distribution of hypertrophy, or the left ventricular mass. The abnormal PDE/PCr ratio was found only in patients with echocardiographic findings of resting left ventricular outflow obstruction but was not associated with severity or distribution of hypertrophy. The study shows the use of combined MR imaging and MR spectroscopy to characterize HCM and possibly to identify abnormal myocardial tissue
Strategies for Demand Response in Commercial Buildings
Energy Technology Data Exchange (ETDEWEB)
Watson, David S.; Kiliccote, Sila; Motegi, Naoya; Piette, Mary Ann
2006-06-20
This paper describes strategies that can be used in commercial buildings to temporarily reduce electric load in response to electric grid emergencies in which supplies are limited or in response to high prices that would be incurred if these strategies were not employed. The demand response strategies discussed herein are based on the results of three years of automated demand response field tests in which 28 commercial facilities with an occupied area totaling over 11 million ft{sup 2} were tested. Although the demand response events in the field tests were initiated remotely and performed automatically, the strategies used could also be initiated by on-site building operators and performed manually, if desired. While energy efficiency measures can be used during normal building operations, demand response measures are transient; they are employed to produce a temporary reduction in demand. Demand response strategies achieve reductions in electric demand by temporarily reducing the level of service in facilities. Heating ventilating and air conditioning (HVAC) and lighting are the systems most commonly adjusted for demand response in commercial buildings. The goal of demand response strategies is to meet the electric shed savings targets while minimizing any negative impacts on the occupants of the buildings or the processes that they perform. Occupant complaints were minimal in the field tests. In some cases, ''reductions'' in service level actually improved occupant comfort or productivity. In other cases, permanent improvements in efficiency were discovered through the planning and implementation of ''temporary'' demand response strategies. The DR strategies that are available to a given facility are based on factors such as the type of HVAC, lighting and energy management and control systems (EMCS) installed at the site.
Option value of electricity demand response
Energy Technology Data Exchange (ETDEWEB)
Sezgen, Osman; Goldman, C.A. [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley CA 94720 (United States); Krishnarao, P. [Citigroup Energy Inc., 1301 Fannin St, Houston, TX 77002 (United States)
2007-02-15
As electricity markets deregulate and energy tariffs increasingly expose customers to commodity price volatility, it is difficult for energy consumers to assess the economic value of investments in technologies that manage electricity demand in response to changing energy prices. The key uncertainties in evaluating the economics of demand-response technologies are the level and volatility of future wholesale energy prices. In this paper, we demonstrate that financial engineering methodologies originally developed for pricing equity and commodity derivatives (e.g., futures, swaps, options) can be used to estimate the value of demand-response technologies. We adapt models used to value energy options and assets to value three common demand-response strategies: load curtailment, load shifting or displacement, and short-term fuel substitution-specifically, distributed generation. These option models represent an improvement to traditional discounted cash flow methods for assessing the relative merits of demand-side technology investments in restructured electricity markets. (author)
Option value of electricity demand response
International Nuclear Information System (INIS)
Sezgen, Osman; Goldman, C.A.; Krishnarao, P.
2007-01-01
As electricity markets deregulate and energy tariffs increasingly expose customers to commodity price volatility, it is difficult for energy consumers to assess the economic value of investments in technologies that manage electricity demand in response to changing energy prices. The key uncertainties in evaluating the economics of demand-response technologies are the level and volatility of future wholesale energy prices. In this paper, we demonstrate that financial engineering methodologies originally developed for pricing equity and commodity derivatives (e.g., futures, swaps, options) can be used to estimate the value of demand-response technologies. We adapt models used to value energy options and assets to value three common demand-response strategies: load curtailment, load shifting or displacement, and short-term fuel substitution-specifically, distributed generation. These option models represent an improvement to traditional discounted cash flow methods for assessing the relative merits of demand-side technology investments in restructured electricity markets. (author)
Aggregated Demand Modelling Including Distributed Generation, Storage and Demand Response
Marzooghi, Hesamoddin; Hill, David J.; Verbic, Gregor
2014-01-01
It is anticipated that penetration of renewable energy sources (RESs) in power systems will increase further in the next decades mainly due to environmental issues. In the long term of several decades, which we refer to in terms of the future grid (FG), balancing between supply and demand will become dependent on demand actions including demand response (DR) and energy storage. So far, FG feasibility studies have not considered these new demand-side developments for modelling future demand. I...
75 FR 15362 - Demand Response Compensation in Organized Wholesale Energy Markets
2010-03-29
.... We propose that Independent System Operators (ISOs) and Regional Transmission Organizations (RTOs) \\3... resource means a resource capable of providing demand response. 18 CFR 35.28(b)(5). \\3\\ The following RTOs... and RTOs administer for reliability or emergency conditions, such as, for instance, Midwest ISO's...
Directory of Open Access Journals (Sweden)
Sidan Tian
2016-06-01
Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA
International Nuclear Information System (INIS)
Gyamfi, Samuel; Krumdieck, Susan
2011-01-01
Peak demand on electricity grids is a growing problem that increases costs and risks to supply security. Residential sector loads often contribute significantly to seasonal and daily peak demand. Demand response projects aim to manage peak demand by applying price signals and automated load shedding technologies. This research investigates voluntary load shedding in response to information about the security of supply, the emission profile and the cost of meeting critical peak demand in the customers' network. Customer willingness to change behaviour in response to this information was explored through mail-back survey. The diversified demand modelling method was used along with energy audit data to estimate the potential peak load reduction resulting from the voluntary demand response. A case study was conducted in a suburb of Christchurch, New Zealand, where electricity is the main source for water and space heating. On this network, all water heating cylinders have ripple-control technology and about 50% of the households subscribe to differential day/night pricing plan. The survey results show that the sensitivity to supply security is on par with price, with the emission sensitivity being slightly weaker. The modelling results show potential 10% reduction in critical peak load for aggregate voluntary demand response. - Highlights: → Multiple-factor behaviour intervention is necessarily for effective residential demand response. → Security signals can achieve result comparable to price. → The modelling results show potential 10% reduction in critical peak load for aggregate voluntary demand response. → New Zealand's energy policy should include innovation and development of VDR programmes and technologies.
Curvo-Semedo, Luís; Lambregts, Doenja M J; Maas, Monique; Thywissen, Thomas; Mehsen, Rana T; Lammering, Guido; Beets, Geerard L; Caseiro-Alves, Filipe; Beets-Tan, Regina G H
2011-09-01
To determine diagnostic performance of diffusion-weighted (DW) magnetic resonance (MR) imaging for assessment of complete tumor response (CR) after combined radiation therapy with chemotherapy (CRT) in patients with locally advanced rectal cancer (LARC) by means of volumetric signal intensity measurements and apparent diffusion coefficient (ADC) measurements and to compare the performance of DW imaging with that of T2-weighted MR volumetry. A retrospective analysis of 50 patients with LARC, for whom clinical and imaging data were retrieved from a previous imaging study approved by the local institutional ethical committee and for which all patients provided informed consent, was conducted. Patients underwent pre- and post-CRT standard T2-weighted MR and DW MR. Two independent readers placed free-hand regions of interest (ROIs) in each tumor-containing section on both data sets to determine pre- and post-CRT tumor volumes and tumor volume reduction rates (volume). ROIs were copied to an ADC map to calculate tumor ADCs. Histopathologic findings were the standard of reference. Receiver operating characteristic (ROC) curves were generated to compare performance of T2-weighted and DW MR volumetry and ADC. The intraclass correlation coefficient (ICC) was used to evaluate interobserver variability and the correlation between T2-weighted and DW MR volumetry. Areas under the ROC curve (AUCs) for identification of a CR that was based on pre-CRT volume, post-CRT volume, and volume, respectively, were 0.57, 0.70, and 0.84 for T2-weighted MR versus 0.63, 0.93, and 0.92 for DW MR volumetry (P = .15, .02, .42). Pre- and post-CRT ADC and ADC AUCs were 0.55, 0.54, and 0.51, respectively. Interobserver agreement was excellent for all pre-CRT measurements (ICC, 0.91-0.96) versus good (ICC, 0.61-0.79) for post-CRT measurements. ICC between T2-weighted and DW MR volumetry was excellent (0.97) for pre-CRT measurements versus fair (0.25) for post-CRT measurements. Post-CRT DW MR
TH-CD-BRA-06: Magnetic Field Effects On Gafchromic-Film Response in MR-IGRT
International Nuclear Information System (INIS)
Reynoso, F; Curcuru, A; Green, O; Mutic, S; Santanam, L; Das, I
2016-01-01
Purpose: To investigate the effects of magnetic fields in radiochromic films (RCF). Magnetokinetic changes may affect crystal orientation and polymerization within active layer of RCF, these effects are investigated in Magnetic Resonance Image-guided Radiotherapy (MR-IGRT). Methods: Gafchromic EBT2 RCF were irradiated in a 30×30×30 cm 3 solid water phantom using a ViewRay MRIdian Co-60 MRI guided radiotherapy system (B=0.35 T). Fifteen 20.3×25.4 cm 2 EBT2 film sheets were placed at three different depths (d=0.5, 5 and 10 cm) and irradiated using 5 different treatment plans. The plans were computed using the MRIdian treatment planning system to deliver 2, 4, 6, 8, and 10 Gy at a depth of 10 cm. The films were scanned using an Epson Expression 10000 XL flat-bed document scanner in transmission mode. Films were processed before and after irradiation to obtain a net optical density (netOD) for each color channel separately. Scanning electron microscope (SEM) images were obtained to compare the active layer of selected samples. Results: The results show the red channel netOD decreases between 1.3–12.3 % (average of 5.95 %) for doses above 2.8 Gy, with a linear increase in this effect for higher doses. Green channel netOD showed similar results with a decrease between 1.2–10.5 % (average of 4.09 %) for doses above 3.5 Gy. Blue channel showed the weakest effect between 1.3–2.9 % (average of 1.94 %) for doses above 8.0 Gy. SEM images show changes in crystal orientation within active layer in RCF exposed in a magnetic field. Conclusion: The presence of a magnetic field affects crystal orientation and polymerization during irradiation, decreasing netOD by an average of 5.95 % in the red channel. The under response is dependent on dose and differs by up to 12.3 % at 17.6 Gy. The results show that magnetokinetic effects should be carefully considered in MR-IGRT.
MR imaging of posttraumatic spinal ligament injury
International Nuclear Information System (INIS)
Pathria, M.N.; Emery, S.; Masaryk, T.J.; Wilber, R.G.; Bohlman, H.
1988-01-01
The accuracy of MR imaging in the detection of ligamentous injury was evaluated in 29 patients (24 male, five female) with spinal injury resulting in fractures (n=27), evidence of instability (n=11), or neurologic deficit (n=2). MR examinations were performed acutely (average, 7.5 days posttrauma) with T1- and T2-weighted imaging and were blindly evaluated. Subsequently, plain films (n=27), tomograms (n=10), and CT scans (n=22) were evaluated. Eighteen patients underwent surgery. Fourteen patients had torn ligaments as indicated by clinical and surgical findings. MR imaging demonstrated ligament damage in 13. One case imaged 40 days following trauma was not detected. No patients with intact ligaments had evidence of ligamentous damage on MR images. MR imaging demonstrated retropulsed fractures in six patients in whom the posterior longitudinal ligament was intact but displaced from the vertebra. MR imaging was more reliable than radiography and CT for detection of ligamentous injury, and T2- weighted sequences are essential in such cases
RAC1 P29S regulates PD-L1 expression in melanoma
Vu, Ha Linh; Rosenbaum, Sheera; Purwin, Timothy J.; Davies, Michael A.; Aplin, Andrew E.
2015-01-01
Summary Whole exome sequencing of cutaneous melanoma has led to the detection of P29 mutations in RAC1 in 5–9% of samples, but the role of RAC1 P29 mutations in melanoma biology remains unclear. Using reverse phase protein array analysis to examine the changes in protein/phospho-protein expression, we identified cyclin B1, PD-L1, Ets-1, and Syk as being selectively upregulated with RAC1 P29S expression and downregulated with RAC1 P29S depletion. Using the melanoma patient samples in TCGA, we found PD-L1 expression to be significantly increased in RAC1 P29S patients compared to RAC1 WT as well as other RAC1 mutants. The finding that PD-L1 is upregulated suggests that oncogenic RAC1 P29S may promote suppression of the antitumor immune response. This is a new insight into the biological function of RAC1 P29S mutations with potential clinical implications as PD-L1 is a candidate biomarker for increased benefit from treatment with anti-PD1 or anti-PD-L1 antibodies. PMID:26176707
Market design for rapid demand response
DEFF Research Database (Denmark)
Nielsen, Kurt; Tamirat, Tseganesh Wubale
We suggest a market design for rapid demand response in electricity markets. The solution consists of remotely controlled switches, meters, forecasting models as well as a flexible auction market to set prices and select endusers job by job. The auction market motivates truth-telling and makes...... it simple to involve the endusers in advance and to activate demand response immediately. The collective solution is analyzed and economic simulations are conducted for the case of Kenya. Kenya has been su ering from unreliable electricity supply for many years and companies and households have learned...... to adjust by investments in backup generators. We focus on turning the many private backup generators into a demand response system. The economic simulation focuses on possible distortion introduced by various ways of splitting the generated surplus from the demand response system. An auction run instantly...
Tomporowski, Phillip D.; Tinsley, Veronica
1994-01-01
The vigilance of young adults with and without mild mental retardation (MR) was compared, with subjects performing two memory demanding, cognitively based tests. The vigilance decrement of MR adults declined more rapidly than did the vigilance of non-MR adults, due to an interaction between target detectability and response bias, and poor target…
2010-01-01
... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction Landing Gear § 29.735 Brakes. For... dry, smooth pavement. [Doc. No. 5084, 29 FR 16150, Dec. 3, 1964, as amended by Amdt. 29-24, 49 FR...
2011-07-26
.... (32 FR 4001). Snake, copperbelly water....... Nerodia Threatened IN north of January 29, 1997... in the List, and improved analytical methods. For the copperbelly water snake, we specifically... A, Columbia, MO 65203-0007. Indiana bat Mr. Andrew King, (812) 334-4261, extension Bloomington Field...
Fast MR imaging and ultrafast MR imaging of fetal central nervous system abnormalities
Energy Technology Data Exchange (ETDEWEB)
Shakudo, Miyuki; Manabe, Takao; Murata, Katsuko; Matsuo, Ryoichi; Oda, Junro [Osaka City General Hospital (Japan); Inoue, Yuichi; Mochizuki, Kunizo; Yamada, Ryusaku
2001-12-01
The aims of this study were two: to compare the efficacy of fast MRI (breath-hold fast spin-echo T2-weighted and fast gradient-echo T1-weighted sequence) and ultrafast MRI (half-Fourier acquisition single-shot turbo spin-echo sequence) in evaluation of fetal central nervous system (CNS) abnormalities at late gestational age, and to compare the capability of fast MRI and ultrafast MRI to assess fetal CNS abnormalities with that of prenatal ultrasonography (US). Forty-nine women with fetuses at gestational ages of 26-39 weeks underwent fast MRI (29 patients) or ultrafast MRI (20 patients). In detection of motion artifact, visualization of the lateral and 4th ventricles, and differentiation between gray and white matter in cerebral hemispheres, ultrafast MRI was significantly superior to fast MRI (p<0.0001, Mann-Whitney U test). In 25 of 43 cases, US and MR diagnoses were the same and consistent with postnatal diagnosis. In 10 of 43 cases, MRI demonstrated findings additional to or different from those of US, and MR findings were confirmed postnatally. MRI, particularly ultrafast MRI, is useful for demonstrating CNS abnormalities in situations in which US is suggestive but not definitive. (author)
An analytical approach to activating demand elasticity with a demand response mechanism
International Nuclear Information System (INIS)
Clastres, Cedric; Khalfallah, Haikel
2015-01-01
The aim of this work is to demonstrate analytically the conditions under which activating the elasticity of consumer demand could benefit social welfare. We have developed an analytical equilibrium model to quantify the effect of deploying demand response on social welfare and energy trade. The novelty of this research is that it demonstrates the existence of an optimal area for the price signal in which demand response enhances social welfare. This optimal area is negatively correlated to the degree of competitiveness of generation technologies and the market size of the system. In particular, it should be noted that the value of un-served energy or energy reduction which the producers could lose from such a demand response scheme would limit its effectiveness. This constraint is even greater if energy trade between countries is limited. Finally, we have demonstrated scope for more aggressive demand response, when only considering the impact in terms of consumer surplus. (authors)
Voltage Controlled Dynamic Demand Response
DEFF Research Database (Denmark)
Bhattarai, Bishnu Prasad; Bak-Jensen, Birgitte; Mahat, Pukar
2013-01-01
Future power system is expected to be characterized by increased penetration of intermittent sources. Random and rapid fluctuations in demands together with intermittency in generation impose new challenges for power balancing in the existing system. Conventional techniques of balancing by large...... central or dispersed generations might not be sufficient for future scenario. One of the effective methods to cope with this scenario is to enable demand response. This paper proposes a dynamic voltage regulation based demand response technique to be applied in low voltage (LV) distribution feeders....... An adaptive dynamic model has been developed to determine composite voltage dependency of an aggregated load on feeder level. Following the demand dispatch or control signal, optimum voltage setting at the LV substation is determined based on the voltage dependency of the load. Furthermore, a new technique...
49 CFR 10.29 - Social Security numbers.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Social Security numbers. 10.29 Section 10.29... INDIVIDUALS Maintenance of Records § 10.29 Social Security numbers. (a) No individual is denied any right... which is required by Federal statute; or (2) The disclosure of a Social Security number when such...
76 FR 16657 - Demand Response Compensation in Organized Wholesale Energy Markets
2011-03-24
... 13, 2010 Comments at 11; Viridity June 18, 2010 Comments at 5. [Demand response] is in all essential...; Potomac Economics; PG&E; Ohio Commission; Robert L. Borlick; Roy Shanker; and RRI Energy. \\58\\ See... at 6; PSEG at 5; and Potomac Economics at 6-8. \\60\\ Attachment to Answer of EPSA, Providing...
Smart Buildings and Demand Response
Kiliccote, Sila; Piette, Mary Ann; Ghatikar, Girish
2011-11-01
Advances in communications and control technology, the strengthening of the Internet, and the growing appreciation of the urgency to reduce demand side energy use are motivating the development of improvements in both energy efficiency and demand response (DR) systems in buildings. This paper provides a framework linking continuous energy management and continuous communications for automated demand response (Auto-DR) in various times scales. We provide a set of concepts for monitoring and controls linked to standards and procedures such as Open Automation Demand Response Communication Standards (OpenADR). Basic building energy science and control issues in this approach begin with key building components, systems, end-uses and whole building energy performance metrics. The paper presents a framework about when energy is used, levels of services by energy using systems, granularity of control, and speed of telemetry. DR, when defined as a discrete event, requires a different set of building service levels than daily operations. We provide examples of lessons from DR case studies and links to energy efficiency.
75 FR 47499 - Demand Response Compensation in Organized Wholesale Energy Markets
2010-08-06
... Potomac Economics at 3; Comments of Massachusetts Attorney General and Maine Public Advocate at 11... response regime.\\29\\ \\26\\ ISO-NE Comments at 5, 40; Comments of PJM at 8; Comments of Potomac Economics at... address other broad principles the Commission could use to determine the cost allocation method. (3) How...
Analyses of demand response in Denmark
International Nuclear Information System (INIS)
Moeller Andersen, F.; Grenaa Jensen, S.; Larsen, Helge V.; Meibom, P.; Ravn, H.; Skytte, K.; Togeby, M.
2006-10-01
Due to characteristics of the power system, costs of producing electricity vary considerably over short time intervals. Yet, many consumers do not experience corresponding variations in the price they pay for consuming electricity. The topic of this report is: are consumers willing and able to respond to short-term variations in electricity prices, and if so, what is the social benefit of consumers doing so? Taking Denmark and the Nord Pool market as a case, the report focuses on what is known as short-term consumer flexibility or demand response in the electricity market. With focus on market efficiency, efficient allocation of resources and security of supply, the report describes demand response from a micro-economic perspective and provides empirical observations and case studies. The report aims at evaluating benefits from demand response. However, only elements contributing to an overall value are presented. In addition, the analyses are limited to benefits for society, and costs of obtaining demand response are not considered. (au)
Opportunities for Automated Demand Response in California Agricultural Irrigation
Energy Technology Data Exchange (ETDEWEB)
Olsen, Daniel [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Aghajanzadeh, Arian [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); McKane, Aimee [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-08-01
Pumping water for agricultural irrigation represents a significant share of California’s annual electricity use and peak demand. It also represents a large source of potential flexibility, as farms possess a form of storage in their wetted soil. By carefully modifying their irrigation schedules, growers can participate in demand response without adverse effects on their crops. This report describes the potential for participation in demand response and automated demand response by agricultural irrigators in California, as well as barriers to widespread participation. The report first describes the magnitude, timing, location, purpose, and manner of energy use in California. Typical on-farm controls are discussed, as well as common impediments to participation in demand response and automated demand response programs. Case studies of demand response programs in California and across the country are reviewed, and their results along with overall California demand estimates are used to estimate statewide demand response potential. Finally, recommendations are made for future research that can enhance the understanding of demand response potential in this industry.
Bladder carcinoma. Apport MR imaging
International Nuclear Information System (INIS)
Roy, C.; Spittler, G.; Jacqmin, D.; Morel, M.
1991-01-01
Bladder carcinoma is the second most commun cause of urogenital tumor. It is suspected by abdominal ultrasound and prouved by cystoscopy with biopsy. At present, MR Imaging is the most accurate diagnostic modality for loco-regional staging. Urography is still useful to appreciate urinary tract [fr
Lighting Systems Control for Demand Response
Husen, S.A.; Pandharipande, A.; Tolhuizen, L.M.G.; Wang, Y.; Zhao, M.
2012-01-01
Lighting is a major part of energy consumption in buildings. Lighting systems will thus be one of the important component systems of a smart grid for dynamic load management services like demand response.In the scenario considered in this paper, under a demand response request, lighting systems in a
Demand Response and Energy Storage Integration Study
Energy Technology Data Exchange (ETDEWEB)
Ma, Ookie; Cheung, Kerry; Olsen, Daniel J.; Matson, Nance; Sohn, Michael D.; Rose, Cody M.; Dudley, Junqiao Han; Goli, Sasank; Kiliccote, Sila; Cappers, Peter; MacDonald, Jason; Denholm, Paul; Hummon, Marissa; Jorgenson, Jennie; Palchak, David; Starke, Michael; Alkadi, Nasr; Bhatnagar, Dhruv; Currier, Aileen; Hernandez, Jaci; Kirby, Brendan; O' Malley, Mark
2016-03-01
Demand response and energy storage resources present potentially important sources of bulk power system services that can aid in integrating variable renewable generation. While renewable integration studies have evaluated many of the challenges associated with deploying large amounts of variable wind and solar generation technologies, integration analyses have not yet fully incorporated demand response and energy storage resources. This report represents an initial effort in analyzing the potential integration value of demand response and energy storage, focusing on the western United States. It evaluates two major aspects of increased deployment of demand response and energy storage: (1) Their operational value in providing bulk power system services and (2) Market and regulatory issues, including potential barriers to deployment.
Refrigerated Warehouse Demand Response Strategy Guide
Energy Technology Data Exchange (ETDEWEB)
Scott, Doug [VaCom Technologies, San Luis Obispo, CA (United States); Castillo, Rafael [VaCom Technologies, San Luis Obispo, CA (United States); Larson, Kyle [VaCom Technologies, San Luis Obispo, CA (United States); Dobbs, Brian [VaCom Technologies, San Luis Obispo, CA (United States); Olsen, Daniel [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-11-01
This guide summarizes demand response measures that can be implemented in refrigerated warehouses. In an appendix, it also addresses related energy efficiency opportunities. Reducing overall grid demand during peak periods and energy consumption has benefits for facility operators, grid operators, utility companies, and society. State wide demand response potential for the refrigerated warehouse sector in California is estimated to be over 22.1 Megawatts. Two categories of demand response strategies are described in this guide: load shifting and load shedding. Load shifting can be accomplished via pre-cooling, capacity limiting, and battery charger load management. Load shedding can be achieved by lighting reduction, demand defrost and defrost termination, infiltration reduction, and shutting down miscellaneous equipment. Estimation of the costs and benefits of demand response participation yields simple payback periods of 2-4 years. To improve demand response performance, it’s suggested to install air curtains and another form of infiltration barrier, such as a rollup door, for the passageways. Further modifications to increase efficiency of the refrigeration unit are also analyzed. A larger condenser can maintain the minimum saturated condensing temperature (SCT) for more hours of the day. Lowering the SCT reduces the compressor lift, which results in an overall increase in refrigeration system capacity and energy efficiency. Another way of saving energy in refrigerated warehouses is eliminating the use of under-floor resistance heaters. A more energy efficient alternative to resistance heaters is to utilize the heat that is being rejected from the condenser through a heat exchanger. These energy efficiency measures improve efficiency either by reducing the required electric energy input for the refrigeration system, by helping to curtail the refrigeration load on the system, or by reducing both the load and required energy input.
Addressing Energy Demand through Demand Response. International Experiences and Practices
Energy Technology Data Exchange (ETDEWEB)
Shen, Bo [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ghatikar, Girish [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ni, Chun Chun [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Dudley, Junqiao [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Martin, Phil [Enernoc, Inc., Boston, MA (United States); Wikler, Greg
2012-06-01
Demand response (DR) is a load management tool which provides a cost-effective alternative to traditional supply-side solutions to address the growing demand during times of peak electrical load. According to the US Department of Energy (DOE), demand response reflects “changes in electric usage by end-use customers from their normal consumption patterns in response to changes in the price of electricity over time, or to incentive payments designed to induce lower electricity use at times of high wholesale market prices or when system reliability is jeopardized.” 1 The California Energy Commission (CEC) defines DR as “a reduction in customers’ electricity consumption over a given time interval relative to what would otherwise occur in response to a price signal, other financial incentives, or a reliability signal.” 2 This latter definition is perhaps most reflective of how DR is understood and implemented today in countries such as the US, Canada, and Australia where DR is primarily a dispatchable resource responding to signals from utilities, grid operators, and/or load aggregators (or DR providers).
Davis, J R; Sheppard, M C; Shakespear, R A; Lynch, S S; Clayton, R N
1986-02-01
It is unclear whether growth hormone releasing factor (GRF) administration in vivo may desensitize the somatotroph. To investigate this possibility we have examined the effects of 10-h infusion of the equipotent 1-29 amide analogue of hpGRF on serum GH levels and on the subsequent GH response to a bolus dose of GRF (1-29). Four normal adult males received an intravenous infusion of 1-29 GRF (1 microgram/kg/h) from 0800 to 1800 h, with blood samples taken at 10 min intervals. A 100 micrograms intravenous bolus dose of GRF was given at 1800 h, and sampling continued for a further 90 min. GH levels were near or below the limit of detection (0.5 mU/l) throughout the control 10 h period. During GRF infusion there was increased GH release with pulses of irregular frequency and amplitude (up to 80 mU/l) continuing throughout the entire infusion period. There was no apparent reduction in total GH released towards the latter part of the infusion. On the control day, 100 micrograms GRF bolus increased mean (+/- SEM) GH from 0.82 +/- 0.21 mU/l to a peak of 59.0 +/- 44.8 mU/l (P less than 0.002). Following 10-GRF infusion, responses to bolus injection of GRF were reduced, but variable. In two subjects a small rise in GH levels occurred (basal 6.4 and 7.2 rising to peak values of 11.2 and 23.0 mU/l respectively). In the other two subjects, GH levels fell but in these the GRF bolus had coincided with a GH peak. The loss of GRF responsiveness after GRF infusion may be due to 'desensitization'.(ABSTRACT TRUNCATED AT 250 WORDS)
Demand Response in Smart Grids
DEFF Research Database (Denmark)
Hansen, Jacob; Knudsen, Jesper Viese; Annaswamy, Anuradha M.
2014-01-01
In recent decades, moves toward higher integration of Renewable Energy Resources have called for fundamental changes in both the planning and operation of the overall power grid. One such change is the incorporation of Demand Response (DR), the process by which consumers can adjust their demand...
7 CFR 29.1166 - Primings (P Group).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Primings (P Group). 29.1166 Section 29.1166... REGULATIONS TOBACCO INSPECTION Standards Grades § 29.1166 Primings (P Group). This group consists of round-tipped leaves from the lowest portion of the stalk. Leaves of the P group ripen prematurely as a result...
2013-06-25
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL13-74-000] Demand Response... Practice and Procedure of the Federal Energy Regulatory Commission (Commission), 18 CFR 385.206, Demand..., Inc. (NYISO or Respondents), seeking an order requiring NYISO to amend its tariffs to allow demand...
Analysis of cardiac energy metabolism in valve disease using 31P-MR-spectroscopy
International Nuclear Information System (INIS)
Beer, M.; Viehrig, M.; Seyfarth, T.; Sandstede, J.; Lipke, C.; Pabst, T.; Kenn, W.; Hahn, D.; Harre, K.; Horn, M.; Neubauer, S.; Landschuetz, W.; Kienlin, M. von
2000-01-01
Patients and methods: 10 healthy volunteers and 10 patients with aortic stenosis (pressure gradients >60 mmHg) were included. For assessment of energy metabolism, 31 P-MR spectra were obtained with a double oblique 3D-CSI technique (voxel size 25 cm 3 ). In 5 of 10 patients, follow-up examination was performed 3 months after surgical valve replacement (SVR). Left ventricular (LV) function was analyzed by cine MRI. Results: Before SVR the myocardial phosphocreatine to adenosinetriphosphate (PCr-ATP) ratio was significantly (p=0.0002) reduced to 0.80±0.25 in patients compared to 1.65±0.21 in volunteers. 3 months after SVR, LV mass had significantly (p=0.04) decreased from 238±33 g to 206±47 g. At the same time a significant (p=0.04) increase of the PCr-ATP ratio from 0.80±0.25 to 1.28±0.22 was observed. A slight, but not significant, reduction of the phosphodiester ATP ratio was observed before SVR, with a trend towards normalization after SVR. (orig.) [de
Directory of Open Access Journals (Sweden)
Sh. Jafari
2016-02-01
Full Text Available Background: Cystic echinococcosis or hydatid disease is a widely endemic helminthic zoonotic disease caused by infection with metacestodes the larval stage of the tapeworm Echinococcus granulosus. P-29, a 29-kDa antigen from E. granulosus, is a protoscolex specific component. The immunologic cross reactivity between P-29 and a major diagnostic antigen of E. granulosus (Ag5 indicated that P-29 might be another useful antigen of E. granulosus to be used in diagnosis or in multi epitope vaccines to prevent secondary echinococcosis. In this study, the peptide epitope regions after the identification and synthesis were evaluated in order to determine the effect of stimulating an immune response in a mouse model. Methods: In this study, the p29 antigen epitope regions of the parasite Echinococcus granulosus detected by the IEDB Bioinformatics software and a 8 amino acids sequence were synthesized. BALB/c mice were immunized subcutaneously three times with two weeks interval. Fourteen days after last immunization spleen tissues were extracted and splenocytes were cultured in presence of antigen for 72 hours. Supernatants were collected and used for cytokine assay by Quantikine ELISA kit. Results: Sandwich ELISA results were analyzed and showed significant difference in IFN-γ but no significant differences observed in levels of two cytokines IL-4, IL-10, between immunized and control groups. Conclusion: This study has assessed the effect of synthetic peptide EgP-29aa134-142 on the immune response and our results showed that the peptide can increase IFN-γ and therefore induce activation of innate Immunity as well as CTL and Th1 response.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Sound. 29.3546 Section 29.3546 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Type 95) § 29.3546 Sound. Free of damage. [30 FR 9207, July 23, 1965. Redesignated at 49 FR 16759, Apr...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Sound. 29.1058 Section 29.1058 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Type 92) § 29.1058 Sound. Free of damage. [42 FR 21092, Apr. 25, 1977. Redesignated at 47 FR 51721, Nov...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Sound. 29.3056 Section 29.3056 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Sound. Free of damage. [24 FR 8771, Oct. 29, 1959. Redesignated at 47 FR 51722, Nov. 17, 1982, and at 49...
Demand Response as a System Reliability Resource
Energy Technology Data Exchange (ETDEWEB)
Eto, Joseph H. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Environmental Energy Technologies Division; Lewis, Nancy Jo [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Environmental Energy Technologies Division; Watson, David [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Environmental Energy Technologies Division; Kiliccote, Sila [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Environmental Energy Technologies Division; Auslander, David [Univ. of California, Berkeley, CA (United States); Paprotny, Igor [Univ. of California, Berkeley, CA (United States); Makarov, Yuri [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2012-12-31
The Demand Response as a System Reliability Resource project consists of six technical tasks: • Task 2.1. Test Plan and Conduct Tests: Contingency Reserves Demand Response (DR) Demonstration—a pioneering demonstration of how existing utility load-management assets can provide an important electricity system reliability resource known as contingency reserve. • Task 2.2. Participation in Electric Power Research Institute (EPRI) IntelliGrid—technical assistance to the EPRI IntelliGrid team in developing use cases and other high-level requirements for the architecture. • Task 2.3. Research, Development, and Demonstration (RD&D) Planning for Demand Response Technology Development—technical support to the Public Interest Energy Research (PIER) Program on five topics: Sub-task 1. PIER Smart Grid RD&D Planning Document; Sub-task 2. System Dynamics of Programmable Controllable Thermostats; Sub-task 3. California Independent System Operator (California ISO) DR Use Cases; Sub-task 4. California ISO Telemetry Requirements; and Sub-task 5. Design of a Building Load Data Storage Platform. • Task 2.4. Time Value of Demand Response—research that will enable California ISO to take better account of the speed of the resources that it deploys to ensure compliance with reliability rules for frequency control. • Task 2.5. System Integration and Market Research: Southern California Edison (SCE)—research and technical support for efforts led by SCE to conduct demand response pilot demonstrations to provide a contingency reserve service (known as non-spinning reserve) through a targeted sub-population of aggregated residential and small commercial customers enrolled in SCE’s traditional air conditioning (AC) load cycling program, the Summer Discount Plan. • Task 2.6. Demonstrate Demand Response Technologies: Pacific Gas and Electric (PG&E)—research and technical support for efforts led by PG&E to conduct a demand response pilot demonstration to provide non
Energy Technology Data Exchange (ETDEWEB)
Hummon, Marissa [National Renewable Energy Lab. (NREL), Golden, CO (United States); Palchak, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Denholm, Paul [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jorgenson, Jennie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Olsen, Daniel J. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Kiliccote, Sila [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Matson, Nance [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Sohn, Michael [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Rose, Cody [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Dudley, Junqiao [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Goli, Sasank [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ma, Ookie [U.S. Dept. of Energy, Washington, DC (United States)
2013-12-01
This report is one of a series stemming from the U.S. Department of Energy (DOE) Demand Response and Energy Storage Integration Study. This study is a multi-national-laboratory effort to assess the potential value of demand response (DR) and energy storage to electricity systems with different penetration levels of variable renewable resources and to improve our understanding of associatedmarkets and institutions. This report implements DR resources in the commercial production cost model PLEXOS.
Energy Technology Data Exchange (ETDEWEB)
Herber, S.; Kalden, P.; Kreitner, K.-F.; Thelen, M. [Tuebingen Univ. (Germany). Klinik und Poliklinik fuer Radiologie; Riedel, C.; Rompe, J.D. [Klinik und Poliklinik fuer Orthopaedie Johannes-Gutenberg-Univ. Mainz (Germany)
2001-05-01
Purpose: Evaluation of the diagnostic value and confidence of contrast-enhanced MR imaging in patients with lateral epicondylitis in comparison to clinical diagnosis. Material and Methods: 42 consecutive patients with clinically proven chronic lateral epicondylitis and 10 ellbow joints of healthy controls have been examined on a 1.0 T MR-unit. Criteria for inclusion in the prospective study were: persistant pain and a failed conservative therapy. The MR protocol included STIR sequence, a native, T{sub 2}-weighted, fat-supressed TSE sequence, and a flash-2-D sequence. Also, fat-supressed, T{sub 1}-weighted SE sequences before and after administration of Gd-DTPA contrast media have been recovded. Results: In 39/42 patients the STIR sequence showed an increased SI of the common extensor tendom. Increased MR signal of the lateral collateral ligament combined with a thickening and a partial rupture or a full thickness tear have been observed in 15/42 cases. A bone marrow edema at the lateral epicondylus was noticed in 6 of the studied patients and a joint effusion in 18/42 patients. After administration of contrast media we noticed an average increase of SI by about 150%. However, enhanced MR imaging did not provide additional information. Conclusion: In MR imaging of chronic epicondylitis administration of gadolinium-DTPA does not provide additional information. (orig.) [German] Zielsetzung: Evaluation der Wertigkeit der Gadolinium-DTPA-Gabe in der MR-Diagnostik der chronischen Epicondylitis humeri radialis im Vergleich zur klinischen Befunderhebung. Material und Methoden: 42 konsekutive Patienten mit einer klinisch diagnostizierten chronischen Epicondylitis humeri radialis sowie 10 Ellenbogengelenke bei 5 Probanden wurden bei 1,0 T prospektiv untersucht. Einschlusskriterium war eine persistierende Schmerzsymptomatik ueber mehr als ein halbes Jahr. Das MR-Protokoll beinhaltete neben einer STIR-Sequenz eine native T{sub 2}-gewichtete TSE-Sequenz mit Fettsupression sowie
Structural and spectroscopic studies of 2,9-dimethyl-1,10 ...
African Journals Online (AJOL)
The crystal structures of the pronated ligand, 2,9-dimethyl-1,10-phenanthrolinium (DPH) cation with selected counter anions (chloride (1), triflate (2), and gold dicyanide (3)) are reported. The role of a hydrogen bond interaction in influencing the solid state p-p stacking found in all three compounds has been investigated.
Wilson's disease: 31P and 1H MR spectroscopy and clinical correlation
International Nuclear Information System (INIS)
Sinha, Sanjib; Taly, A.B.; Prashanth, L.K.; Ravishankar, S.; Vasudev, M.K.
2010-01-01
Proton ( 1 H) magnetic resonance spectroscopy (MRS) changes are noted in Wilson's disease (WD). However, there are no studies regarding membrane phospholipid abnormality using 31 P MRS in these patients. We aimed to analyze the striatal spectroscopic abnormalities using 31 P and 1 H MRS in WD. Forty patients of WD (treated, 29; untreated,11) and 30 controls underwent routine MR image sequences and in vivo 2-D 31 P and 1 H MRS of basal ganglia using an image-selected technique on a 1.5-T MRI scanner. Statistical analysis was done using Student's t test. The mean durations of illness and treatment were 6.2 ± 7.4 and 4.8 ± 5.9 years, respectively. MRI images were abnormal in all the patients. 1 H MRS revealed statistically significant reduction of N-acetyl aspartate (NAA)/choline (Cho) and NAA/creatine ratios in striatum ( 1 H MRS) of treated patients compared to controls. The mean values of phosphomonoesters (PME) (p 31 P MRS study. The duration of illness correlated well with increased PME/PDE [p < 0.001], PME/TPh [p < 0.05], and PDE/TPh [p < 0.05] and decreased NAA/Cho [p < 0.05] ratios. There was correlation of MRI score and reduced NAA/Cho ratio with disease severity. The PME/PDE ratio (right) was elevated in the treated group [p < 0.001] compared to untreated group. There is reduced breakdown and/or increased synthesis of membrane phospholipids and increased neuronal damage in basal ganglia in patients with WD. (orig.)
Nursimulu, Anjali; Florin, Marie-Valentine; Vuille, François
2015-01-01
This report provides an overview of the current debates about demand response development, focusing primarily on Europe, with some comparisons to the United States. ‘Demand response’ includes strategies that involve end-use customers adapting or altering their electricity demand in response to grid conditions or market prices. It is viewed as a multi-purpose power-system resource that enhances the energy system’s capacity to cope with increasing demand, rising costs of conventional transmissi...
History of demand side management and classification of demand response control schemes
Lampropoulos, I.; Kling, W.L.; Ribeiro, P.F.; Berg, van den J.
2013-01-01
The scope of this paper is to provide a review on the topic of demand side management. A historical overview provides a critical insight to applied cases, while the discovery of new evidence calls for reconsideration of the design of demand response control schemes. The developments at the demand
Liang, He-Yue; Huang, Ya-Qin; Yang, Zhao-Xia; Ying-Ding; Zeng, Meng-Su; Rao, Sheng-Xiang
2016-07-01
To determine if magnetic resonance imaging (MRI) histogram analyses can help predict response to chemotherapy in patients with colorectal hepatic metastases by using response evaluation criteria in solid tumours (RECIST1.1) as the reference standard. Standard MRI including diffusion-weighted imaging (b=0, 500 s/mm(2)) was performed before chemotherapy in 53 patients with colorectal hepatic metastases. Histograms were performed for apparent diffusion coefficient (ADC) maps, arterial, and portal venous phase images; thereafter, mean, percentiles (1st, 10th, 50th, 90th, 99th), skewness, kurtosis, and variance were generated. Quantitative histogram parameters were compared between responders (partial and complete response, n=15) and non-responders (progressive and stable disease, n=38). Receiver operator characteristics (ROC) analyses were further analyzed for the significant parameters. The mean, 1st percentile, 10th percentile, 50th percentile, 90th percentile, 99th percentile of the ADC maps were significantly lower in responding group than that in non-responding group (p=0.000-0.002) with area under the ROC curve (AUCs) of 0.76-0.82. The histogram parameters of arterial and portal venous phase showed no significant difference (p>0.05) between the two groups. Histogram-derived parameters for ADC maps seem to be a promising tool for predicting response to chemotherapy in patients with colorectal hepatic metastases. • ADC histogram analyses can potentially predict chemotherapy response in colorectal liver metastases. • Lower histogram-derived parameters (mean, percentiles) for ADC tend to have good response. • MR enhancement histogram analyses are not reliable to predict response.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Quality. 29.1051 Section 29.1051 Agriculture... Type 92) § 29.1051 Quality. A division of a group or the second factor of a grade based on the relative degree of one or more elements of quality. [42 FR 21092, Apr. 25, 1977. Redesignated at 47 FR 51721, Nov...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Quality. 29.3539 Section 29.3539 Agriculture... Type 95) § 29.3539 Quality. A division of a group or the second factor of a grade based on the relative degree of one or more elements of quality in tobacco. [30 FR 9207, July 23, 1965. Redesignated at 49 FR...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Quality. 29.3050 Section 29.3050 Agriculture... Quality. A division of a group or the second factor of a grade, based on the relative degree of one or more elements of quality in tobacco. [24 FR 8771, Oct. 29, 1959. Redesignated at 47 FR 51722, Nov. 17...
Energy Technology Data Exchange (ETDEWEB)
Liu, Ming; Huang, Jie; Xu, Yujun; He, Xiangmeng; Lue, Yubo; Liu, Qiang; Li, Chengli [Department of Interventional MRI, Shandong Medical Imaging Research Institute affiliated to Shandong University, Shandong Key Laboratory of Advanced Medical Imaging Technologies and Applications, Jinan, Shandong (China); Li, Lei [Qingdao Central Hospital, Department of Interventional Radiology, Qingdao, Shandong (China); Blanco Sequeiros, Roberto [Turku University Hospital, The South Western Finland Imaging Centre, Turku (Finland)
2017-04-15
To prospectively evaluate the feasibility, safety and accuracy of MR-guided percutaneous biopsy of solitary pulmonary lesions using a 1.0-T open MR scanner with respiratory gating. Sixty-five patients with 65 solitary pulmonary lesions underwent MR-guided percutaneous coaxial cutting needle biopsy using a 1.0-T open MR scanner with respiratory gating. Lesions were divided into two groups according to maximum lesion diameters: ≤2.0 cm (n = 31) and >2.0 cm (n = 34). The final diagnosis was established in surgery and subsequent histology. Diagnostic accuracy, sensitivity and specificity were compared between the groups using Fisher's exact test. Accuracy, sensitivity and specificity of MRI-guided percutaneous pulmonary biopsy in diagnosing malignancy were 96.9 %, 96.4 % and 100 %, respectively. Accuracy, sensitivity and specificity were 96.8 %, 96.3 % and 100 % for lesions 2.0 cm or smaller and 97.1 %, 96.4 % and 100 %, respectively, for lesions larger than 2.0 cm. There was no significant difference between the two groups (P > 0.05). Biopsy-induced complications encountered were pneumothorax in 12.3 % (8/65) and haemoptysis in 4.6 % (3/65). There were no serious complications. MRI-guided percutaneous biopsy using a 1.0-T open MR scanner with respiratory gating is an accurate and safe diagnostic technique in evaluation of pulmonary lesions. (orig.)
Demand response in a market environment
DEFF Research Database (Denmark)
Larsen, Emil Mahler
This thesis addresses the design, deployment and benefits of demand response in a market environment. Demand response is consumption that can be controlled by an external stimulus in the power system. Flexible consumption is a useful tool for absorbing volatile power from renewable sources like...... this simulation, real power system data from the Danish island of Bornholm is introduced and methods to quantify an aggregated load is developed. These methods can be used for real-time operation and to support investment decisions. More specifically, they can be used to forecast the response to electricity...... pricing and to classify different types of customers. The proposed models are then embedded into new fiveminute electricity markets for system balancing and local congestion management. New market tools for exploiting and maintaining a degree of control over demand are developed, and the value of DR using...
10 CFR 34.29 - Quarterly inventory.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Quarterly inventory. 34.29 Section 34.29 Energy NUCLEAR... RADIOGRAPHIC OPERATIONS Equipment § 34.29 Quarterly inventory. (a) Each licensee shall conduct a quarterly physical inventory to account for all sealed sources and for devices containing depleted uranium received...
Demand response in a market environment
Larsen, Emil Mahler; Pinson, Pierre; Ding, Yi; Østergaard, Jacob
2016-01-01
This thesis addresses the design, deployment and benefits of demand response in a market environment. Demand response is consumption that can be controlled by an external stimulus in the power system. Flexible consumption is a useful tool for absorbing volatile power from renewable sources like wind power and photovoltaics, and dealing with decentralised activity like electric vehicle charging. Without flexible consumption or other new technologies like storage, there will be several occasion...
Differentiating high-grade from low-grade chondrosarcoma with MR imaging
Energy Technology Data Exchange (ETDEWEB)
Yoo, Hye Jin; Hong, Sung Hwan; Choi, Ja-Young; Choi, Jung-Ah; Kang, Heung Sik [Seoul National University College of Medicine, Department of Radiology and Institute of Radiation Medicine, Seoul (Korea); Moon, Kyung Chul [Seoul National University College of Medicine, Department of Pathology, Seoul (Korea); Kim, Han-Soo [Seoul National University College of Medicine, Department of Orthopedic Surgery, Seoul (Korea)
2009-12-15
The purpose of the study was to evaluate the MR imaging features that differentiate between low-grade chondrosarcoma (LGCS) and high-grade chondrosarcoma (HGCS) and to determine the most reliable predictors for differentiation. MR images of 42 pathologically proven chondrosarcomas (28 LGCS and 14 HGCS) were retrospectively reviewed. There were 13 male and 29 female patients with an age range of 23-72 years (average age 51 years). On MR images, signal intensity, specific morphological characteristics including entrapped fat, internal lobular architecture, and outer lobular margin, soft tissue mass formation and contrast enhancement pattern were analysed. MR imaging features used to identify LGCS and HGCS were compared using univariate analysis and multivariate stepwise logistic regression analysis. On T1-weighted images, a central area of high signal intensity, which was not seen in LGCS, was frequently observed in HGCS (n = 5, 36%) (p < 0.01). Entrapped fat within the tumour was commonly seen in LGCS (n = 26, 93%), but not in HGCS (n = 1, 4%) (p < 0.01). LGCS more commonly (n = 24, 86%) preserved the characteristic internal lobular structures within the tumour than HGCSs (n = 4, 29%) (p < 0.01). Soft tissue formation was more frequently observed in HGCS (n = 11, 79%) than in LGCS (n = 1, 4%) (p < 0.01). On gadolinium-enhanced images, large central nonenhancing areas were exhibited in only two (7.1%) of LGCS, while HGCS frequently (n = 9, 64%) had a central nonenhancing portion (p < 0.01). Results of multivariate stepwise logistic regression analysis showed that soft tissue formation and entrapped fat within the tumour were the variables that could be used to independently differentiate LGCS from HGCS. There were several MR imaging features of chondrosarcoma that could be helpful in distinguishing HGCS from LGCS. Among them, soft tissue mass formation favoured the diagnosis of HGCS, and entrapped fat within the tumour was highly indicative of LGCS. (orig.)
Differentiating high-grade from low-grade chondrosarcoma with MR imaging
International Nuclear Information System (INIS)
Yoo, Hye Jin; Hong, Sung Hwan; Choi, Ja-Young; Choi, Jung-Ah; Kang, Heung Sik; Moon, Kyung Chul; Kim, Han-Soo
2009-01-01
The purpose of the study was to evaluate the MR imaging features that differentiate between low-grade chondrosarcoma (LGCS) and high-grade chondrosarcoma (HGCS) and to determine the most reliable predictors for differentiation. MR images of 42 pathologically proven chondrosarcomas (28 LGCS and 14 HGCS) were retrospectively reviewed. There were 13 male and 29 female patients with an age range of 23-72 years (average age 51 years). On MR images, signal intensity, specific morphological characteristics including entrapped fat, internal lobular architecture, and outer lobular margin, soft tissue mass formation and contrast enhancement pattern were analysed. MR imaging features used to identify LGCS and HGCS were compared using univariate analysis and multivariate stepwise logistic regression analysis. On T1-weighted images, a central area of high signal intensity, which was not seen in LGCS, was frequently observed in HGCS (n = 5, 36%) (p < 0.01). Entrapped fat within the tumour was commonly seen in LGCS (n = 26, 93%), but not in HGCS (n = 1, 4%) (p < 0.01). LGCS more commonly (n = 24, 86%) preserved the characteristic internal lobular structures within the tumour than HGCSs (n = 4, 29%) (p < 0.01). Soft tissue formation was more frequently observed in HGCS (n = 11, 79%) than in LGCS (n = 1, 4%) (p < 0.01). On gadolinium-enhanced images, large central nonenhancing areas were exhibited in only two (7.1%) of LGCS, while HGCS frequently (n = 9, 64%) had a central nonenhancing portion (p < 0.01). Results of multivariate stepwise logistic regression analysis showed that soft tissue formation and entrapped fat within the tumour were the variables that could be used to independently differentiate LGCS from HGCS. There were several MR imaging features of chondrosarcoma that could be helpful in distinguishing HGCS from LGCS. Among them, soft tissue mass formation favoured the diagnosis of HGCS, and entrapped fat within the tumour was highly indicative of LGCS. (orig.)
Prediction of Early Response to Chemotherapy in Lung Cancer by Using Diffusion-Weighted MR Imaging
Directory of Open Access Journals (Sweden)
Jing Yu
2014-01-01
Full Text Available Purpose. To determine whether change of apparent diffusion coefficient (ADC value could predict early response to chemotherapy in lung cancer. Materials and Methods. Twenty-five patients with advanced non-small cell lung cancer underwent chest MR imaging including DWI before and at the end of the first cycle of chemotherapy. The tumor’s mean ADC value and diameters on MR images were calculated and compared. The grouping reference was based on serial CT scans according to Response Evaluation Criteria in Solid Tumors. Logistic regression was applied to assess treatment response prediction ability of ADC value and diameters. Results. The change of ADC value in partial response group was higher than that in stable disease group (P=0.004. ROC curve showed that ADC value could predict treatment response with 100% sensitivity, 64.71% specificity, 57.14% positive predictive value, 100% negative predictive value, and 82.7% accuracy. The area under the curve for combination of ADC value and longest diameter change was higher than any parameter alone (P≤0.01. Conclusions. The change of ADC value may be a sensitive indicator to predict early response to chemotherapy in lung cancer. Prediction ability could be improved by combining the change of ADC value and longest diameter.
A summary of demand response in electricity markets
International Nuclear Information System (INIS)
Albadi, M.H.; El-Saadany, E.F.
2008-01-01
This paper presents a summary of demand response (DR) in deregulated electricity markets. The definition and the classification of DR as well as potential benefits and associated cost components are presented. In addition, the most common indices used for DR measurement and evaluation are highlighted, and some utilities' experiences with different demand response programs are discussed. Finally, the effect of demand response in electricity prices is highlighted using a simulated case study. (author)
Wyatt, Jonathan J.; Dowling, Jason A.; Kelly, Charles G.; McKenna, Jill; Johnstone, Emily; Speight, Richard; Henry, Ann; Greer, Peter B.; McCallum, Hazel M.
2017-12-01
There is increasing interest in MR-only radiotherapy planning since it provides superb soft-tissue contrast without the registration uncertainties inherent in a CT-MR registration. However, MR images cannot readily provide the electron density information necessary for radiotherapy dose calculation. An algorithm which generates synthetic CTs for dose calculations from MR images of the prostate using an atlas of 3 T MR images has been previously reported by two of the authors. This paper aimed to evaluate this algorithm using MR data acquired at a different field strength and a different centre to the algorithm atlas. Twenty-one prostate patients received planning 1.5 T MR and CT scans with routine immobilisation devices on a flat-top couch set-up using external lasers. The MR receive coils were supported by a coil bridge. Synthetic CTs were generated from the planning MR images with (sCT1V ) and without (sCT) a one voxel body contour expansion included in the algorithm. This was to test whether this expansion was required for 1.5 T images. Both synthetic CTs were rigidly registered to the planning CT (pCT). A 6 MV volumetric modulated arc therapy plan was created on the pCT and recalculated on the sCT and sCT1V . The synthetic CTs’ dose distributions were compared to the dose distribution calculated on the pCT. The percentage dose difference at isocentre without the body contour expansion (sCT-pCT) was Δ D_sCT=(0.9 +/- 0.8) % and with (sCT1V -pCT) was Δ D_sCT1V=(-0.7 +/- 0.7) % (mean ± one standard deviation). The sCT1V result was within one standard deviation of zero and agreed with the result reported previously using 3 T MR data. The sCT dose difference only agreed within two standard deviations. The mean ± one standard deviation gamma pass rate was Γ_sCT = 96.1 +/- 2.9 % for the sCT and Γ_sCT1V = 98.8 +/- 0.5 % for the sCT1V (with 2% global dose difference and 2~mm distance to agreement gamma criteria). The one voxel body contour
MR Imaging in Monitoring and Predicting Treatment Response in Multiple Sclerosis.
Río, Jordi; Auger, Cristina; Rovira, Àlex
2017-05-01
MR imaging is the most sensitive tool for identifying lesions in patients with multiple sclerosis (MS). MR imaging has also acquired an essential role in the detection of complications arising from these treatments and in the assessment and prediction of efficacy. In the future, other radiological measures that have shown prognostic value may be incorporated within the models for predicting treatment response. This article examines the role of MR imaging as a prognostic tool in patients with MS and the recommendations that have been proposed in recent years to monitor patients who are treated with disease-modifying drugs. Copyright © 2017 Elsevier Inc. All rights reserved.
Demand Response Spinning Reserve Demonstration
Energy Technology Data Exchange (ETDEWEB)
Eto, Joseph H.; Nelson-Hoffman, Janine; Torres, Carlos; Hirth,Scott; Yinger, Bob; Kueck, John; Kirby, Brendan; Bernier, Clark; Wright,Roger; Barat, A.; Watson, David S.
2007-05-01
The Demand Response Spinning Reserve project is a pioneeringdemonstration of how existing utility load-management assets can providean important electricity system reliability resource known as spinningreserve. Using aggregated demand-side resources to provide spinningreserve will give grid operators at the California Independent SystemOperator (CAISO) and Southern California Edison (SCE) a powerful, newtool to improve system reliability, prevent rolling blackouts, and lowersystem operating costs.
Demand Response Resource Quantification with Detailed Building Energy Models
Energy Technology Data Exchange (ETDEWEB)
Hale, Elaine; Horsey, Henry; Merket, Noel; Stoll, Brady; Nag, Ambarish
2017-04-03
Demand response is a broad suite of technologies that enables changes in electrical load operations in support of power system reliability and efficiency. Although demand response is not a new concept, there is new appetite for comprehensively evaluating its technical potential in the context of renewable energy integration. The complexity of demand response makes this task difficult -- we present new methods for capturing the heterogeneity of potential responses from buildings, their time-varying nature, and metrics such as thermal comfort that help quantify likely acceptability of specific demand response actions. Computed with an automated software framework, the methods are scalable.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Tan color. 29.3066 Section 29.3066 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Tan color. A light red-yellow. [24 FR 8771, Oct. 29, 1959. Redesignated at 47 FR 51722, Nov. 17, 1982...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Steam-dried. 29.3058 Section 29.3058 Agriculture... Steam-dried. The condition of unfermented tobacco as customarily prepared for storage by means of a redrying machine or other steam-conditioning equipment. [24 FR 8771, Oct. 29, 1959. Redesignated at 47 FR...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Orange (F). 29.1043 Section 29.1043 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Type 92) § 29.1043 Orange (F). A reddish yellow. [42 FR 21092, Apr. 25, 1977. Redesignated at 47 FR...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Lemon (L). 29.1031 Section 29.1031 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Type 92) § 29.1031 Lemon (L). Yellow. [42 FR 21092, Apr. 25, 1977. Redesignated at 49 FR 16755, Apr. 20...
Benefits and challenges of electrical demand response: A critical review
DEFF Research Database (Denmark)
O'Connell, Niamh; Pinson, Pierre; Madsen, Henrik
2014-01-01
and challenges of demand response. These benefits include the ability to balance fluctuations in renewable generation and consequently facilitate higher penetrations of renewable resources on the power system, an increase in economic efficiency through the implementation of real-time pricing, and a reduction...... in generation capacity requirements. Nevertheless, demand response is not without its challenges. The key challenges for demand response centre around establishing reliable control strategies and market frameworks so that the demand response resource can be used optimally. One of the greatest challenges...... for demand response is the lack of experience, and the consequent need to employ extensive assumptions when modelling and evaluating this resource. This paper concludes with an examination of these assumptions, which range from assuming a fixed linear price–demand relationship for price responsive demand...
Does Knowledge Contribute to the Acceptance of Demand Response?
Directory of Open Access Journals (Sweden)
Salla Annala
2014-03-01
Full Text Available More flexible demand side would benefit the electricity markets, networks and sustainable power generation in many ways. The success of demand response programs, however, relies on consumer acceptance. This paper reviews previous studies about acceptability of different kinds of residential demand response programs. Furthermore, it discusses whether consumers who are more aware of the principles and benefits of demand response have more positive attitudes towards demand response programs. The results of the literature review and two survey studies suggest that price and security of supply are currently bigger motives to change consumption behaviour than environmental issues and that the savings expected to trigger any action (and to lead to lasting change in behaviour may be relatively high. Therefore, the framing of demand response programs goals may affect the acceptance. Additionally, consumers seem to prefer simple price structures that remain constant for a long time to more dynamic options.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Steam-dried. 29.2300 Section 29.2300 Agriculture... INSPECTION Standards Official Standard Grades for Virginia Fire-Cured Tobacco (u.s. Type 21) § 29.2300 Steam... machine or other steam-conditioning equipment. [37 FR 13521, July 11, 1972. Redesignated at 51 FR 40406...
International Nuclear Information System (INIS)
Hu, Ming-Che; Lu, Su-Ying; Chen, Yen-Haw
2016-01-01
Highlights: • Analyze the impact of a demand response program under uncertainty. • Stochastic Nash–Cournot competition model is formulated. • Case study of the Taiwanese electric power market is conducted. • Demand response decreases power price, generation, and emissions. • Demand uncertainty increases energy price and supply risk in the results. - Abstract: In the electricity market, demand response programs are designed to shift peak demand and enhance system reliability. A demand response program can reduce peak energy demand, power transmission congestion, or high energy-price conditions by changing consumption patterns. The purpose of this research is to analyze the impact of a demand response program in the energy market, under demand uncertainty. A stochastic–multiobjective Nash–Cournot competition model is formulated to simulate demand response in an uncertain energy market. Then, Karush–Kuhn–Tucker optimality conditions and a linear complementarity problem are derived for the stochastic Nash–Cournot model. Accordingly, the linear complementarity problem is solved and its stochastic market equilibrium solution is determined by using a general algebraic modeling system. Additionally, the case of the Taiwanese electric power market is taken up here, and the results show that a demand response program is capable of reducing peak energy consumption, energy price, and carbon dioxide emissions. The results show that demand response program decreases electricity price by 2–10%, total electricity generation by 0.5–2%, and carbon dioxide emissions by 0.5–2.5% in the Taiwanese power market. In the simulation, demand uncertainty leads to an 2–7% increase in energy price and supply risk in the market. Additionally, tradeoffs between cost and carbon dioxide emissions are presented.
The development of demand elasticity model for demand response in the retail market environment
Babar, M.; Nguyen, P.H.; Kamphuis, I.G.
2015-01-01
In the context of liberalized energy market, increase in distributed generation, storage and demand response has expanded the price elasticity of demand, thus causing the addition of uncertainty to the supply-demand chain of power system. In order to cope with the challenges of demand uncertainty
Energy Technology Data Exchange (ETDEWEB)
Heo, Young Jin [Inje University, Busan Paik Hospital, Department of Radiology, Busan (Korea, Republic of); Park, Ji Eun; Kim, Ho Sung; Lee, Ji Ye; Jung, Seung Chai; Choi, Choong Gon; Kim, Sang Joon [University of Ulsan College of Medicine, Asan Medical Center, Department of Radiology and Research Institute of Radiology, Seoul (Korea, Republic of); Nam, Soo Jeong [University of Ulsan College of Medicine, Asan Medical Center, Department of Pathology, Seoul (Korea, Republic of)
2017-07-15
To determine if gemistocytic grade II astrocytoma (GemA) and its MR imaging characteristics are associated with a shorter time-to-progression (TTP) compared with non-gemistocytic grade II astrocytoma (non-GemA). We enrolled 78 patients who were followed up more than 5 years (29 pathologically proven GemA and 49 non-GemA) during a 10-year period. Contrast-enhanced T1-weighted, diffusion-weighted imaging (DWI), dynamic susceptibility contrast (DSC), and MR spectroscopy (MRS) and clinical data were retrospectively reviewed. Clinical and MR imaging features were analyzed as possible prognostic factors of high-grade transformation, and multivariate analysis of TTP was performed using Cox proportional modeling. GemA showed more frequent high-grade features than non-GemA, including diffusion restriction (P <.001), increased choline/creatine (P =.02), and increased choline/NAA ratio (P =.015). Patients with GemA had a significantly shorter median TTP (53.1 vs 68 months; P <.001). A gemistocytic histopathology (hazard ratio = 3.42; P =.015) and low ADC (hazard ratio = 3.61; P =.001) were independently associated with a shorter TTP. GemA can present with MR imaging findings mimicking high-grade glioma at initial diagnosis and transforms to high-grade disease earlier than non-GemA. Low ADC on DWI might be useful in stratifying the risk of progression in patients with grade II astrocytoma. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Min, Soo Hyun; Kim, Soo Youn; Lee, Ghi Jai; Shim, Jae Chan; Oh, Tae Kyung; Kim, Ho Kyun [College of Medicine, Jnje University, Seoul (Korea, Republic of)
2000-03-01
To compare the findings of fluid-attenuated inversion recovery (FLAIR) MR imaging in the detection of subarachnoid hemorrhage (SAH), with those of precontrast CT and T1-weighted MR imaging. In 13 patients (14 cases) with SAH, FLAIR MR images were retrospectively analyzed and compared with CT (10 patients, 11 cases) and T1-weighted MR images (9 cases). SAH was confirmed on the basis of high density along the subarachnoid space, as seen on precontrast CT, or lumbar puncture. MR imaging was performed on a 1.0T unit. FLAIR MR and CT images were obtained during the acute stage(less than 3 days after ictus) in 10 and 9 cases, respectively, during the subacute stage (4-14 days after ictus) in two cases and one, respectively, and during the chronic stage (more than 15 days after ictus) in two cases and one, respectively. CT was performed before FLAIR MR imaging, and the interval between CT and FLAIR ranged from 24 hours (6 cases) to 2-3 (2 cases) or 4-7 days (3 cases). In each study, the conspicuity of visualization of SAH was graded as excellent, good, fair, or negative at five locations (sylvian fissure, cortical sulci, anterior basal cistern, posterior basal cistern, and perimesencephalic cistern). In all cases, subarachnoid hemorrhages were demonstrated as high signal intensity areas on FLAIR images. The detection rates for SAH on CT and T1-weighted MR images were 100% (11/11) and 89% (8/9), respectively. FLAIR was superior to T1-weighted imaging in the detection of SAH at all sites except the anterior basal cistern (p less than 0.05) and superior to CT in the detection of SAH at the cortical sulci (p less than 0.05). On FLAIR MR images, subarachnoid hemorrhages at all stages are demonstrated as high signal intensity areas; the FLAIR MR sequence is thus considered useful in the detection of SAH. In particular FLAIR is more sensitive than CT for the detection of SAH in the cortical sulci. (author)
MR elastography: high rate of technical success in pediatric and young adult patients
Energy Technology Data Exchange (ETDEWEB)
Joshi, Madalsa [British Columbia Children' s Hospital, Department of Radiology, Vancouver, BC (Canada); Dillman, Jonathan R.; Towbin, Alexander J.; Serai, Suraj D.; Trout, Andrew T. [Cincinnati Children' s Hospital Medical Center, Department of Radiology, MLC 5031, Cincinnati, OH (United States)
2017-06-15
Magnetic resonance (MR) elastography allows the noninvasive assessment of liver stiffness, which is a surrogate for fibrosis. The purpose of this study was to describe our experience using liver MR elastography in a large pediatric population with attention to the frequency and causes of exam failure. Imaging records were searched for patients ≤18 years of age who underwent 2-D gradient recalled echo (GRE) MR elastography of the liver between September 2011 and August 2015 on one of two 1.5-T MRI platforms. Imaging reports and clinical records were reviewed for failed MR elastography acquisitions, factor(s) resulting in failure and whether a subsequent successful examination had been performed. Four hundred sixty-eight MR elastography examinations were performed in 372 patients between 1.5 months and 18 years of age during the study period. Ninety-six percent (450/468) of the examinations were successful. There was no significant difference in mean age (12.6±3.6 vs. 11.2±4.1 years, P=0.12) or body mass index (BMI) (28.2±12.4 vs. 29.5±10 kg/m{sup 2}, P=0.6) between patients with and without successful examinations. MR elastography failures were due to poor paddle positioning resulting in inadequate generation of hepatic shear waves (n=5), iron overload (n=4), patient inability to tolerate MRI (n=3), patient breathing/motion (n=3), artifact from implanted hardware (n=1) and technical malfunction (n=2). Seven of nine (78%) repeat examinations were successful (78%). Hepatic 2-D GRE MR elastography at 1.5 T is technically robust in children. Exam failure is infrequent and largely reflects patient specific factors, some of which can be mitigated with careful technique. (orig.)
Opportunities for Automated Demand Response in California’s Dairy Processing Industry
Energy Technology Data Exchange (ETDEWEB)
Homan, Gregory K. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Aghajanzadeh, Arian [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); McKane, Aimee [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-08-30
During periods of peak electrical demand on the energy grid or when there is a shortage of supply, the stability of the grid may be compromised or the cost of supplying electricity may rise dramatically, respectively. Demand response programs are designed to mitigate the severity of these problems and improve reliability by reducing the demand on the grid during such critical times. In 2010, the Demand Response Research Center convened a group of industry experts to suggest potential industries that would be good demand response program candidates for further review. The dairy industry was suggested due to the perception that the industry had suitable flexibility and automatic controls in place. The purpose of this report is to provide an initial description of the industry with regard to demand response potential, specifically automated demand response. This report qualitatively describes the potential for participation in demand response and automated demand response by dairy processing facilities in California, as well as barriers to widespread participation. The report first describes the magnitude, timing, location, purpose, and manner of energy use. Typical process equipment and controls are discussed, as well as common impediments to participation in demand response and automated demand response programs. Two case studies of demand response at dairy facilities in California and across the country are reviewed. Finally, recommendations are made for future research that can enhance the understanding of demand response potential in this industry.
Directory of Open Access Journals (Sweden)
Liangcai Lin
Full Text Available Fungal pathogens of plants and insects infect their hosts by direct penetration of the cuticle. Plant and insect cuticles are covered by a hydrocarbon-rich waxy outer layer that represents the first barrier against infection. However, the fungal genes that underlie insect waxy layer degradation have received little attention. Here we characterize the single cytochrome P450 monoxygenase family 52 (MrCYP52 gene of the insect pathogen Metarhizium robertsii, and demonstrate that it encodes an enzyme required for efficient utilization of host hydrocarbons. Expressing a green florescent protein gene under control of the MrCYP52 promoter confirmed that MrCYP52 is up regulated on insect cuticle as well as by artificial media containing decane (C10, extracted cuticle hydrocarbons, and to a lesser extent long chain alkanes. Disrupting MrCYP52 resulted in reduced growth on epicuticular hydrocarbons and delayed developmental processes on insect cuticle, including germination and production of appressoria (infection structures. Extraction of alkanes from cuticle prevented induction of MrCYP52 and reduced growth. Insect bioassays against caterpillars (Galleria mellonella confirmed that disruption of MrCYP52 significantly reduces virulence. However, MrCYP52 was dispensable for normal germination and appressorial formation in vitro when the fungus was supplied with nitrogenous nutrients. We conclude therefore that MrCYP52 mediates degradation of epicuticular hydrocarbons and these are an important nutrient source, but not a source of chemical signals that trigger infection processes.
78 FR 7852 - Qualification of Drivers; Exemption Applications; Diabetes Mellitus
2013-02-04
... license from New York. Isaias Gomez Mr. Gomez, 54, has had ITDM since 2009. His endocrinologist examined..., Associate Administrator for Policy. [FR Doc. 2013-02268 Filed 2-1-13; 8:45 am] BILLING CODE P ...
Measurement of P-31 MR relaxation times and concentrations in human brain and brain tumors
International Nuclear Information System (INIS)
Roth, K.; Naruse, S.; Hubesch, B.; Gober, I.; Lawry, T.; Boska, M.; Matson, G.B.; Weiner, M.W.
1987-01-01
Measurements of high-energy phosphates and pH were made in human brain and brain tumors using P-31 MR imaging. Using a Philips Gyroscan 1.5-T MRMRS, MR images were used to select a cuboidal volume of interest and P-31 MR spectra were obtained from that volume using the ISIS technique. An external quantitation standard was used. T 1 s were measured by inversion recovery. Quantitative values for metabolites were calculated using B 1 field plot of the head coil. The results for normal brain phosphates are as follows; adenosine triphosphate, 2.2 mM; phosphocreatin, 5.3 mM; inorganic phosphate, 1.6 mM. Preliminary studies with human brain tumors show a decrease of all phosphate compounds. These experiments are the first to quantitate metabolites in human brain
Energy Technology Data Exchange (ETDEWEB)
Aragao, Amanda P.; Saide, Clara Santos Martins; Machado, Giovani V.; Cavalcanti, Marcelo C.B.; Valle, Ricardo Nascimento e Silva do [Empresa de Pesquisa Energetica (EPE), Rio de Janeiro, RJ (Brazil)
2012-07-01
The purpose of this study is to assess the forecast for the diesel 10 ppm demand in the next years, by applying a bottom-up model for heavy vehicles. The relevance of this issue is evidenced by the deadline to obey a Judicial Agreement (signed in 2008 between the Federal Public Ministry, the automotive industry and other entities) and Resolution n. 403/2008 (CONAMA), which establishes that motor suitable for the use of diesel 10 ppm (P-7 Phase) is mandatory for heavy vehicles as of 2012 and that such fuel (diesel 10 ppm) must be supplied from 2013 on. Thus, the diesel national market will face important changes, either on the supply side (refining and logistics), in order to provide diesel 10 ppm, or on the demand side, with the new trucks and buses put into circulation with different motors. Particularly, on the demand side, the potential market, mainly the diesel 10 ppm portion, will be defined by the perspective of the fleet growth, energy efficiency increase and mileage variations for trucks and buses. Under the assumptions considered by this study, the demand for diesel 10 ppm for heavy vehicles will reach 27,9 million m{sup 3} in 2020.(author)
Effect of Attenuation Correction on Regional Quantification Between PET/MR and PET/CT
DEFF Research Database (Denmark)
Teuho, Jarmo; Johansson, Jarkko; Linden, Jani
2016-01-01
UNLABELLED: A spatial bias in brain PET/MR exists compared with PET/CT, because of MR-based attenuation correction. We performed an evaluation among 4 institutions, 3 PET/MR systems, and 4 PET/CT systems using an anthropomorphic brain phantom, hypothesizing that the spatial bias would be minimized....../MR systems, CTAC was applied as the reference method for attenuation correction. RESULTS: With CTAC, visual and quantitative differences between PET/MR and PET/CT systems were minimized. Intersystem variation between institutions was +3.42% to -3.29% in all VOIs for PET/CT and +2.15% to -4.50% in all VOIs...... for PET/MR. PET/MR systems differed by +2.34% to -2.21%, +2.04% to -2.08%, and -1.77% to -5.37% when compared with a PET/CT system at each institution, and these differences were not significant (P ≥ 0.05). CONCLUSION: Visual and quantitative differences between PET/MR and PET/CT systems can be minimized...
MrGrid: a portable grid based molecular replacement pipeline.
Directory of Open Access Journals (Sweden)
Jason W Schmidberger
Full Text Available BACKGROUND: The crystallographic determination of protein structures can be computationally demanding and for difficult cases can benefit from user-friendly interfaces to high-performance computing resources. Molecular replacement (MR is a popular protein crystallographic technique that exploits the structural similarity between proteins that share some sequence similarity. But the need to trial permutations of search models, space group symmetries and other parameters makes MR time- and labour-intensive. However, MR calculations are embarrassingly parallel and thus ideally suited to distributed computing. In order to address this problem we have developed MrGrid, web-based software that allows multiple MR calculations to be executed across a grid of networked computers, allowing high-throughput MR. METHODOLOGY/PRINCIPAL FINDINGS: MrGrid is a portable web based application written in Java/JSP and Ruby, and taking advantage of Apple Xgrid technology. Designed to interface with a user defined Xgrid resource the package manages the distribution of multiple MR runs to the available nodes on the Xgrid. We evaluated MrGrid using 10 different protein test cases on a network of 13 computers, and achieved an average speed up factor of 5.69. CONCLUSIONS: MrGrid enables the user to retrieve and manage the results of tens to hundreds of MR calculations quickly and via a single web interface, as well as broadening the range of strategies that can be attempted. This high-throughput approach allows parameter sweeps to be performed in parallel, improving the chances of MR success.
Biochemical T2* MR quantification of ankle arthrosis in pes cavovarus.
Krause, Fabian G; Klammer, Georg; Benneker, Lorin M; Werlen, Stefan; Mamisch, Tallal C; Weber, Martin
2010-12-01
Pes cavovarus affects the ankle biomechanics and may lead to ankle arthrosis. Quantitative T2 STAR (T2*) magnetic resonance (MR) mapping allows high resolution of thin cartilage layers and quantitative grading of cartilage degeneration. Detection of ankle arthrosis using T2* mapping in cavovarus feet was evaluated. Eleven cavovarus patients with symptomatic ankle arthrosis (13 feet, mean age 55.6 years, group 1), 10 cavovarus patients with no or asymptomatic, mild ankle arthrosis (12 feet, mean age 41.8 years, group 2), and 11 controls without foot deformity (18 feet, mean age 29.8 years, group 3) had quantitative T2* MR mapping. Additional assessment included plain radiographs and the American Orthopaedic Foot and Ankle Society (AOFAS) score (groups 1 and 2 only). Mean global T2* relaxation time was significantly different between groups 1 and 2 (p = 0.001) and groups 1 and 3 (p = 0.017), but there was no significance for decreased global T2* values in group 2 compared to group 3 (p = 0.345). Compared to the medial compartment T2* values of the lateral compartment were significantly (p = 0.025) higher within group 1. T2* values in the medial ankle joint compartment of group 2 were significantly lower than those of group 1 (p = 0.019). Ankle arthrosis on plain radiographs and the AOFAS score correlated significantly with T2* values in the medial compartment of group 1 (p = 0.04 and 0.039, respectively). Biochemical, quantitative T2* MR mapping is likely effective to evaluate ankle arthrosis in cavovarus feet but further studies are required. © 2010 Orthopaedic Research Society. Published by Wiley Periodicals, Inc.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Costs. 4221.10 Section 4221.10 Labor Regulations Relating... PLANS ARBITRATION OF DISPUTES IN MULTIEMPLOYER PLANS § 4221.10 Costs. The costs of arbitration under... the costs of its own witnesses. (b) Other costs of arbitration. Except as provided in § 4221.6(d) with...
7 CFR 29.3007 - Buff color (L).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Buff color (L). 29.3007 Section 29.3007 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Buff color (L). A light yellow slightly shaded toward red. [24 FR 8771, Oct. 29, 1959; 24 FR 9121, Nov...
7 CFR 29.3052 - Red color (R).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Red color (R). 29.3052 Section 29.3052 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Red color (R). A brownish red. [24 FR 8771, Oct. 29, 1959. Redesignated at 47 FR 51722, Nov. 17, 1982...
MR equipment acquisition strategies: low-field or high-field scanners
International Nuclear Information System (INIS)
Marti-Bonmati, L.; Kormano, M.
1997-01-01
Magnetic resonance (MR) field strength is one of the key aspects to consider when purchasing MR equipment. Other aspects include the gradient system, coil design, computer and pulse sequence availability, purchase cost, local reimbursement policies, and current opinion within the medical community. Our objective here is to evaluate the decision-influencing aspects of the MR market, with a focus on some specific areas such as high resolution studies, examination times, special techniques, instrumentation, open design magnets, costs and reimbursement policies, academic and industrial interests, contrast media, clinical efficacy, and finally, clinicians' preferences. Certainly the advantage of high-field is a higher signal-to-noise ratio and improved resolution. With a high-field unit, higher spatial resolution images and higher temporal resolution images can be obtained. Typical imaging times needed to produce clinically diagnostic images are about 3 times longer at 0.1 T than at 1.0 or 1.5 T. High-field-related advanced techniques, such as functional imaging, spectroscopy and microscopy, may become clinically useful in the near future. As long as there is an unlimited demand for MR examinations, it appears financially profitable to run a high-field system, despite the associated higher costs. However, if demand for MR becomes saturated, low-field systems will cause less financial strain on the reimbursement organisation and service provider. Recent emphasis on cost containment, the development of interventional techniques, the increased use of MR for patients in intensive care and operating suites, the deployment of magnets in office suites, and the development of new magnet configurations, all favour the supplementary use of low-field systems. Hence, MR units of all field strengths have a role in radiology. (orig.)
Muruganandham, Manickam; Clerkin, Patrick P; Smith, Brian J; Anderson, Carryn M; Morris, Ann; Capizzano, Aristides A; Magnotta, Vincent; McGuire, Sarah M; Smith, Mark C; Bayouth, John E; Buatti, John M
2014-01-01
Purpose To evaluate the utility of 3D-MR proton spectroscopic imaging for treatment planning and its implications for early response assessment in glioblastoma multiforme. Methods and Materials Eighteen patients with newly diagnosed, histologically confirmed glioblastoma had 3D-MR proton spectroscopic imaging (MRSI) along with T2 and T1 gadolinium enhanced MR images at simulation and at boost treatment planning after 17-20 fractions of radiotherapy. All patients received standard radiotherapy with temozolomide and follow-up with every two month MR scans. Progression free survival was defined using MacDonald criteria. MRSI images obtained at initial simulation were analyzed for choline / N-acetylaspartate ratios (Cho/NAA) on a voxel by voxel basis with abnormal activity defined as Cho/NAA ≥ 2. These images were compared on anatomically matched MRSI data collected after 3 weeks of radiotherapy. Changes in Cho/NAA between pre-therapy and 3rd week RT scans were tested using Wilcoxon matched-pairs signed rank tests and correlated with progression free survival, radiation dose and location of recurrence using Cox proportional hazards regression. Results After 8.6 months (median follow-up), 50% of patients had progressed based on imaging. Patients with a decreased or stable mean or median Cho/NAA values had less risk of progression (p< 0.01). Patients with an increase in mean or median Cho/NAA values at the 3rd week RT scan had a significantly greater chance of early progression (p <0.01). An increased Cho/NAA at the 3rd week MRSI scan carried a hazard ratio of 2.72 (95% confidence interval 1.10-6.71, p= 0.03). Most patients received the prescription dose of RT to the Cho/NAA ≥ 2 volume, which was where recurrence most often occurred. Conclusion Change in mean and median Cho/NAA detected at 3 weeks was a significant predictor of early progression. The potential impact for risk-adaptive therapy based on early spectroscopic findings is suggested. PMID:24986746
Energy Technology Data Exchange (ETDEWEB)
Fushimi, Yasutaka, E-mail: yfushimi@kuhp.kyoto-u.ac.jp [Department of Diagnostic Imaging and Nuclear Medicine, Kyoto University Graduate School of Medicine, Kyoto 606-8507 (Japan); Okada, Tomohisa; Kanagaki, Mitsunori; Yamamoto, Akira; Kanda, Yumiko; Sakamoto, Ryo [Department of Diagnostic Imaging and Nuclear Medicine, Kyoto University Graduate School of Medicine, Kyoto 606-8507 (Japan); Hojo, Masato; Takahashi, Jun C.; Miyamoto, Susumu [Department of Neurosurgery, Kyoto University Graduate School of Medicine, Kyoto 606-8507 (Japan); Togashi, Kaori [Department of Diagnostic Imaging and Nuclear Medicine, Kyoto University Graduate School of Medicine, Kyoto 606-8507 (Japan)
2014-10-15
Objectives: To evaluate the validity of 3D dynamic pituitary MR imaging with controlled aliasing in parallel imaging results in higher acceleration (CAIPIRINHA), with special emphasis on demarcation of pituitary posterior lobe and stalk. Methods: Participants comprised 32 patients who underwent dynamic pituitary MR imaging due to pituitary or parasellar lesions. 3D dynamic MR with CAIPIRINHA was performed at 3 T with 20-s-interval, precontrast, 1st to 5th dynamic images. Normalized values and enhanced ratios (dynamic postcontrast image values divided by precontrast ones) were compared between 3D and 2D dynamic MR imaging for patients with visual identification of posterior lobe and stalk. Results: In 3D, stalk was identified in 29 patients and unidentified in 3, and posterior lobe was identified in 28 and unidentified in 4. In 2D, stalk was identified in 26 patients and unidentified in 6 patients, and posterior lobe was identified in 15 and unidentified in 17. Normalized values of pituitary posterior lobe and stalk were higher in 3D than 2D (P < 0.001). No significant difference in enhancement ratio was seen between 3D and 2D. Conclusions: 3D dynamic pituitary MR provided better identification and higher normalized values of pituitary posterior lobe and stalk than 2D.
The effects of session length on demand functions generated using FR schedules.
Foster, T Mary; Kinloch, Jennifer; Poling, Alan
2011-05-01
In comparing open and closed economies, researchers often arrange shorter sessions under the former condition than under the latter. Several studies indicate that session length per se can affect performance and there are some data that indicate that this variable can influence demand functions. To provide further data, the present study exposed domestic hens to series of increasing fixed-ratio schedules with the length of the open-economy sessions varied over 10, 40, 60, and 120 min. Session time affected the total-session response rates and pause lengths. The shortest session gave the greatest response rates and shortest pauses and the longest gave the lowest response rates and longest pauses. The total-session demand functions also changed with session length: The shortest session gave steeper initial slopes (i.e., the functions were more elastic at small ratios) and smaller rates of change of elasticity than the longest session. Response rates, pauses, and demand functions were, however, similar for equivalent periods of responding taken from within sessions of different overall lengths (e.g., total-session data for 10-min sessions and the data for the first 10 min of 120-min sessions). These findings suggest that differences in session length can confound the results of studies comparing open and closed economies when those economies are arranged in sessions that differ substantially in length, hence data for equivalent-length periods of responding, rather than total-session data, should be of primary interest under these conditions.
Estimating Reduced Consumption for Dynamic Demand Response
Energy Technology Data Exchange (ETDEWEB)
Chelmis, Charalampos [Univ. of Southern California, Los Angeles, CA (United States); Aman, Saima [Univ. of Southern California, Los Angeles, CA (United States); Saeed, Muhammad Rizwan [Univ. of Southern California, Los Angeles, CA (United States); Frincu, Marc [Univ. of Southern California, Los Angeles, CA (United States); Prasanna, Viktor K. [Univ. of Southern California, Los Angeles, CA (United States)
2015-01-30
Growing demand is straining our existing electricity generation facilities and requires active participation of the utility and the consumers to achieve energy sustainability. One of the most effective and widely used ways to achieve this goal in the smart grid is demand response (DR), whereby consumers reduce their electricity consumption in response to a request sent from the utility whenever it anticipates a peak in demand. To successfully plan and implement demand response, the utility requires reliable estimate of reduced consumption during DR. This also helps in optimal selection of consumers and curtailment strategies during DR. While much work has been done on predicting normal consumption, reduced consumption prediction is an open problem that is under-studied. In this paper, we introduce and formalize the problem of reduced consumption prediction, and discuss the challenges associated with it. We also describe computational methods that use historical DR data as well as pre-DR conditions to make such predictions. Our experiments are conducted in the real-world setting of a university campus microgrid, and our preliminary results set the foundation for more detailed modeling.
Analyses of demand response in Denmark[Electricity market
Energy Technology Data Exchange (ETDEWEB)
Moeller Andersen, F.; Grenaa Jensen, S.; Larsen, Helge V.; Meibom, P.; Ravn, H.; Skytte, K.; Togeby, M.
2006-10-15
Due to characteristics of the power system, costs of producing electricity vary considerably over short time intervals. Yet, many consumers do not experience corresponding variations in the price they pay for consuming electricity. The topic of this report is: are consumers willing and able to respond to short-term variations in electricity prices, and if so, what is the social benefit of consumers doing so? Taking Denmark and the Nord Pool market as a case, the report focuses on what is known as short-term consumer flexibility or demand response in the electricity market. With focus on market efficiency, efficient allocation of resources and security of supply, the report describes demand response from a micro-economic perspective and provides empirical observations and case studies. The report aims at evaluating benefits from demand response. However, only elements contributing to an overall value are presented. In addition, the analyses are limited to benefits for society, and costs of obtaining demand response are not considered. (au)
MR study of acute myocardial infarction with injection of Gd-DOTA (Fifteen patients)
International Nuclear Information System (INIS)
Richoz, B.; Delcour, C.; Depelchin, P.; Lenaers, A.; Jacquemin, C.; Gusella, P.; Struyven, J.; Richoz, B.
1990-01-01
We studied 15 patients 4 to 8 days after myocardial infarction by using ECG gated MR before and after administration of 0.2 mmol/kg Gd-DOTA. The diagnosis in each patient was confirmed by electrocardiographic criteria, elevated levels of fractionated creatine kinase (CK) isoenzyme, thallium scintigraphy, ventriculography and coronarography. T1-weighted, spin-echo images, were obtained before and immediately after injection of Gd-DOTA and were repeated 15 min later. The site of infarction was visualized in 10 patients as an area of high signal intensity after the injection of Gd-DOTA. Contrast between normal and infarcted myocardium was greatest 15 min after injection. Three patients were excluded because of failure to acquire adequate MR studies. In 2 other patients, the infarct were not detected. Before injection of Gd-DOTA, only 2 infarcts were detected. These results suggest that Gd-DOTA can improve MR visualization and detection of acute myocardial infarction [fr
Opportunities for Automated Demand Response in California Wastewater Treatment Facilities
Energy Technology Data Exchange (ETDEWEB)
Aghajanzadeh, Arian [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Wray, Craig [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); McKane, Aimee [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-08-30
Previous research over a period of six years has identified wastewater treatment facilities as good candidates for demand response (DR), automated demand response (Auto-DR), and Energy Efficiency (EE) measures. This report summarizes that work, including the characteristics of wastewater treatment facilities, the nature of the wastewater stream, energy used and demand, as well as details of the wastewater treatment process. It also discusses control systems and automated demand response opportunities. Furthermore, this report summarizes the DR potential of three wastewater treatment facilities. In particular, Lawrence Berkeley National Laboratory (LBNL) has collected data at these facilities from control systems, submetered process equipment, utility electricity demand records, and governmental weather stations. The collected data were then used to generate a summary of wastewater power demand, factors affecting that demand, and demand response capabilities. These case studies show that facilities that have implemented energy efficiency measures and that have centralized control systems are well suited to shed or shift electrical loads in response to financial incentives, utility bill savings, and/or opportunities to enhance reliability of service. In summary, municipal wastewater treatment energy demand in California is large, and energy-intensive equipment offers significant potential for automated demand response. In particular, large load reductions were achieved by targeting effluent pumps and centrifuges. One of the limiting factors to implementing demand response is the reaction of effluent turbidity to reduced aeration at an earlier stage of the process. Another limiting factor is that cogeneration capabilities of municipal facilities, including existing power purchase agreements and utility receptiveness to purchasing electricity from cogeneration facilities, limit a facility’s potential to participate in other DR activities.
Energy Technology Data Exchange (ETDEWEB)
Wen, N; Glide-Hurst, C; Liu, M; Hearshen, D; Brown, S; Siddiqui, S; Chetty, I [Henry Ford Health System, Detroit, MI (United States)
2015-06-15
Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable
Simulation-based Strategies for Smart Demand Response
Directory of Open Access Journals (Sweden)
Ines Leobner
2018-03-01
Full Text Available Demand Response can be seen as one effective way to harmonize demand and supply in order to achieve high self-coverage of energy consumption by means of renewable energy sources. This paper presents two different simulation-based concepts to integrate demand-response strategies into energy management systems in the customer domain of the Smart Grid. The first approach is a Model Predictive Control of the heating and cooling system of a low-energy office building. The second concept aims at industrial Demand Side Management by integrating energy use optimization into industrial automation systems. Both approaches are targeted at day-ahead planning. Furthermore, insights gained into the implications of the concepts onto the design of the model, simulation and optimization will be discussed. While both approaches share a similar architecture, different modelling and simulation approaches were required by the use cases.
International Nuclear Information System (INIS)
Bartusch, Cajsa; Wallin, Fredrik; Odlare, Monica; Vassileva, Iana; Wester, Lars
2011-01-01
Increased demand response is essential to fully exploit the Swedish power system, which in turn is an absolute prerequisite for meeting political goals related to energy efficiency and climate change. Demand response programs are, nonetheless, still exceptional in the residential sector of the Swedish electricity market, one contributory factor being lack of knowledge about the extent of the potential gains. In light of these circumstances, this empirical study set out with the intention of estimating the scope of households' response to, and assessing customers' perception of, a demand-based time-of-use electricity distribution tariff. The results show that households as a whole have a fairly high opinion of the demand-based tariff and act on its intrinsic price signals by decreasing peak demand in peak periods and shifting electricity use from peak to off-peak periods. - Highlights: → Households are sympathetic to demand-based tariffs, seeing as they relate to environmental issues. → Households adjust their electricity use to the price signals of demand-based tariffs. → Demand-based tariffs lead to a shift in electricity use from peak to off-peak hours. → Demand-based tariffs lead to a decrease in maximum demand in peak periods. → Magnitude of these effects increases over time.
Kirchgesner, Thomas; Perlepe, Vasiliki; Michoux, Nicolas; Larbi, Ahmed; Vande Berg, Bruno
2017-04-01
To compare the effectiveness of fat suppression and the signal-to-noise ratio (SNR) of the Dixon method with those of the CHESS (Chemical Shift-Selective) technique and STIR (Short Tau Inversion Recovery) sequence in hands of normal subjects at 2D MR imaging. 14 healthy volunteers (mean age of 29.4 years) consented to have both hands prospectively imaged with SE T1 Dixon, T1 CHESS, T2 Dixon, T2 CHESS and STIR sequences in a 1.5T MR scanner. Three radiologists scored the effectiveness of fat suppression in bone marrow (EFS BM ) and soft tissues (EFS ST ) in 20 joints per subject. One radiologist measured the SNR in 10 bones per subject. Statistical analysis used two-way ANOVA with random effects, paired t-test and observed agreement to assess differences in effectiveness of fat suppression, differences in SNR and inter-observer agreement. EFS BM was statistically significantly higher for T1 Dixon than for T1 CHESS and for T2 Dixon than for T2 CHESS (pCHESS and for T2 Dixon than for STIR (pCHESS (pCHESS technique at 2D T1-weighted MR imaging of the hands. At T2-weighted MR imaging, fat suppression is more effective with the Dixon method while SNR is higher with the CHESS technique. Copyright © 2017 Elsevier B.V. All rights reserved.
Interoperability of Demand Response Resources Demonstration in NY
Energy Technology Data Exchange (ETDEWEB)
Wellington, Andre
2014-03-31
The Interoperability of Demand Response Resources Demonstration in NY (Interoperability Project) was awarded to Con Edison in 2009. The objective of the project was to develop and demonstrate methodologies to enhance the ability of customer sited Demand Response resources to integrate more effectively with electric delivery companies and regional transmission organizations.
In vivo P-31 MR spectroscopic studies of liver in normal adults and cirrhotic patients
International Nuclear Information System (INIS)
Ban, N.; Moriyasu, F.; Tamada, T.
1986-01-01
The author performed in vivo P-31 MR spectroscopic studies of normal and diseased human liver using an experimental 2.0-T whole-body MR imager. Then normal adults and ten cirrhotic patients in the fasting state were studied. Spatially localized in vivo P-31 MR spectra of human liver were obtained in combination with the use of a surface coil and gradient magnetic field. Six spectral peaks were observed in both groups and were assigned, from left to right, to phosphomonoester, inorganic phosphate, phosophodiester, γ-ATP, α-ATP, and β-ATP, on the basis of the chemical shifts. There were no definite differences between the spectral patterns of normal adults and those of cirrhotic patients in the fasting state
Heshmati, Almas
2012-01-01
The increasing use of demand-side management as a tool to reliably meet electricity demand at peak time has stimulated interest among researchers, consumers and producer organizations, managers, regulators and policymakers, This research reviews the growing literature on models used to study demand, consumer baseline (CBL) and demand response in the electricity market. After characterizing the general demand models, it reviews consumer baseline based on which further study the demand response...
Modelling of demand response and market power
International Nuclear Information System (INIS)
Kristoffersen, B.B.; Donslund, B.; Boerre Eriksen, P.
2004-01-01
Demand-side flexibility and demand response to high prices are prerequisites for the proper functioning of the Nordic power market. If the consumers are unwilling to respond to high prices, the market may fail the clearing, and this may result in unwanted forced demand disconnections. Being the TSO of Western Denmark, Eltra is responsible of both security of supply and the design of the power market within its area. On this basis, Eltra has developed a new mathematical model tool for analysing the Nordic wholesale market. The model is named MARS (MARket Simulation). The model is able to handle hydropower and thermal production, nuclear power and wind power. Production, demand and exchanges modelled on an hourly basis are new important features of the model. The model uses the same principles as Nord Pool (The Nordic Power Exchange), including the division of the Nordic countries into price areas. On the demand side, price elasticity is taken into account and described by a Cobb-Douglas function. Apart from simulating perfect competition markets, particular attention has been given to modelling imperfect market conditions, i.e. exercise of market power on the supply side. Market power is simulated by using game theory, including the Nash equilibrium concept. The paper gives a short description of the MARS model. Besides, focus is on the application of the model in order to illustrate the importance of demand response in the Nordic market. Simulations with different values of demand elasticity are compared. Calculations are carried out for perfect competition and for the situation in which market power is exercised by the large power producers in the Nordic countries (oligopoly). (au)
Ankle ligamints : comparison of MR arthrography with conventional MR imaging in amputated feet
International Nuclear Information System (INIS)
Yoo, Jae Sung; Lee, Sang Yong; Lee, Jeong Min; Han, Young Min; Chung, Kyung Ho; Kim, CHong Soo
2001-01-01
To compare magnetic resonance (MR) arthrography with conventional MR imaging in the evaluation of ankle ligaments. Eight freshly amputated human feet underwent conventional MR imaging and MR arthrography. For the former, 1.5-T magnets in the axial, coronal and sagittal planes were used, and T1-weighted sequences were obtained. Following the injection of 6-10 ml of diluted contrast media (Gd-DTPA 1:250), T1-weighted images were obtained in the same positions as conventional MR images. Paired conventional MR imaging and MR arthrography of each ankle ligament were rated on a five-point scale, and to reflect inter-group differences a Wilcoxon singed-rank test was used to compare the different measurements (p<0.05). In two ankles, MR images of the ligaments were correlated with ankle dissection. Anterior and posterior talofibular ligaments were more clearly revealed by MR arthrography than by conventional MR imaging, while calcaneofibular ligaments showed no difference between these two modalities. With regard to deltoid ligaments, visualization of the anterior and posterior tibiotalar ligament was much improved when contrast material was used to outline the ligament's articular aspect. Visualization of the posterior inferior tibiofibular ligament and inferior transverse ligament were also improved when the use of contrast material provided delineation of the articular side of the ligaments and separated them from adjacent bone. In addition, MR arthography was very useful for indentification of the posterior intermalleolar ligament, though its use did not enhance visualization of the calcaneofibular, tibiocalcaneal, spring or tibiospring ligaments. MR arthrography accurately revealed the anatomic details of ankle ligaments, and may therefore be more useful than conventional Mr imaging for evaluation of these structures
Assessment of Industrial Load for Demand Response across Western Interconnect
Energy Technology Data Exchange (ETDEWEB)
Alkadi, Nasr E [ORNL; Starke, Michael R [ORNL; Ma, Ookie [United States Department of Energy (DOE), Office of Efficiency and Renewable Energy (EERE)
2013-11-01
Demand response (DR) has the ability to both increase power grid reliability and potentially reduce operating system costs. Understanding the role of demand response in grid modeling has been difficult due to complex nature of the load characteristics compared to the modeled generation and the variation in load types. This is particularly true of industrial loads, where hundreds of different industries exist with varying availability for demand response. We present a framework considering industrial loads for the development of availability profiles that can provide more regional understanding and can be inserted into analysis software for further study. The developed framework utilizes a number of different informational resources, algorithms, and real-world measurements to perform a bottom-up approach in the development of a new database with representation of the potential demand response resource in the industrial sector across the U.S. This tool houses statistical values of energy and demand response (DR) potential by industrial plant and geospatially locates the information for aggregation for different territories without proprietary information. This report will discuss this framework and the analyzed quantities of demand response for Western Interconnect (WI) in support of evaluation of the cost production modeling with power grid modeling efforts of demand response.
Providing frequency regulation reserve services using demand response scheduling
International Nuclear Information System (INIS)
Motalleb, Mahdi; Thornton, Matsu; Reihani, Ehsan; Ghorbani, Reza
2016-01-01
Highlights: • Proposing a market model for contingency reserve services using demand response. • Considering transient limitations of grid frequency for inverter-based generations. • Price-sensitive scheduling of residential batteries and water heaters using dynamic programming. • Calculating the profits of both generation companies and demand response aggregators. - Abstract: During power grid contingencies, frequency regulation is a primary concern. Historically, frequency regulation during contingency events has been the sole responsibility of the power utility. We present a practical method of using distributed demand response scheduling to provide frequency regulation during contingency events. This paper discusses the implementation of a control system model for the use of distributed energy storage systems such as battery banks and electric water heaters as a source of ancillary services. We present an algorithm which handles the optimization of demand response scheduling for normal operation and during contingency events. We use dynamic programming as an optimization tool. A price signal is developed using optimal power flow calculations to determine the locational marginal price of electricity, while sensor data for water usage is also collected. Using these inputs to dynamic programming, the optimal control signals are given as output. We assume a market model in which distributed demand response resources are sold as a commodity on the open market and profits from demand response aggregators as brokers of distributed demand response resources can be calculated. In considering control decisions for regulation of transient changes in frequency, we focus on IEEE standard 1547 in order to prevent the safety shut-off of inverter-based generation and further exacerbation of frequency droop. This method is applied to IEEE case 118 as a demonstration of the method in practice.
Stimulation of demand response through evaluation and training
International Nuclear Information System (INIS)
Encinas, N.; Alfonso, D.; Alvarez, C.; Mendez, C.; Rodriguez, J.; Perez-Navarro, A.; Gabaldon, A.
2004-01-01
The objective of Demand Response is to enhance customer choice opportunities by means of price-responsive mechanisms in contrast to direct load control practices and associated revenues based on fixed incentives. In this way, the new approach complements the traditional concept of Demand Side Management by including the voluntary nature to customer participation. This voluntary feature implies a change in customers' traditional behaviour and therefore stimulation and training is needed to achieve an optimal participation. This paper presents a methodology developed to stimulate and train customers for Demand Response practices as well as to identify the suitable products for different customers. Finally, the paper includes an example of the methodology considering a university as a customer. (au)
43 CFR 17.10 - Judicial review.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Judicial review. 17.10 Section 17.10... Origin § 17.10 Judicial review. Action taken pursuant to section 602 of the act is subject to judicial review as provided in section 603 of the act. [29 FR 16293, Dec. 4, 1964] ...
Gadolinium-enhanced excretory MR urography: comparison with MR urography using HASTE technique
International Nuclear Information System (INIS)
Jin, Gong Yong; Lee, Jeong Min; Han, Young Min; Cheong, Gyung Ho; Oh, Hee Sul; Kim, Chong Soo; Park, Sung Kwang; Kim, Young Gon
2000-01-01
To compare the feasibility of gadolinium-enhanced excretory MR urography (GEMRU) and conventional MR urography using the half-Fourier acquisition single-shot turbo spin-echo (HASTE) sequence in patients with hydronephrosis or non-visualized kidney. Fifteen patients with hydronephrosis or non-visualized kidney, as demonstrated by ultrasonography or intravenous urography, were enrolled in this study. Nine were men and six were women, and their age ranged from 18 to 77 (mean, 60.6) years. For all MR examinations, a 1.5T MR unit was employed. For breath-hold MR urography, the HASTE technique (MRU) was used, and reconstruction involved the use of a maximum intensity-projection (MIP) algorithm. For gadolinium-enhanced excretory MR urography, the fast low angle shot (FLASH) 3-D method was used and images were obtained at 5, 10, 20, and 30 minutes, and reconstruction again involved the use of MIP algorithm. In some cases, additional GEMRU was obtained 24 hour after contrast material injection, and an MIP algorithm was used for reconstruction. MRU and GEMRU were independently interpreted by two radiologists who for quantitative analysis compared SNR with CNR, and at each anatomic level qualitatively analyzed morphologic accuracy and diagnostic value of the lesions. In quantitative analysis, SNR and CNR differences between the two sequences at the renal pelvis and the level of the ureter were not significant (p greater than 0.05). In qualitative analysis, GEMRU was superior to MRU for the assessment of evaluated ureter at each level (p less than 0.05), anatomic anomaly and intrinsic tumor. Ureteral stones, however, were more easily diagnosed with MRU. For assessment of the ureter GEMRU is superior to MRU and has the advantage of evaluating renal function. We believe that for evaluation of the urinary tract, especially the distal ureter, GEMRU may be a valuable adjunct to routine MR urography. (author)
Which electricity market design to encourage the development of demand response?
Vincent Rious, Fabien Roques and Yannick Perez
2012-01-01
Demand response is a cornerstone problem in electricity markets under climate change constraint. Most liberalized electricity markets have a poor track record at encouraging the deployment of smart meters and the development of demand response. In Europe, different models are considered for demand response, from a development under a regulated regime to a development under competitive perspectives. In this paper, focusing on demand response and smart metering for mid-size and small consumers,...
Which electricity market design to encourage the development of demand response?
Rious , Vincent; Perez , Yannick; Roques , Fabien
2015-01-01
International audience; Demand response is a cornerstone problem in electricity markets under climate change constraints. Most liberalized electricity markets have a poor track record at encouraging the deployment of smart meters and the development of demand response. In Europe, different models are considered for demand response, from a development under a regulated regime to a development under competitive perspectives. In this paper focusing on demand response and smart metering for mid-...
Directory of Open Access Journals (Sweden)
Chia-Hsin Chen
Full Text Available Human p29 is a putative component of spliceosomes, but its role in pre-mRNA is elusive. By siRNA knockdown and stable overexpression, we demonstrated that human p29 is involved in DNA damage response and Fanconi anemia pathway in cultured cells. In this study, we generated p29 knockout mice (mp29(GT/GT using the mp29 gene trap embryonic stem cells to study the role of mp29 in DNA damage response in vivo. Interruption of mp29 at both alleles resulted in embryonic lethality. Embryonic abnormality occurred as early as E6.5 in mp29(GT/GT mice accompanied with decreased mRNA levels of α-tubulin and Chk1. The reduction of α-tubulin and Chk1 mRNAs is likely due to an impaired post-transcriptional event. An aberrant G2/M checkpoint was found in mp29 gene trap embryos when exposed to aphidicolin and UV light. This embryonic lethality was rescued by crossing with mp29 transgenic mice. Additionally, the knockdown of zfp29 in zebrafish resulted in embryonic death at 72 hours of development postfertilization (hpf. A lower level of acetylated α-tubulin was also observed in zfp29 morphants. Together, these results illustrate an indispensable role of mp29 in DNA checkpoint response during embryonic development.
MR imaging in chronic epicondylitis humeri radialis at 1.0 T: is Gd-DTPA administration useful?
International Nuclear Information System (INIS)
Herber, S.; Kalden, P.; Kreitner, K.-F.; Thelen, M.
2001-01-01
Purpose: Evaluation of the diagnostic value and confidence of contrast-enhanced MR imaging in patients with lateral epicondylitis in comparison to clinical diagnosis. Material and Methods: 42 consecutive patients with clinically proven chronic lateral epicondylitis and 10 elbow joints of healthy controls have been examined on a 1.0 T MR-unit. Criteria for inclusion in the prospective study were: persistant pain and a failed conservative therapy. The MR protocol included STIR sequence, a native, T 2 -weighted, fat-supressed TSE sequence, and a flash-2-D sequence. Also, fat-supressed, T 1 -weighted SE sequences before and after administration of Gd-DTPA contrast media have been recorded. Results: In 39/42 patients the STIR sequence showed an increased SI of the common extensor tendom. Increased MR signal of the lateral collateral ligament combined with a thickening and a partial rupture or a full thickness tear have been observed in 15/42 cases. A bone marrow edema at the lateral epicondylus was noticed in 6 of the studied patients and a joint effusion in 18/42 patients. After administration of contrast media we noticed an average increase of SI by about 150%. However, enhanced MR imaging did not provide additional information. Conclusion: In MR imaging of chronic epicondylitis administration of gadolinium-DTPA does not provide additional information. (orig.) [de
Certification prerequisites for activities related to the trading of demand response resources
International Nuclear Information System (INIS)
Alcázar-Ortega, Manuel; Calpe, Carmen; Theisen, Thomas; Rodríguez-García, Javier
2015-01-01
Certification according to international standards brings many benefits to the society, including technical, economic and environmental aspects. In this context, this paper highlights the benefits of certification of Demand Response, including the additional credibility which provides to the trading of flexibility and higher confidence between different players. The consequence is a dynamic environment which facilitates the market acceptance of Demand Response services and products, providing significant benefits to providers and users of such services. A methodology for the systematic certification of different activities related to the transaction of Demand Response resources has been developed and it is presented here. In particular, three types of certificate have been specified, considering the certification of the entity providing the resource (Demand Response Provider), the contractual framework between the provider and the requester (Demand Response Product) and the physical platform to enable and guarantee such transaction (Demand Response Energy Service Trader). The results of this paper may help regulators and standardization bodies in the design and specification of a future norm to allow the certification of the above-mentioned activities, or a further development of existing regulation for certification of energy efficiency systems (like ISO (International Standard Organization) 50001), where certification of Demand Response activities could be complementary. - Highlights: • Inexistence of a standard on Demand Response limits the application of demand flexibility. • Demand flexibility is essential for the cost-effective integration of renewable generation technologies. • Benefits of certification of activities in the trading of Demand Response are highlighted. • Necessary activities for a standard interchange of Demand Response are identified. • The specifications of a new standard for Demand Response certification are given.
Energy Technology Data Exchange (ETDEWEB)
Hakyemez, Bahattin [Uludag University School of Medicine, Department of Radiology, Gorukle, Bursa (Turkey); Bursa State Hospital, Department of Radiology, Bursa (Turkey); Yildirim, Nalan; Gokalp, Gokhan; Erdogan, Cuneyt; Parlak, Mufit [Uludag University School of Medicine, Department of Radiology, Gorukle, Bursa (Turkey)
2006-08-15
Atypical/malignant meningiomas recur more frequently then typical meningiomas. In this study, the contribution of diffusion-weighted MR imaging to the differentiation of atypical/malignant and typical meningiomas and to the determination of histological subtypes of typical meningiomas was investigated. The study was performed prospectively on 39 patients. The signal intensity of the lesions was evaluated on trace and apparent diffusion coefficient (ADC) images. ADC values were measured in the lesions and peritumoral edema. Student's t-test was used for statistical analysis. P<0.05 was considered statistically significant. Mean ADC values in atypical/malignant and typical meningiomas were 0.75{+-}0.21 and 1.17{+-}0.21, respectively. Mean ADC values for subtypes of typical meningiomas were as follows: meningothelial, 1.09{+-}0.20; transitional, 1.19{+-}0.07; fibroblastic, 1.29{+-}0.28; and angiomatous, 1.48{+-}0.10. Normal white matter was 0.91{+-}0.10. ADC values of typical meningiomas and atypical/malignant meningiomas significantly differed (P<0.001). However, the difference between peritumoral edema ADC values was not significant (P>0.05). Furthermore, the difference between the subtypes of typical meningiomas and atypical/malignant meningiomas was significant (P<0.001). Diffusion-weighted MR imaging findings of atypical/malignant meningiomas and typical meningiomas differ. Atypical/malignant meningiomas have lower intratumoral ADC values than typical meningiomas. Mean ADC values for peritumoral edema do not differ between typical and atypical meningiomas. (orig.)
Design of demand side response model in energy internet demonstration park
Zhang, Q.; Liu, D. N.
2017-08-01
The implementation of demand side response can bring a lot of benefits to the power system, users and society, but there are still many problems in the actual operation. Firstly, this paper analyses the current situation and problems of demand side response. On this basis, this paper analyses the advantages of implementing demand side response in the energy Internet demonstration park. Finally, the paper designs three kinds of feasible demand side response modes in the energy Internet demonstration park.
A predictive control scheme for automated demand response mechanisms
Lampropoulos, I.; Bosch, van den P.P.J.; Kling, W.L.
2012-01-01
The development of demand response mechanisms can provide a considerable option for the integration of renewable energy sources and the establishment of efficient generation and delivery of electrical power. The full potential of demand response can be significant, but its exploration still remains
Adductor-related groin pain in athletes: correlation of MR imaging with clinical findings
International Nuclear Information System (INIS)
Robinson, P.; Barron, D.A.; Grainger, A.J.; O'Connor, P.J.; Parsons, W.; Schilders, E.M.G.
2004-01-01
To evaluate gadolinium-enhanced MR imaging in athletes with chronic groin pain and correlate with the clinical features. MR examinations performed in 52 athletes (51 male, 1 female; median age 26 years) with chronic groin pain and 6 asymptomatic control athletes (6 male; median age 29 years) were independently reviewed by two radiologists masked to the clinical details. Symptom duration (median 6 months) and clinical side of severity were recorded. Anatomical areas in the pelvis were scored for abnormality (as normal, mildly abnormal or abnormal) and an overall assessment for side distribution of abnormality was recorded, initially without post-gadolinium sequences and then, 3 weeks later (median 29 days), the post-gadolinium sequences only. Correlation between radiological and clinical abnormality was calculated by Spearman's correlation. Abnormal anterior pubis and enthesis enhancement significantly correlated with clinical side for both radiologists (both P=0.008). Abnormal anterior pubis and adductor longus enthesis oedema was significant for one radiologist (P=0.009). All other features showed no significant correlation (P>0.05). In the control cases there was no soft tissue abnormality but symphyseal irregularity was present (n=2). For both radiologists assessment of imaging side severity significantly correlated with clinical side for post-gadolinium (P=0.048 and P=0.023) but not non-gadolinium sequences (P>0.05). The extent and side of anterior pubis and adductor longus enthesis abnormality on MR imaging significantly and reproducibly correlates with the athletes' current symptoms in chronic adductor-related groin pain. (orig.)
29 CFR 99.400 - Responsibilities.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Responsibilities. 99.400 Section 99.400 Labor Office of the... Pass-through Entities § 99.400 Responsibilities. (a) Cognizant agency for audit responsibilities... the report submission due date required by § 99.320(a). The cognizant agency for audit may grant...
Serai, Suraj D; Dillman, Jonathan R; Trout, Andrew T
2017-03-01
Purpose To compare two-dimensional (2D) gradient-recalled echo (GRE) and 2D spin-echo (SE) echo-planar imaging (EPI) magnetic resonance (MR) elastography for measurement of hepatic stiffness in pediatric and young adult patients suspected of having liver disease. Materials and Methods In this institutional review board-approved, HIPAA-compliant study, 58 patients underwent both 2D GRE and 2D SE-EPI MR elastography at 1.5 T during separate breath holds. Liver stiffness (mean of means; in kilopascals) was measured by five blinded reviewers. Pooled mean liver stiffness and region-of-interest (ROI) size were compared by using paired t tests. Intraclass correlation coefficients (ICCs) were used to assess agreement between techniques. Respiratory motion artifacts were compared across sequences by using the Fisher exact test. Results Mean patient age was 14.7 years ± 5.2 (standard deviation; age range, 0.7-20.5 years), and 55.2% (32 of 58) of patients were male. Mean liver stiffness was 2.92 kPa ± 1.29 measured at GRE MR elastography and 2.76 kPa ± 1.39 at SE-EPI MR elastography (n = 290; P = .15). Mean ROI sizes were 8495 mm 2 ± 4482 for 2D GRE MR elastography and 15 176 mm 2 ± 7609 for 2D SE-EPI MR elastography (n = 290; P range, 0.91-0.95). Moderate or severe breathing artifacts were observed on 27.5% (16 of 58) of 2D GRE images versus 0% 2D SE-EPI images (P < .001). Conclusion There is excellent agreement on measured hepatic stiffness between 2D GRE and 2D SE-EPI MR elastography across multiple reviewers. SE-EPI MR elastography allowed for stiffness measurement across larger areas of the liver and can be performed in a single breath hold. © RSNA, 2016.
Berg, W A; Caskey, C I; Hamper, U M; Kuhlman, J E; Anderson, N D; Chang, B W; Sheth, S; Zerhouni, E A
1995-10-01
To evaluate the accuracy of magnetic resonance (MR) and ultrasound (US) criteria for breast implant integrity. One hundred twenty-two single-lumen silicone breast implants and 22 bilumen implants were evaluated with surface coil MR imaging and US and surgically removed. MR criteria for implant failure were a collapsed implant shell ("linguine sign"), foci of silicone outside the shell ("noose sign"), and extracapsular gel, US criteria were collapsed shell, low-level echoes within the gel, and "snowstorm" echoes of extracapsular silicone. Among single-lumen implants, MR imaging depicted 39 of 40 ruptures, 14 of 28 with minimal leakage; 49 of 54 intact implants were correctly interpreted. US depicted 26 of 40 ruptured implants, four of 28 with minimal leakage, and 30 of 54 intact implants. Among bilumen implants, MR imaging depicted four of five implants with rupture of both lumina and nine of 10 as intact; US depicted one rupture and helped identify two of 10 as intact. Mammography accurately depicted the status of 29 of 30 bilumen implants with MR imaging correlation. MR imaging depicts implant integrity more accurately than US; neither method reliably depicts minimal leakage with shell collapse. Mammography is useful in screening bilumen implant integrity.
International Nuclear Information System (INIS)
Inada, Yuki; Matsuki, Mitsuru; Nakai, Go; Tatsugami, Fuminari; Tanikake, Masato; Narabayashi, Isamu; Yamada, Takashi; Tsuji, Motomu
2009-01-01
Objective: In this study, the authors discussed the feasibility and value of diffusion-weighted (DW) MR imaging in the detection of uterine endometrial cancer in addition to conventional nonenhanced MR images. Methods and materials: DW images of endometrial cancer in 23 patients were examined by using a 1.5-T MR scanner. This study investigated whether or not DW images offer additional incremental value to conventional nonenhanced MR imaging in comparison with histopathological results. Moreover, the apparent diffusion coefficient (ADC) values were measured in the regions of interest within the endometrial cancer and compared with those of normal endometrium and myometrium in 31 volunteers, leiomyoma in 14 patients and adenomyosis in 10 patients. The Wilcoxon rank sum test was used, with a p -3 mm 2 /s, which was significantly lower than those of the normal endometrium, myometrium, leiomyoma and adenomyosis (p < 0.05). Conclusion: DW imaging can be helpful in the detection of uterine endometrial cancer in nonenhanced MR imaging.
Aggregated Demand Response Modelling for Future Grid Scenarios
Marzooghi, Hesamoddin; Verbic, Gregor; Hill, David J.
2015-01-01
With the increased penetration of intermittent renewable energy sources (RESs) in future grids (FGs), balancing between supply and demand will become more dependent on demand response (DR) and energy storage. Thus, FG feasibility studies will need to consider DR for modelling nett future demand. Against this backdrop, this paper proposes a demand model which integrates the aggregated effect of DR in a simplified representation of the effect of market/dispatch processes aiming at minimising th...
MKP1 phosphatase mediates G1-specific dephosphorylation of H3Serine10P in response to DNA damage
Energy Technology Data Exchange (ETDEWEB)
Sharma, Ajit K.; Khan, Shafqat A.; Sharda, Asmita; Reddy, Divya V; Gupta, Sanjay, E-mail: sgupta@actrec.gov.in
2015-08-15
Highlights: • Reversible reduction of H3S10 phosphorylation after DNA damage is G1 phase specific. • Dynamic balance between MAP kinases, MKP1 and MSK1 regulate H3S10P during DDR. • MKP1 associates with chromatin bearing γH2AX in response to DNA damage. • Inhibition of MKP1 activity with specific inhibitor promotes radiation-induced cell death. - Abstract: Histone mark, H3S10 phosphorylation plays a dual role in a cell by maintaining relaxed chromatin for active transcription in interphase and condensed chromatin state in mitosis. The level of H3S10P has also been shown to alter on DNA damage; however, its cell cycle specific behavior and regulation during DNA damage response is largely unexplored. In the present study, we demonstrate G1 cell cycle phase specific reversible loss of H3S10P in response to IR-induced DNA damage is mediated by opposing activities of phosphatase, MKP1 and kinase, MSK1 of the MAP kinase pathway. We also show that the MKP1 recruits to the chromatin in response to DNA damage and correlates with the decrease of H3S10P, whereas MKP1 is released from chromatin during recovery phase of DDR. Furthermore, blocking of H3S10 dephosphorylation by MKP1 inhibition impairs DNA repair process and results in poor survival of WRL68 cells. Collectively, our data proposes a pathway regulating G1 cell cycle phase specific reversible reduction of H3S10P on IR induced DNA damage and also raises the possibility of combinatorial modulation of H3S10P with specific inhibitors to target the cancer cells in G1-phase of cell cycle.
George, J M; Fiori, S; Fripp, J; Pannek, K; Bursle, J; Moldrich, R X; Guzzetta, A; Coulthard, A; Ware, R S; Rose, S E; Colditz, P B; Boyd, R N
2017-07-01
The diagnostic and prognostic potential of brain MR imaging before term-equivalent age is limited until valid MR imaging scoring systems are available. This study aimed to validate an MR imaging scoring system of brain injury and impaired growth for use at 29 to 35 weeks postmenstrual age in infants born at Toddler Development, 3rd ed. (Bayley III), and the Neuro-Sensory Motor Developmental Assessment. Early MR imaging global, WM, and deep gray matter scores were negatively associated with Bayley III motor (regression coefficient for global score β = -1.31; 95% CI, -2.39 to -0.23; P = .02), cognitive (β = -1.52; 95% CI, -2.39 to -0.65; P < .01) and the Neuro-Sensory Motor Developmental Assessment outcomes (β = -1.73; 95% CI, -3.19 to -0.28; P = .02). Early MR imaging cerebellar scores were negatively associated with the Neuro-Sensory Motor Developmental Assessment (β = -5.99; 95% CI, -11.82 to -0.16; P = .04). Results were reconfirmed at term-equivalent-age MR imaging. This clinically accessible MR imaging scoring system is valid for use at 29 to 35 weeks postmenstrual age in infants born very preterm. It enables identification of infants at risk of adverse outcomes before the current standard of term-equivalent age. © 2017 by American Journal of Neuroradiology.
Demand response from the non-domestic sector: Early UK experiences and future opportunities
International Nuclear Information System (INIS)
Grünewald, Philipp; Torriti, Jacopo
2013-01-01
Demand response is believed by some to become a major contributor towards system balancing in future electricity networks. Shifting or reducing demand at critical moments can reduce the need for generation capacity, help with the integration of renewables, support more efficient system operation and thereby potentially lead to cost and carbon reductions for the entire energy system. In this paper we review the nature of the response resource of consumers from different non-domestic sectors in the UK, based on extensive half hourly demand profiles and observed demand responses. We further explore the potential to increase the demand response capacity through changes in the regulatory and market environment. The analysis suggests that present demand response measures tend to stimulate stand-by generation capacity in preference to load shifting and we propose that extended response times may favour load based demand response, especially in sectors with significant thermal loads. - Highlights: • Empirical demand response data from non-domestic sector evaluated. • Load profiles suggest strong sector dependence on availability response at system peak. • Majority of aggregated demand response still stems from stand-by generation, not from demand turn down. • Scope for substantial increase in demand response capacity if response times were extended
Demonstrating demand response from water distribution system through pump scheduling
International Nuclear Information System (INIS)
Menke, Ruben; Abraham, Edo; Parpas, Panos; Stoianov, Ivan
2016-01-01
Highlights: • Water distribution systems can profitably provide demand response energy. • STOR and FFR are financially viable under a wide range of operating conditions. • Viability depends on the pump utilisation and peak price of the electricity tariff. • Total GHG emissions caused by the provision of reserve energy are <300 gCO_2/kW h. • These are lower than those from the major reserve energy provision technologies. - Abstract: Significant changes in the power generation mix are posing new challenges for the balancing systems of the grid. Many of these challenges are in the secondary electricity grid regulation services and could be met through demand response (DR) services. We explore the opportunities for a water distribution system (WDS) to provide balancing services with demand response through pump scheduling and evaluate the associated benefits. Using a benchmark network and demand response mechanisms available in the UK, these benefits are assessed in terms of reduced green house gas (GHG) emissions from the grid due to the displacement of more polluting power sources and additional revenues for water utilities. The optimal pump scheduling problem is formulated as a mixed-integer optimisation problem and solved using a branch and bound algorithm. This new formulation finds the optimal level of power capacity to commit to the provision of demand response for a range of reserve energy provision and frequency response schemes offered in the UK. For the first time we show that DR from WDS can offer financial benefits to WDS operators while providing response energy to the grid with less greenhouse gas emissions than competing reserve energy technologies. Using a Monte Carlo simulation based on data from 2014, we demonstrate that the cost of providing the storage energy is less than the financial compensation available for the equivalent energy supply. The GHG emissions from the demand response provision from a WDS are also shown to be smaller than
Energy Technology Data Exchange (ETDEWEB)
Izquierdo-Garcia, David [Mount Sinai School of Medicine, Translational and Molecular Imaging Institute, New York, NY (United States); Department of Radiology, Massachusetts General Hospital and Harvard Medical School, Athinoula A. Martinos Center for Biomedical Imaging, Charlestown, MA (United States); Sawiak, Stephen J. [University of Cambridge, Wolfson Brain Imaging Centre, Cambridge (United Kingdom); Knesaurek, Karin; Machac, Joseph [Mount Sinai School of Medicine, Division of Nuclear Medicine, Department of Radiology, New York, NY (United States); Narula, Jagat [Mount Sinai School of Medicine, Department of Cardiology, Zena and Michael A. Weiner Cardiovascular Institute and Marie-Josee and Henry R. Kravis Cardiovascular Health Center, New York, NY (United States); Fuster, Valentin [Mount Sinai School of Medicine, Department of Cardiology, Zena and Michael A. Weiner Cardiovascular Institute and Marie-Josee and Henry R. Kravis Cardiovascular Health Center, New York, NY (United States); The Centro Nacional de Investigaciones Cardiovasculares (CNIC), Madrid (Spain); Fayad, Zahi A. [Mount Sinai School of Medicine, Translational and Molecular Imaging Institute, New York, NY (United States); Mount Sinai School of Medicine, Department of Cardiology, Zena and Michael A. Weiner Cardiovascular Institute and Marie-Josee and Henry R. Kravis Cardiovascular Health Center, New York, NY (United States); Mount Sinai School of Medicine, Department of Radiology, New York, NY (United States)
2014-08-15
The objective of this study was to evaluate the performance of the built-in MR-based attenuation correction (MRAC) included in the combined whole-body Ingenuity TF PET/MR scanner and compare it to the performance of CT-based attenuation correction (CTAC) as the gold standard. Included in the study were 26 patients who underwent clinical whole-body FDG PET/CT imaging and subsequently PET/MR imaging (mean delay 100 min). Patients were separated into two groups: the alpha group (14 patients) without MR coils during PET/MR imaging and the beta group (12 patients) with MR coils present (neurovascular, spine, cardiac and torso coils). All images were coregistered to the same space (PET/MR). The two PET images from PET/MR reconstructed using MRAC and CTAC were compared by voxel-based and region-based methods (with ten regions of interest, ROIs). Lesions were also compared by an experienced clinician. Body mass index and lung density showed significant differences between the alpha and beta groups. Right and left lung densities were also significantly different within each group. The percentage differences in uptake values using MRAC in relation to those using CTAC were greater in the beta group than in the alpha group (alpha group -0.2 ± 33.6 %, R{sup 2} = 0.98, p < 0.001; beta group 10.31 ± 69.86 %, R{sup 2} = 0.97, p < 0.001). In comparison to CTAC, MRAC led to underestimation of the PET values by less than 10 % on average, although some ROIs and lesions did differ by more (including the spine, lung and heart). The beta group (imaged with coils present) showed increased overall PET quantification as well as increased variability compared to the alpha group (imaged without coils). PET data reconstructed with MRAC and CTAC showed some differences, mostly in relation to air pockets, metallic implants and attenuation differences in large bone areas (such as the pelvis and spine) due to the segmentation limitation of the MRAC method. (orig.)
Directory of Open Access Journals (Sweden)
Stefano Delli Pizzi
Full Text Available To prospectively evaluate the feasibility of using magnetic resonance (MR techniques for in-vivo assessing a rat diabetic model of limb ischemia. Unilateral hind limb ischemia was induced by ligation of the iliac-femoral artery in male streptozotocin-treated and non-diabetic control rats. Four weeks after ligation, rats underwent MR Angiography (MRA, T(1-weighted and Short Time Inversion Recovery (STIR sequences and muscle Proton MR Spectroscopy ((1H-MRS on both hind limbs. After MR examinations, immunoblotting and immunofluorescence analysis were performed. MRA showed a signal void due to flow discontinuation distal to the artery ligation. T(1-weighted and STIR images showed, respectively, the presence of tissue swelling (p = 0.018 for non-diabetic; p = 0.027 for diabetic rats and signal hyperintensity in tissue affected by occlusion. Mean total creatine/water for the occluded limb was significantly lower than for the non-occluded limbs in both non-diabetic (5.46×10(-4 vs 1.14×10(-3, p = 0.028 and diabetic rats (1.37×10(-4 vs 1.10×10(-3; p = 0.018. MR Imaging and (1H-MRS changes were more pronounced in diabetic than in non-diabetic occluded limbs (p = 0.032. MR findings were confirmed by using histological findings. Combined MR techniques can be used to demonstrate the presence of structural and metabolic changes produced by iliac-femoral artery occlusion in rat diabetic model of limb ischemia.
Pulmonary branch arterial flow can be measured with cine MR velocity mapping
International Nuclear Information System (INIS)
Caputo, G.R.; Kondo, C.; Masui, T.; Foster, E.; Geraci, S.J.; O'Sullivan, M.; Higgins, C.B.
1990-01-01
This paper assesses the capability of cine MR phase velocity mapping (CVM) to measure main, right-sided, and left-sided pulmonary arterial (PA) blood flow. The authors examined a constant-flow phantom and nine healthy volunteers with use of 1.5-T MR imaging system (GE Signa) with phase velocity cine sequences. CVM correctly measured constant-flow phantom velocities (range, 20-190 cm/sec; r = .998, SEE = 4.2 cm/sec), and velocity with use of angulated planes to section the phantom tube perpendicularly. CVM peak systolic main PA velocity (79 cm/sec ± 10) correlated well with Doppler US measurements (80 cm/sec ± 7). CVM main PA flow correlated well with conventional cine MR LV stroke volume measurements (r = .98, SEE = 4.8 mL). Left and right PA flow on the angulated planes were 29 mL ± 7 and 34 mL ± 10, respectively
Energy Technology Data Exchange (ETDEWEB)
Dohan, Anthony, E-mail: anthony.dohan@lrb.aphp.fr [Department of Body and Interventional Imaging, Hôpital Lariboisière, AP-HP, 2 Rue Ambroise Paré, 75475 Paris Cedex 10 (France); Université Paris-Diderot, Sorbonne Paris Cité, 10 Rue de Verdun, 75010 Paris (France); UMR INSERM 965, Hôpital Lariboisière, 2 Rue Amboise Paré, 75010 Paris (France); Gavini, Jean-Philippe, E-mail: jpgavini@gmail.com [Department of Body and Interventional Imaging, Hôpital Lariboisière, AP-HP, 2 Rue Ambroise Paré, 75475 Paris Cedex 10 (France); Université Paris-Diderot, Sorbonne Paris Cité, 10 Rue de Verdun, 75010 Paris (France); Placé, Vinciane, E-mail: vinciane.place@gmail.com [Department of Body and Interventional Imaging, Hôpital Lariboisière, AP-HP, 2 Rue Ambroise Paré, 75475 Paris Cedex 10 (France); Sebbag, Delphine, E-mail: delphinesebbag@gmail.com [Department of Body and Interventional Imaging, Hôpital Lariboisière, AP-HP, 2 Rue Ambroise Paré, 75475 Paris Cedex 10 (France); Université Paris-Diderot, Sorbonne Paris Cité, 10 Rue de Verdun, 75010 Paris (France); Vignaud, Alexandre, E-mail: alexandre.vignaud@cea.fr [LRMN, Neurospin, CEA-SACLAY, Bâtiment 145, 91 191 Gif-sur-Yvette Cedex (France); and others
2013-11-01
Objective: To qualitatively and quantitatively compare T2-weighted MR imaging of the liver using volumetric spin-echo with sampling perfection with application-optimized contrast using different flip angle evolutions (SPACE) with conventional turbo spin-echo (TSE) sequence for fat-suppressed T2-weighted MR imaging of the liver. Materials and methods: Thirty-three patients with suspected focal liver lesions had SPACE MR imaging and conventional fat-suppressed TSE MR imaging. Images were analyzed quantitatively by measuring the lesion-to-liver contrast-to-noise ratio (CNR), and the signal-to-noise ratio (SNR) of main focal hepatic lesions, hepatic and splenic parenchyma and qualitatively by evaluating the presence of vascular, respiratory motion and cardiac artifacts. Wilcoxon signed rank test was used to search for differences between the two sequences. Results: SPACE MR imaging showed significantly greater CNR for focal liver lesions (median = 22.82) than TSE MR imaging (median = 14.15) (P < .001). No differences were found for SNR of hepatic parenchyma (P = .097), main focal hepatic lesions (P = .35), and splenic parenchyma (P = .25). SPACE sequence showed less artifacts than TSE sequence (vascular, P < .001; respiratory motion, P < .001; cardiac, P < .001) but needed a longer acquisition time (228.4 vs. 162.1 s; P < .001). Conclusion: SPACE MR imaging provides a significantly increased CNR for focal liver lesions and less artifacts by comparison with the conventional TSE sequence. These results should stimulate further clinical studies with a surgical standard of reference to compare the two techniques in terms of sensitivity for malignant lesions.
International Nuclear Information System (INIS)
Gilbraith, Nathaniel; Powers, Susan E.
2013-01-01
Many urban areas in the United States have experienced difficulty meeting the National Ambient Air Quality Standards (NAAQS), partially due to pollution from electricity generating units. We evaluated the potential for residential demand response to reduce pollutant emissions on days with above average pollutant emissions and a high potential for poor air quality. The study focused on New York City (NYC) due to non-attainment with NAAQS standards, large exposed populations, and the existing goal of reducing pollutant emissions. The baseline demand response scenario simulated a 1.8% average reduction in NYC peak demand on 49 days throughout the summer. Nitrogen oxide and particulate matter less than 2.5 μm in diameter emission reductions were predicted to occur (−70, −1.1 metric tons (MT) annually), although, these were not likely to be sufficient for NYC to meet the NAAQS. Air pollution mediated damages were predicted to decrease by $100,000–$300,000 annually. A sensitivity analysis predicted that substantially larger pollutant emission reductions would occur if electricity demand was shifted from daytime hours to nighttime hours, or the total consumption decreased. Policies which incentivize shifting electricity consumption away from periods of high human and environmental impacts should be implemented, including policies directed toward residential consumers. - Highlights: • The impact of residential demand response on air emissions was modeled. • Residential demand response will decrease pollutant emissions in NYC. • Emissions reductions occur during periods with high potential for poor air quality. • Shifting demand to nighttime hours was more beneficial than to off-peak daytime hours
International Nuclear Information System (INIS)
Hajek, M.; Horska, A.; Grosmanova, A.; Urban, P.; Suchanek, M.; Jirasek, A.
1990-01-01
31 P MR spectroscopy was used to investigate neuromuscular diseases of various origin in 35 patients, mostly children. In devising the procedure of MR examination and of evaluation of results, pattern recognition analysis was used. According to the results of 31 P MR spectroscopy, the patients can be divided into three groups. Group A comprises patients with severe muscular lesions such as Duchenne dystrophy. The second, B group is characterized by milder atrophic changes of muscle fibres. The third group comprises dubious cases. The 31 P MRS method was also used for investigating the development of the disease in time - a decrease in parameter P CR /P i (P CR is an indicator of phosphocreatinine and P i an indicator of inorganic phosphate) corresponds to a deterioration of the clinical condition of patients from group one. In group B fairly stable values of the parameter were observed. An increase in P CR /P i was also observed during administration of Prednisone in a patient with child polymyositis. 3 figs., 3 tabs., 23 refs
An electricity generation planning model incorporating demand response
International Nuclear Information System (INIS)
Choi, Dong Gu; Thomas, Valerie M.
2012-01-01
Energy policies that aim to reduce carbon emissions and change the mix of electricity generation sources, such as carbon cap-and-trade systems and renewable electricity standards, can affect not only the source of electricity generation, but also the price of electricity and, consequently, demand. We develop an optimization model to determine the lowest cost investment and operation plan for the generating capacity of an electric power system. The model incorporates demand response to price change. In a case study for a U.S. state, we show the price, demand, and generation mix implications of a renewable electricity standard, and of a carbon cap-and-trade policy with and without initial free allocation of carbon allowances. This study shows that both the demand moderating effects and the generation mix changing effects of the policies can be the sources of carbon emissions reductions, and also shows that the share of the sources could differ with different policy designs. The case study provides different results when demand elasticity is excluded, underscoring the importance of incorporating demand response in the evaluation of electricity generation policies. - Highlights: ► We develop an electric power system optimization model including demand elasticity. ► Both renewable electricity and carbon cap-and-trade policies can moderate demand. ► Both policies affect the generation mix, price, and demand for electricity. ► Moderated demand can be a significant source of carbon emission reduction. ► For cap-and-trade policies, initial free allowances change outcomes significantly.
10 CFR 1.29 - Office of International Programs.
2010-01-01
... maintains working relationships with individual countries and international nuclear organizations, as well... 10 Energy 1 2010-01-01 2010-01-01 false Office of International Programs. 1.29 Section 1.29 Energy... Staff § 1.29 Office of International Programs. The Office of International Programs— (a) Advises the...
Demand response scheme based on lottery-like rebates
Schwartz, Galina A.; Tembine, Hamidou; Amin, Saurabh; Sastry, S. Shankar
2014-01-01
In this paper, we develop a novel mechanism for reducing volatility of residential demand for electricity. We construct a reward-based (rebate) mechanism that provides consumers with incentives to shift their demand to off-peak time. In contrast to most other mechanisms proposed in the literature, the key feature of our mechanism is its modest requirements on user preferences, i.e., it does not require exact knowledge of user responsiveness to rewards for shifting their demand from the peak to the off-peak time. Specifically, our mechanism utilizes a probabilistic reward structure for users who shift their demand to the off-peak time, and is robust to incomplete information about user demand and/or risk preferences. We approach the problem from the public good perspective, and demonstrate that the mechanism can be implemented via lottery-like schemes. Our mechanism permits to reduce the distribution losses, and thus improve efficiency of electricity distribution. Finally, the mechanism can be readily incorporated into the emerging demand response schemes (e.g., the time-of-day pricing, and critical peak pricing schemes), and has security and privacy-preserving properties.
Demand response scheme based on lottery-like rebates
Schwartz, Galina A.
2014-08-24
In this paper, we develop a novel mechanism for reducing volatility of residential demand for electricity. We construct a reward-based (rebate) mechanism that provides consumers with incentives to shift their demand to off-peak time. In contrast to most other mechanisms proposed in the literature, the key feature of our mechanism is its modest requirements on user preferences, i.e., it does not require exact knowledge of user responsiveness to rewards for shifting their demand from the peak to the off-peak time. Specifically, our mechanism utilizes a probabilistic reward structure for users who shift their demand to the off-peak time, and is robust to incomplete information about user demand and/or risk preferences. We approach the problem from the public good perspective, and demonstrate that the mechanism can be implemented via lottery-like schemes. Our mechanism permits to reduce the distribution losses, and thus improve efficiency of electricity distribution. Finally, the mechanism can be readily incorporated into the emerging demand response schemes (e.g., the time-of-day pricing, and critical peak pricing schemes), and has security and privacy-preserving properties.
Unlocking the potential for efficiency and demand response throughadvanced metering
Energy Technology Data Exchange (ETDEWEB)
Levy, Roger; Herter, Karen; Wilson, John
2004-06-30
Reliance on the standard cumulative kilowatt-hour meter substantially compromises energy efficiency and demand response programs. Without advanced metering, utilities cannot support time-differentiated rates or collect the detailed customer usage information necessary to (1)educate the customer to the economic value of efficiency and demand response options, or (2) distribute load management incentives proportional to customer contribution. These deficiencies prevent the customer feedback mechanisms that would otherwise encourage economically sound demand-side investments and behaviors. Thus, the inability to collect or properly price electricity usage handicaps the success of almost all efficiency and demand response options. Historically, implementation of the advanced metering infrastructure (AMI) necessary for the successful efficiency and demand response programs has been prevented by inadequate cost-benefit analyses. A recent California effort has produced an expanded cost-effectiveness methodology for AMI that introduces previously excluded benefits. In addition to utility-centric costs and benefits, the new model includes qualitative and quantitative costs and benefits that accrue to both customers and society.
Czech Academy of Sciences Publication Activity Database
Kořínek, Radim; Gajdošík, M.; Trattnig, S.; Krššák, M.
2016-01-01
Roč. 29, S1 (2016), s. 203 E-ISSN 1352-8661. [ESMRMB 2016 Congress. 29.09.2016-01.10.2016, Vienna] R&D Projects: GA ČR GA13-09086S; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : MR spectroscopy * quantification of low fat fractions Subject RIV: BH - Optics, Masers, Lasers
In vivo 31P MR spectroscopy of breast tumors: preliminary results
International Nuclear Information System (INIS)
Choe, Bo Young; Kim, Hak Hee; Suh, Tae Suk; Shinn, Kyung Sub; Jung, Sang Seol
1995-01-01
To evaluate the various phosphorus metabolism of breast tumors with use of in vivo phosphorus-31 ( 31 P) MR spectroscopy (MRS). Five patients with breast tumor (benign in two, malignant in three) and three normal healthy volunteers participated in this study. All in vivo 31 P MRS examinations were performed on 1.5T whole-body MRI/MRS system by using a Free Induction Decay (FID) pulse sequence. T1-weighted MR images were used for localization of tumors. Peak areas for each phosphorus metabolite were measured using a Marquart algorithm. Breast carcinoma had a substantially larger phosphomonoester (PME) and a smaller phosphocreatine (PCr) peak intensity than normal breast tissue. This was reflected in the relatively higher PME/PCr ratio of breast carcinomas as well as phosphodiester (PDE)/PCr, inorganic phosphate (Pi)/PCr, and adenosine triphosphate (ATP)/PCr ratios, compared with normal controls. The mean pH value of breast tumor demonstrating the alkaline nature was higher than that of normal controls. Spectral patterns between benign breast disease and normal breast tissue were quite similar, and differentiation was not established. Our preliminary study suggests that in vivo 31 P MRS is a noninvasive examination which may be useful in the early differentiation of malignant breast tumors from normal and benign conditions. However, normal control and benign conditions could not be characterized on the basis of the phosphorus metabolite ratios
Price elasticity matrix of demand in power system considering demand response programs
Qu, Xinyao; Hui, Hongxun; Yang, Shengchun; Li, Yaping; Ding, Yi
2018-02-01
The increasing renewable energy power generations have brought more intermittency and volatility to the electric power system. Demand-side resources can improve the consumption of renewable energy by demand response (DR), which becomes one of the important means to improve the reliability of power system. In price-based DR, the sensitivity analysis of customer’s power demand to the changing electricity prices is pivotal for setting reasonable prices and forecasting loads of power system. This paper studies the price elasticity matrix of demand (PEMD). An improved PEMD model is proposed based on elasticity effect weight, which can unify the rigid loads and flexible loads. Moreover, the structure of PEMD, which is decided by price policies and load types, and the calculation method of PEMD are also proposed. Several cases are studied to prove the effectiveness of this method.
MR imaging of von Hippel-Lindau disease
International Nuclear Information System (INIS)
Sato, Y.; Waziri, M.H.; Smith, W.L.; Frey, E.E.; Franken, E.A.
1986-01-01
Sixteen patients with von Hippel-Lindau disease (VH-L) and 11 asymptomatic family members underwent a total of 29 central nervous system (CNS) and 23 body MR imaging evaluations during a 2-year study period. Nineteen CNS and spinal lesions and nine abdominal visceral lesions were identified on MR imaging and were confirmed at surgery or by other imaging modalities. MR imaging is superior to CT in the evaluation of intraocular vitreous abnormalities and cerebellar and spinal hemangioblastomas because of superior tissue characterization and lack of bone artifacts. MR imaging adequately demonstrated the abdominal visceral lesions. MR imaging is a sensitive and reliable imaging modality for the various lesions of VH-L
Miah, Gous; Rafii, Mohd Y; Ismail, Mohd R; Puteh, Adam B; Rahim, Harun A; Latif, Mohammad A
2017-07-01
The rice cultivar MR219 is famous for its better yield and long and fine grain quality; however, it is susceptible to blast disease. The main objective of this study was to introgress blast resistance genes into MR219 through marker-assisted selection (MAS). The rice cultivar MR219 was used as the recurrent parent, and Pongsu Seribu 1 was used as the donor. Marker-assisted foreground selection was performed using RM6836 and RM8225 to identify plants possessing blast resistance genes. Seventy microsatellite markers were used to estimate recurrent parent genome (RPG) recovery. Our analysis led to the development of 13 improved blast resistant lines with Piz, Pi2 and Pi9 broad-spectrum blast resistance genes and an MR219 genetic background. The RPG recovery of the selected improved lines was up to 97.70% with an average value of 95.98%. Selected improved lines showed a resistance response against the most virulent blast pathogen pathotype, P7.2. The selected improved lines did not express any negative effect on agronomic traits in comparison with MR219. The research findings of this study will be a conducive approach for the application of different molecular techniques that may result in accelerating the development of new disease-resistant rice varieties, which in turn will match rising demand and food security worldwide. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Demand response offered by households with direct electric heating
International Nuclear Information System (INIS)
Kofod, C.; Togeby, M.
2004-01-01
The peak power balance in the Nordic power system is gradually turning to be very tight, especially in the electric area of southern Sweden and eastern Denmark. Power stations are closed and hardly any investments in new production are carried out. Demand response is considered essential when the formation of spot prices shall send the signal of needed investments in new capacity. Demand response which are based on individual preferences, and carried out automatically, can be one way to increase the volume of price elastic demand. Demand response need hourly metering for calculation and documentation of the decrease in demand, and controllability in order to meet the timing requirements. Within the EU SAVE project EFFLOCOM (2002 - 2004), a Danish demand response pilot project was established in 2003 including 25 single family homes with direct electrical heating. The system has been tested during the winter 2003/2004. The tested technologies include hourly metering, communication by GRPS as well as the Internet. GPRS is used for daily remote meter reading and automatic control of the electric heating including individual control of up to five zones. The system is designed for automatic activation when the Nord Pool hourly Elspot prices exceed preset levels. The system can also be used as regulating power. The EFFLOCOM Web Bite includes an interactive demonstrator of the system. The developed customer Web Bite is including the services: 1) Access to setting the limits for the maximum duration of interruption for up to five different control zones for two periods of the day and for three price levels. 2) Access to stop an actual interruption. 3) A report on the hourly, daily, weekly and monthly use of electricity and the saved bonus by demand response control. The report is updated daily. The goals of up to 5 kW controlled per house were fulfilled. Besides the demand response bonus the customers have also saved electricity. A customer survey did show that the
International Nuclear Information System (INIS)
Tan, Zhongfu; Ju, Liwei; Reed, Brent; Rao, Rao; Peng, Daoxin; Li, Huanhuan; Pan, Ge
2015-01-01
Highlights: • Our research focuses on demand response behaviors of multi-type customers. • A wind power simulation method is proposed based on the Brownian motion theory. • Demand response revenue functions are proposed for multi-type customers. • A robust stochastic optimization model is proposed for wind power consumptive. • Models are built to measure the impacts of demand response on wind power consumptive. - Abstract: In order to relieve the influence of wind power uncertainty on power system operation, demand response and robust stochastic theory are introduced to build a stochastic scheduling optimization model. Firstly, this paper presents a simulation method for wind power considering external environment based on Brownian motion theory. Secondly, price-based demand response and incentive-based demand response are introduced to build demand response model. Thirdly, the paper constructs the demand response revenue functions for electric vehicle customers, business customers, industry customers and residential customers. Furthermore, robust stochastic optimization theory is introduced to build a wind power consumption stochastic optimization model. Finally, simulation analysis is taken in the IEEE 36 nodes 10 units system connected with 650 MW wind farms. The results show the robust stochastic optimization theory is better to overcome wind power uncertainty. Demand response can improve system wind power consumption capability. Besides, price-based demand response could transform customers’ load demand distribution, but its load curtailment capacity is not as obvious as incentive-based demand response. Since price-based demand response cannot transfer customer’s load demand as the same as incentive-based demand response, the comprehensive optimization effect will reach best when incentive-based demand response and price-based demand response are both introduced.
Time-of-use based electricity demand response for sustainable manufacturing systems
International Nuclear Information System (INIS)
Wang, Yong; Li, Lin
2013-01-01
As required by the Energy Policy Act of 2005, utility companies across the U.S. are offering TOU (time-of-use) based electricity demand response programs. The TOU rate gives consumers opportunities to manage their electricity bill by shifting use from on-peak periods to mid-peak and off-peak periods. Reducing the amount of electricity needed during the peak load times makes it possible for the power grid to meet consumers' needs without building more costly backup infrastructures and help reduce GHG (greenhouse gas) emissions. Previous research on the applications of TOU and other electricity demand response programs has been mainly focused on residential and commercial buildings while largely neglected industrial manufacturing systems. This paper proposes a systems approach for TOU based electricity demand response for sustainable manufacturing systems under the production target constraint. Key features of this approach include: (i) the electricity related costs including both consumption and demand are integrated into production system modeling; (ii) energy-efficient and demand-responsive production scheduling problems are formulated and the solution technique is provided; and (iii) the effects of various factors on the near-optimal scheduling solutions are examined. The research outcome is expected to enhance the energy efficiency, electricity demand responsiveness, and cost effectiveness of modern manufacturing systems. - Highlights: • We propose a TOU based demand response approach for manufacturing systems. • Both electricity consumption and demand are integrated into the system modeling. • Energy-efficient and demand-responsive production scheduling problems are formulated. • The meta-heuristic solution technique is provided. • The effects of various factors on the scheduling solutions are examined
Measuring the financial impact of demand response for electricity retailers
International Nuclear Information System (INIS)
Feuerriegel, Stefan; Neumann, Dirk
2014-01-01
Due to the integration of intermittent resources of power generation such as wind and solar, the amount of supplied electricity will exhibit unprecedented fluctuations. Electricity retailers can partially meet the challenge of matching demand and volatile supply by shifting power demand according to the fluctuating supply side. The necessary technology infrastructure such as Advanced Metering Infrastructures for this so-called Demand Response (DR) has advanced. However, little is known about the economic dimension and further effort is strongly needed to realistically quantify the financial impact. To succeed in this goal, we derive an optimization problem that minimizes procurement costs of an electricity retailer in order to control Demand Response usage. The evaluation with historic data shows that cost volatility can be reduced by 7.74%; peak costs drop by 14.35%; and expenditures of retailers can be significantly decreased by 3.52%. - Highlights: • Ex post simulation to quantify financial impacts of demand response. • Effects of Demand Response are simulated based on real-world data. • Procurement costs of an average electricity retailer decrease by 3.4%. • Retailers can cut hourly peak expenditures by 12.1%. • Cost volatility is reduced by 12.2%
Radiative proton capture to the first excited state of sup 29 P nucleus at subbarrier energies
Energy Technology Data Exchange (ETDEWEB)
Matulewicz, T; Dabrowska, M; Decowski, P; Kicinska-Habior, M; Sikora, B [Warsaw Univ. (Poland). Inst. Fizyki Doswiadczalnej; Toke, J [Rochester Univ., NY (USA). Nuclear Structure Research Lab.; Somorjai, E [Magyar Tudomanyos Akademia, Debrecen (Hungary). Atommag Kutato Intezete
1985-08-01
Differential cross sections at 0 deg and 90 deg measured for {sup 28}Si(p,{gamma}{sub 1}){sup 29}P reaction at proton energy range 2.3-2.9 MeV have been analyzed in terms of the direct-semidirect capture model extended by the effective potential approach. Spectroscopic factor of the first excited states of {sup 29}P nucleus was found to be 0.10+-0.05. 9 refs., 1 fig. (author).
Open Automated Demand Response for Small Commerical Buildings
Energy Technology Data Exchange (ETDEWEB)
Dudley, June Han; Piette, Mary Ann; Koch, Ed; Hennage, Dan
2009-05-01
This report characterizes small commercial buildings by market segments, systems and end-uses; develops a framework for identifying demand response (DR) enabling technologies and communication means; and reports on the design and development of a low-cost OpenADR enabling technology that delivers demand reductions as a percentage of the total predicted building peak electric demand. The results show that small offices, restaurants and retail buildings are the major contributors making up over one third of the small commercial peak demand. The majority of the small commercial buildings in California are located in southern inland areas and the central valley. Single-zone packaged units with manual and programmable thermostat controls make up the majority of heating ventilation and air conditioning (HVAC) systems for small commercial buildings with less than 200 kW peak electric demand. Fluorescent tubes with magnetic ballast and manual controls dominate this customer group's lighting systems. There are various ways, each with its pros and cons for a particular application, to communicate with these systems and three methods to enable automated DR in small commercial buildings using the Open Automated Demand Response (or OpenADR) communications infrastructure. Development of DR strategies must consider building characteristics, such as weather sensitivity and load variability, as well as system design (i.e. under-sizing, under-lighting, over-sizing, etc). Finally, field tests show that requesting demand reductions as a percentage of the total building predicted peak electric demand is feasible using the OpenADR infrastructure.
Generation of structural MR images from amyloid PET: Application to MR-less quantification.
Choi, Hongyoon; Lee, Dong Soo
2017-12-07
Structural magnetic resonance (MR) images concomitantly acquired with PET images can provide crucial anatomical information for precise quantitative analysis. However, in the clinical setting, not all the subjects have corresponding MR. Here, we developed a model to generate structural MR images from amyloid PET using deep generative networks. We applied our model to quantification of cortical amyloid load without structural MR. Methods: We used florbetapir PET and structural MR data of Alzheimer's Disease Neuroimaging Initiative database. The generative network was trained to generate realistic structural MR images from florbetapir PET images. After the training, the model was applied to the quantification of cortical amyloid load. PET images were spatially normalized to the template space using the generated MR and then standardized uptake value ratio (SUVR) of the target regions was measured by predefined regions-of-interests. A real MR-based quantification was used as the gold standard to measure the accuracy of our approach. Other MR-less methods, a normal PET template-based, multi-atlas PET template-based and PET segmentation-based normalization/quantification methods, were also tested. We compared performance of quantification methods using generated MR with that of MR-based and MR-less quantification methods. Results: Generated MR images from florbetapir PET showed visually similar signal patterns to the real MR. The structural similarity index between real and generated MR was 0.91 ± 0.04. Mean absolute error of SUVR of cortical composite regions estimated by the generated MR-based method was 0.04±0.03, which was significantly smaller than other MR-less methods (0.29±0.12 for the normal PET-template, 0.12±0.07 for multiatlas PET-template and 0.08±0.06 for PET segmentation-based methods). Bland-Altman plots revealed that the generated MR-based SUVR quantification was the closest to the SUVR values estimated by the real MR-based method. Conclusion
Demand Response in Europe's Electricity Sector: Market barriers and outstanding issues
International Nuclear Information System (INIS)
Eid, Cherrelle
2015-01-01
In October 2014, Europe's drive for sustainability has been further continued with the set objectives for 2030, aiming for 40% emission reduction compared to 1990 levels and at least a 27% share of renewable energy sources. For the longer term, the European Commission (EC) targets a zero CO_2 emitting electricity sector in 2050. Those objectives for the electricity sector have a large impact on the expected development of electricity generation, but also on the evolution of demand. To meet those objectives, a larger share of electricity supply will come from intermittent sources like wind turbines and solar panels. In an electric system that is largely based on renewable electricity sources, it is desired to have higher electricity consumption in moments when more renewable electricity is being produced, and a lower consumption in times of lower renewable production. Demand response is related to the adaptability of the electricity demand to the availability of supply. The development of demand response is rooted in the need for carbon emission reductions and for efficient use of installed generation capacities with the growth of power consumption. In addition to providing flexibility to the electric system, demand response could be a direct source of revenue to households and businesses. In 2013, in the United States, businesses and homeowners earned over $2.2 billion in revenues from demand response together with other avoided investment in grid infrastructure and power plants. This source of direct revenue could also be made available in Europe and would release financial benefits to local economies (SEDC, 2014). The reliability improvements as well as the economic and sustainability potential coming from a more responsive electricity demand are fully acknowledged. However, demand response is still immaturely developed in Europe. If Europe wants to make a step forward to a more sustainable electricity sector, the development of demand response is an inevitable
International Nuclear Information System (INIS)
Soyer, Philippe; Corno, Lucie; Boudiaf, Mourad; Aout, Mounir; Sirol, Marc; Place, Vinciane; Duchat, Florent; Guerrache, Youcef; Fargeaudou, Yann; Vicaut, Eric; Pocard, Marc; Hamzi, Lounis
2011-01-01
Objective: To test interobserver variability of ADC measurements and compare the diagnostic performances of free-breathing diffusion-weighted (FBDW) with that of T2-weighted FSE (T2WFSE) MR imaging for differentiating between cavernous hemangiomas and untreated malignant hepatic neoplasms. Materials and methods: Thirty-five patients with cavernous hemangiomas and 35 with untreated hepatic malignant neoplasms had FBDW and T2WFSE MR imaging. Hepatic lesions were characterized with ADC measurement and visual evaluation. Interobserver agreement for ADC measurement was calculated. Association between ADC value and lesion type was assessed using univariate analysis. Sensitivity, specificity and accuracy of ADC values and visual evaluation of MR images for the diagnosis of untreated malignant hepatic neoplasm were compared. Results: ADC measurements showed excellent interobserver correlation (intraclass correlation coefficient = 0.980). Malignant neoplasms had lower ADC values than hemangiomas for the two observers (1.11 x 10 -3 mm 2 /s ± .21 x 10 -3 vs. 1.77 x 10 -3 mm 2 /s ± .29 x 10 -3 for observer 1 and 1.11 x 10 -3 mm 2 /s ± .19 x 10 -3 vs. 1.79 x 10 -3 mm 2 /s ± .32 x 10 -3 for observer 2) and univariate analysis found significant correlations between lesion type and ADC values. Depending on ADC threshold value, accuracy for the diagnosis of malignant neoplasm varied from 82.9% to 94.3%. Using visual evaluation, FBDW showed better specificity and accuracy than T2WFSE MR images for the diagnosis of malignant neoplasm (97.1% vs. 77.1% and 94.3% vs. 62.9%, respectively). Conclusion: FBDW imaging provides reproducible quantitative information and surpasses the value of T2WFSE MR imaging for differentiating between cavernous hemangiomas and untreated malignant hepatic neoplasms.
Data-driven Demand Response Characterization and Quantification
DEFF Research Database (Denmark)
Le Ray, Guillaume; Pinson, Pierre; Larsen, Emil Mahler
2017-01-01
Analysis of load behavior in demand response (DR) schemes is important to evaluate the performance of participants. Very few real-world experiments have been carried out and quantification and characterization of the response is a difficult task. Nevertheless it will be a necessary tool for portf...
Open Automated Demand Response Communications in Demand Response for Wholesale Ancillary Services
Energy Technology Data Exchange (ETDEWEB)
Kiliccote, Sila; Piette, Mary Ann; Ghatikar, Girish; Koch, Ed; Hennage, Dan; Hernandez, John; Chiu, Albert; Sezgen, Osman; Goodin, John
2009-11-06
The Pacific Gas and Electric Company (PG&E) is conducting a pilot program to investigate the technical feasibility of bidding certain demand response (DR) resources into the California Independent System Operator's (CAISO) day-ahead market for ancillary services nonspinning reserve. Three facilities, a retail store, a local government office building, and a bakery, are recruited into the pilot program. For each facility, hourly demand, and load curtailment potential are forecasted two days ahead and submitted to the CAISO the day before the operation as an available resource. These DR resources are optimized against all other generation resources in the CAISO ancillary service. Each facility is equipped with four-second real time telemetry equipment to ensure resource accountability and visibility to CAISO operators. When CAISO requests DR resources, PG&E's OpenADR (Open Automated DR) communications infrastructure is utilized to deliver DR signals to the facilities energy management and control systems (EMCS). The pre-programmed DR strategies are triggered without a human in the loop. This paper describes the automated system architecture and the flow of information to trigger and monitor the performance of the DR events. We outline the DR strategies at each of the participating facilities. At one site a real time electric measurement feedback loop is implemented to assure the delivery of CAISO dispatched demand reductions. Finally, we present results from each of the facilities and discuss findings.
Mangal, S. K.; Sharma, Vivek
2018-02-01
Magneto rheological fluids belong to a class of smart materials whose rheological characteristics such as yield stress, viscosity etc. changes in the presence of applied magnetic field. In this paper, optimization of MR fluid constituents is obtained with on-state yield stress as response parameter. For this, 18 samples of MR fluids are prepared using L-18 Orthogonal Array. These samples are experimentally tested on a developed & fabricated electromagnet setup. It has been found that the yield stress of MR fluid mainly depends on the volume fraction of the iron particles and type of carrier fluid used in it. The optimal combination of the input parameters for the fluid are found to be as Mineral oil with a volume percentage of 67%, iron powder of 300 mesh size with a volume percentage of 32%, oleic acid with a volume percentage of 0.5% and tetra-methyl-ammonium-hydroxide with a volume percentage of 0.7%. This optimal combination of input parameters has given the on-state yield stress as 48.197 kPa numerically. An experimental confirmation test on the optimized MR fluid sample has been then carried out and the response parameter thus obtained has found matching quite well (less than 1% error) with the numerically obtained values.
MR-guided MR arthrography of the shoulder
International Nuclear Information System (INIS)
Tratting, S.; Breitenseher, M.; Pretterklieber, M.; Kontaxis, G.; Rand, T.; Imhof, H.
1996-01-01
Purpose: To develop an MR-guided technique for joint puncture in MR arthrography of the shoulder and to confirm the intracapsular position of the needle tip by visualization of the flow of contrast media into the joint. Materials and methods: Three unfixed human shoulder joint specimens were examined on a 1.0 T unit. The optimal point of entrance and depth for joint puncture were estimated by means of MR-compatible markers on the skin. Needle orientation and localization of the needle tip (MR-compatible 22-gauge needle) in the shoulder joint were monitored by rapid localizer gradient-echo sequences in two orthogonal planes. To confirm the intracapsular position of the needle tip, diluted gadolinium-DTPA was administered via a long connecting tube and the flow of contrast media into the joint was viewed directly on an LCD screen using real-time MR imaging (local look technique). Results: The MR-compatible markers on the skin allowed determination of the optimal point of entrance and estimation of the depth for joint puncture. Passive visualization of the MR-compatible needle due to spin dephasing and signal loss provided adequate localization of the intra-articular needle tip position in all specimens, although significant artefacts were present on rapid localizer gradient-echo sequences with an increase in width of the apparent needle shaft. Real-time MR imaging of the flow of contrast media was possible using the local look technique and the LCD screen of the MR unit and allowed confirmation of the intracapsular position. Conclusion: MR-guided joint puncture and real-time MR-assisted contrast media application results in improved MR arthrography and may replace conventional fluoroscopic guidance. (orig.) [de
Opportunities for Demand Response in California Agricultural Irrigation: A Scoping Study
Energy Technology Data Exchange (ETDEWEB)
Marks, Gary [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Wilcox, Edmund [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Olsen, Daniel [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Goli, Sasank [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2013-01-02
California agricultural irrigation consumes more than ten billion kilowatt hours of electricity annually and has significant potential for contributing to a reduction of stress on the grid through demand response, permanent load shifting, and energy efficiency measures. To understand this potential, a scoping study was initiated for the purpose of determining the associated opportunities, potential, and adoption challenges in California agricultural irrigation. The primary research for this study was conducted in two ways. First, data was gathered and parsed from published sources that shed light on where the best opportunities for load shifting and demand response lie within the agricultural irrigation sector. Secondly, a small limited survey was conducted as informal face-to-face interviews with several different California growers to get an idea of their ability and willingness to participate in permanent load shifting and/or demand response programs. Analysis of the data obtained from published sources and the survey reveal demand response and permanent load shifting opportunities by growing region, irrigation source, irrigation method, grower size, and utility coverage. The study examines some solutions for demand response and permanent load shifting in agricultural irrigation, which include adequate irrigation system capacity, automatic controls, variable frequency drives, and the contribution from energy efficiency measures. The study further examines the potential and challenges for grower acceptance of demand response and permanent load shifting in California agricultural irrigation. As part of the examination, the study considers to what extent permanent load shifting, which is already somewhat accepted within the agricultural sector, mitigates the need or benefit of demand response for agricultural irrigation. Recommendations for further study include studies on how to gain grower acceptance of demand response as well as other related studies such as
Meisamy, Sina; Hines, Catherine D G; Hamilton, Gavin; Sirlin, Claude B; McKenzie, Charles A; Yu, Huanzhou; Brittain, Jean H; Reeder, Scott B
2011-03-01
To prospectively compare an investigational version of a complex-based chemical shift-based fat fraction magnetic resonance (MR) imaging method with MR spectroscopy for the quantification of hepatic steatosis. This study was approved by the institutional review board and was HIPAA compliant. Written informed consent was obtained before all studies. Fifty-five patients (31 women, 24 men; age range, 24-71 years) were prospectively imaged at 1.5 T with quantitative MR imaging and single-voxel MR spectroscopy, each within a single breath hold. The effects of T2 correction, spectral modeling of fat, and magnitude fitting for eddy current correction on fat quantification with MR imaging were investigated by reconstructing fat fraction images from the same source data with different combinations of error correction. Single-voxel T2-corrected MR spectroscopy was used to measure fat fraction and served as the reference standard. All MR spectroscopy data were postprocessed at a separate institution by an MR physicist who was blinded to MR imaging results. Fat fractions measured with MR imaging and MR spectroscopy were compared statistically to determine the correlation (r(2)), and the slope and intercept as measures of agreement between MR imaging and MR spectroscopy fat fraction measurements, to determine whether MR imaging can help quantify fat, and examine the importance of T2 correction, spectral modeling of fat, and eddy current correction. Two-sided t tests (significance level, P = .05) were used to determine whether estimated slopes and intercepts were significantly different from 1.0 and 0.0, respectively. Sensitivity and specificity for the classification of clinically significant steatosis were evaluated. Overall, there was excellent correlation between MR imaging and MR spectroscopy for all reconstruction combinations. However, agreement was only achieved when T2 correction, spectral modeling of fat, and magnitude fitting for eddy current correction were used (r(2
Feasibility of ultrasound-guided intraarticular contrast injection for MR arthrography
International Nuclear Information System (INIS)
Baek, Soo Jin; Lee, Jong Min; Kang, Duck Sick
2005-01-01
To assess the feasibility of ultrasound-guided intraarticular contrast injection using the posterior approach for MR arthrography. Between June 2002 and October 2004, 132 patients (29 female, 103 male: mean age, 33.6 years) underwent ultrasound-guided intraarticular contrast media injection (40 ml saline + 10 ml 2% lidocaine + 0.2 ml gadopentetate dimeglumine + 0.4 ml epinephrine) for MR arthrography. The patients were classified into four groups, viz. the no leakage group, the minor leakage with successful intraarticular injection group, the major leakage with unsuccessful intraarticular injection group, and the injection failure group. The 'no leakage' and 'minor leakage' groups were considered to be technical successes, while the 'major leakage' and 'injection failure' groups were regarded as technical failures. The technical success rate of ultrasound-guided intraarticular contrast injection using the posterior approach for MR Arthrography was 99.2% (131/132 patients) and one patients 0.7% (1/132 patients) was included in the 'major leakage' group. Ultrasound-guided intraarticular contrast injection using the posterior approach for MR arthrography was feasible with a high success rate
29 CFR 2201.10 - Maintenance of statistics.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Maintenance of statistics. 2201.10 Section 2201.10 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH REVIEW COMMISSION REGULATIONS IMPLEMENTING THE FREEDOM OF INFORMATION ACT § 2201.10 Maintenance of statistics. (a) The FOIA Disclosure...
12 CFR 602.23 - Responses to demands served on FCA employees.
2010-01-01
... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Responses to demands served on FCA employees. 602.23 Section 602.23 Banks and Banking FARM CREDIT ADMINISTRATION ADMINISTRATIVE PROVISIONS RELEASING....23 Responses to demands served on FCA employees. (a) An employee served with a demand or a subpoena...
Integrated Platform for Automated Sustainable Demand Response in Smart Grids
Energy Technology Data Exchange (ETDEWEB)
Zois, Vassilis [Univ. of Southern California, Los Angeles, CA (United States). Dept. of Computer Science; Frincu, Marc [Univ. of Southern California, Los Angeles, CA (United States). Dept. of Electrical Engineering; Prasanna, Viktor K. [Univ. of Southern California, Los Angeles, CA (United States). Dept. of Electrical Engineering
2014-10-08
Demand Response(DR) is a common practice used by utility providers to regulate energy demand. It is used at periods of high demand to minimize the peak to average consumption ratio. Several methods have been Demand Response(DR) is a common praon using information about the baseline consumption and the consumption during DR. Our goal is to provide a sustainable reduction to ensure the elimination of peaks in demand. The proposed system includes an adaptation mechanism for when the provided solution does not meet the DR requirements. We conducted a series of experiments using consumption data from a real life micro grid to evaluate the efficiency as well as the robustness of our solution.
Cardiac Autonomic and Blood Pressure Responses to an Acute Foam Rolling Session.
Lastova, Kevin; Nordvall, Michael; Walters-Edwards, Michelle; Allnutt, Amy; Wong, Alexei
2018-03-22
Foam Rolling (FR) is a self-myofascial release method that has become extremely popular among athletes and fitness enthusiasts for its ability to improve flexibility and range of motion and alleviate delayed onset muscle soreness. However, the cardiac autonomic modulation and blood pressure (BP) responses induced by an acute FR session are currently unknown. The present study evaluated the effects of an acute session of FR exercise on heart rate variability (HRV) and BP responses in healthy individuals. Fifteen (M=8, F=7) healthy subjects completed either a FR or non-exercise control trial in randomized order. HRV and BP measurements were collected at baseline, 10 and 30 min after each trial. There were significant increases (P < 0.01) in markers of vagal tone (nHF) for 30 min after the FR trial, while no changes from baseline were observed following control. There were also significant decreases (P < 0.05) in markers of sympathetic activity (nLF), sympathovagal balance (nLF/nHF), systolic BP and diastolic BP at 10 and 30 min after the trial KB trial while no changes from baseline were observed after the control trial. Our findings indicate that FR decreases sympathovagal balance for 30 min post-intervention which is concurrent with an important hypotensive effect. Further research is warranted to evaluate the potential cardiovascular protective effects of FR in diverse populations.
MR of normal pancreas : comparison of five pulse sequences and enhancing patterns on dynamic imaging
International Nuclear Information System (INIS)
Jang, Hyun Jung; Kim, Tae Kyoung; Hong, Sung Hwan; Han, Joon Koo; Choi, Byung Ihn
1997-01-01
To compare T1-weighted FLASH and turbo spin echo (SE) T2-weighted sequences with conventional T1- and T2-weighted sequences in imaging normal pancreas and to describe the enhancing patterns on dynamic MR imging. Forty-four patients with presumed hepatic hemangiomas were studied at 1.0T or 1.5T by using conventional SE sequences (T1-weighted, T2-weighted, and heavily T2-weighted), turbo-SE T2-weighted sequences, and breath-hold T1-weighted FLASH sequences acquired before, immediately on, and at 1, 2, 3, and 5 or 10 minutes after injection of a bolus of gadopentetate dimeglumine. No patients had either a history or its clinical features of pancreatic disease. Images were quantitatively analyzed for signal-difference-to noise ratios (SD/Ns) between the pancreas and peripancreatic fat. Percentage enhancement of the pancreas was measured on each dynamic MR image. Conspicuity of the pancreatic border was qualitatively evaluated according to a consensus, reached by three radiologists. Turbo-SE T2-weighted images had a significantly higher SD/N ratio (p<0.001) and better conspicuity of the pancreatic border (p<0.001) than SE T2- and heavily T2-weighted images;T1-weighted SE images had a significantly higher SD/N ratio than T1-weighted FLASH images (p<0.001), but there was no significant difference between tham in qualitative analysis (p=0.346). Percentage enhancement immediately on and at 1, 2, 3, 5, and 10 minutes after administration of contrast material was 39.9%, 44.5%, 42.9%, 40.8%, 36.3%, 29.9%, respectively, with peak enhancement at 1 minute. In MR imaging of normal pancreas, turbo-SE T2-weighted imaging is superior to SE T2- and heavily T2- weighted imaging, and SE T1-weighted imaging is superior to T1-weighted FLASH imaging. On serial gadolinium-enhanced FLASH imaging, normal pancreas shows peak enhancement at 1 minute
Su, Zheng; Meng, Tianguang
2016-09-01
The widespread use of information and communication technology (ICT) has reshaped the public sphere in the digital era, making online forums a new channel for political participation. Using big data analytics of full records of citizen-government interactions from 2008 to early 2014 on a nationwide political forum, we find that authoritarian China is considerably responsive to citizens' demands with a rapid growth of response rate; however, government responsiveness is highly selective, conditioning on actors' social identities and the policy domains of their online demands. Results from logistic and duration models suggest that requests which made by local citizens, expressed collectively, focused on the single task issue, and are closely related to economic growth are more likely to be responded to. These strategies adopted by Chinese provincial leaders reveal the scope and selectivity of authoritarian responsiveness. Copyright © 2016 Elsevier Inc. All rights reserved.
29 CFR 525.10 - Prevailing wage rates.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Prevailing wage rates. 525.10 Section 525.10 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS EMPLOYMENT OF WORKERS WITH DISABILITIES UNDER SPECIAL CERTIFICATES § 525.10 Prevailing wage rates. (a) A...
International Nuclear Information System (INIS)
Magnusson, K.F.; Johansson, L.
1977-01-01
The Salmonella typhimurium 395 MS and MR10 bacteria and lipopolysaccharide (LPS) were studied by X-ray photoelectron spectroscopy with the aid of the ESCA technique for the in situ analysis of chemical elements (C, O and N) at the surface. The nitrogen peak was large in both bacteria implying the presence of protein in the very outer part of the bacterial envelope due to the surface-sensitive measurement. The nitrogen peak was larger in the MR10 than in the MS bacteria, presumably reflecting an increased exposure of proteins concomitantly with the reduction of the LPS in MR10. After corrections for background and sensitivity of detection the relative intensities of the peaks agreed appreciably well with the proposed chemical structure of the LPS, indicating that at least semiquantitative relationships between the elements were obtained. (author)
Directory of Open Access Journals (Sweden)
Jimyung Kang
2017-10-01
Full Text Available Demand response is nowadays considered as another type of generator, beyond just a simple peak reduction mechanism. A demand response service provider (DRSP can, through its subcontracts with many energy customers, virtually generate electricity with actual load reduction. However, in this type of virtual generator, the amount of load reduction includes inevitable uncertainty, because it consists of a very large number of independent energy customers. While they may reduce energy today, they might not tomorrow. In this circumstance, a DSRP must choose a proper set of these uncertain customers to achieve the exact preferred amount of load curtailment. In this paper, the customer selection problem for a service provider that consists of uncertain responses of customers is defined and solved. The uncertainty of energy reduction is fully considered in the formulation with data-driven probability distribution modeling and stochastic programming technique. The proposed optimization method that utilizes only the observed load data provides a realistic and applicable solution to a demand response system. The performance of the proposed optimization is verified with real demand response event data in Korea, and the results show increased and stabilized performance from the service provider’s perspective.
Human fascioliasis: MR imaging findings of hepatic lesions
International Nuclear Information System (INIS)
Cevikol, Can; Karaali, Kamil; Senol, Utku; Kabaalioglu, Adnan; Apaydin, Ali; Lueleci, Ersin; Saba, Rabin
2003-01-01
Our objective was to describe MR imaging findings of liver lesions in human fascioliasis. The MR imaging of the liver was performed in 29 patients with fascioliasis. Seventeen patients were women and 12 were men, with a mean age of 47.5 years (age range 17-75 years). Hepatic lesions were grouped into five types based on their signal characteristics. Three patients had normal imaging findings. One or more lesions were observed in the other 26 patients. The lesion types and the frequency of appearances were as follows: hyperintensity of the liver capsule on T2-weighted images (n=16, 55.2%); ill-defined slightly hyperintense areas on T2-weighted images (n=18, 62.1%); lesions which were hypointense on T1-weighted and hyperintense on T2-weighted images (n=10, 34.5%); hypointense on T1-weighted images and centrally hypo- or hyperintense, surrounded by peripherally less hyperintense area on T2-weighted images (n=4, 13.8%); and hypointense foci or ill-defined hypointense areas on T1- and T2-weighted images (n=10, 34.5%). We describe the MR imaging features of the disease. Our findings may help the differential diagnosis in which fascioliasis should be added to the list. (orig.)
International Nuclear Information System (INIS)
Erbay, Sami H.; Bhadelia, Rafeeque A.; Gupta, Punita; O'Callaghan, Mark; Yun, Eric; Oljeski, Steven; Riesenburger, Ron
2006-01-01
Treatment with gamma knife radiosurgery (GKRS) provides adequate short-term pain control in about 70% of the patients with intractable trigeminal neuralgia (TN). The purpose of our study was to evaluate whether the presence of neurovascular contact (NVC) at the root entry zone of the trigeminal nerve on pre-gamma knife MR imaging predicts an increased likelihood of an adequate response to GKRS.We studied 40 consecutive patients who underwent GKRS for treatment of intractable TN. Two neuroradiologists blinded to the side of symptoms analyzed pre-treatment constructive interference in steady state (CISS) images to determine the presence of NVC by consensus. An adequate response was defined as freedom from pain with or without reduced need for medical therapy. Adequate short-term response to GKRS was seen in 29 (72.5%) of 40 patients. NVC was seen in 30 of the 40 patients. Twenty-five (83.3%) of 30 patients with NVC had adequate short-term response to GKRS. Only four (40%) of the 10 patients without NVC had adequate response to GKRS (X 2 =7.06; P<0.01). Patients with NVC were seven times more likely to have an adequate response to GKRS than those without NVC (odds ratio =7.5).The presence of NVC on pre-treatment MR imaging predicts an increased likelihood of an adequate response to GKRS. (orig.)
MR findings of transient synovitis of the hip
International Nuclear Information System (INIS)
Lee, Jong Sea; Na, Jae Boem; Yoo, Jin Jong; Ahn, In Oak; Chung, Sung Hoon
2000-01-01
To evaluate the MR findings of transient synovitis of the hip in children. Between 1993 and 1997, MR imaging was performed in 30 children (male:female 22:8) in whom transient synovitis had been clinically diagnosed. In 20 of these 30 patients, Gd-enhanced study was also performed. The signal intensity of bone marrow of the femur, the synovial enhancement pattern and the amount of hip joint effusion in affected hips were evaluated; the last -mentioned was determined using the volume measurement method. In 29 patients (97%), no abnormal signal intensity was seen in bone marrow of the femur in affected hips. Gd-enhanced MR imaging revealed synovial enhancement of affected hip joints, as follows: minimal enhancement in eight patients (40%), moderate enhancement in eight (40%), and strong enhancement in four (20%). No abnormal enhancement was demonstrated in bone marrow of the femur or adjacent soft tissue. The mean amount of joint effusion of affected hips was 2.7±1.7 (range, 0.2-18.9)ml; statistically, this was much greater than that of contralateral hip (p less than 0.01). The MR findings of transient synovitis of the hip in children were normal bone marrow signal intensity of the femoral head, moderate or strong synovial enhancement, and asymmetric hip joint effusion. (author)
Smart electric storage heating and potential for residential demand response
Darby, S
2017-01-01
Low-carbon transition plans for temperate and sub-polar regions typically involve some electrification of space heating. This poses challenges to electricity system operation and market design, as it increases overall demand and alters the temporal patterns of that demand. One response to the challenge is to ‘smarten’ electrical heating, enabling it to respond to network conditions by storing energy at times of plentiful supply, releasing it in response to customer demands and offering rapid-...
Vermeulen, Tyler Dennis; Boulet, Lindsey M; Stembridge, Mike; Williams, Alexandra Mackenzie; Anholm, James D; Subedi, Prajan; Gasho, Chris; Ainslie, Philip N; Feigl, Eric O; Foster, Glen Edward
2018-03-30
It remains unclear if the human coronary vasculature is inherently sensitive to changes in arterial PO 2 and PCO 2 or if coronary vascular responses are the result of concomitant increases in myocardial O 2 consumption/demand (MVO 2 ). We hypothesized that the coronary vascular response to PO 2 and PCO 2 would be attenuated in healthy men when MVO 2 was attenuated with β 1 -adrenergic receptor blockade. Healthy men (n=11; age: 25 {plus minus} 1 years) received intravenous esmolol (β 1 -adrenergic receptor antagonist) or volume-matched saline in a double-blind, randomized, crossover study, and were exposed to poikilocapnic hypoxia, isocapnic hypoxia, and hypercapnic hypoxia. Measurements made at baseline and following 5-min of steady state at each gas manipulation included left anterior descending coronary blood velocity (LAD V ; Doppler echocardiography), heart rate and arterial blood pressure. LAD V values at the end of each hypoxic condition were compared between esmolol and placebo. Rate pressure product (RPP) and left-ventricular mechanical energy (ME LV ) were calculated as indices of MVO 2 . All gas manipulations augmented RPP, ME LV , and LAD V but only RPP and ME LV were attenuated (4-18%) following β 1 -adrenergic receptor blockade (P<0.05). Despite attenuated RPP and MELV responses, β 1 -adrenergic receptor blockade did not attenuate the mean LADV vasodilatory response when compared to placebo during poikilocapnic hypoxia (29.4{plus minus}2.2 vs. 27.3{plus minus}1.6 cm/s) and isocapnic hypoxia (29.5{plus minus}1.5 vs. 30.3{plus minus}2.2 cm/s). Hypercapnic hypoxia elicited a feed-forward coronary dilation that was blocked by β 1 -adrenergic receptor blockade. These results indicate a direct influence of arterial PO 2 on coronary vascular regulation that is independent of MVO 2 .
29 CFR 1903.10 - Consultation with employees.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Consultation with employees. 1903.10 Section 1903.10 Labor... INSPECTIONS, CITATIONS AND PROPOSED PENALTIES § 1903.10 Consultation with employees. Compliance Safety and... extent they deem necessary for the conduct of an effective and thorough inspection. During the course of...
MR imaging of the neonatal brain: Pathologic features
International Nuclear Information System (INIS)
McArdle, C.B.; Richardson, C.J.; Nicholas, D.A.; Hayden, C.K.; Amparo, E.G.
1986-01-01
Seventy-three neonates, aged 29-43 weeks since conception, were studied. US and/or CT correlations were obtained in most infants with pathology. In the first 4-5 days after hemorrhage, US and CT were superior to MR imaging, but after that time MR imaging was the single best modality for imaging blood. In early premature infants with very watery white matter, US detected infarction and brain edema that were poorly seen on both MR imaging and CT. However, in late premature and full-term infants, MR imaging was better than CT in distinguishing between normal white matter and infarction. Only MR imaging disclosed delayed myelination in 13 term infants with hydrocephalus and severe asphyxia. MR imaging with play an important role in imaging neonates once MR imaging-compatible monitors and neonatal head coils become widely available
Gadolinium-enhanced MR imaging in evaluation of Bell palsy
International Nuclear Information System (INIS)
Wang, A.M.; Wesolowski, D.P.; Bojrab, D.I.; Ernstoff, R.M.; Farah, J.
1989-01-01
Eight patients with Bell palsy were evaluated with Gd-DTPA (Magnevist)-enhanced MR imaging in a 1.0-T Siemen's Magnetom unit. Axial pre-and postcontrast and coronal postcontrast T1-weighted MR images of facial nerves were studied. Significant unilateral enhancement of the facial nerve within the internal auditory canal, with or without involvement of the geniculate ganglia, was found in six patients. Three of these patients without satisfactory response to medical treatment underwent surgical decompression, with excellent recovery of facial nerve function. The authors believe that gadolinium-enhanced MR imaging is valuable in the evaluation and management of Bell palsy
Energy Technology Data Exchange (ETDEWEB)
Leeuwenburgh, Marjolein M.N., E-mail: m.m.leeuwenburgh@amc.uva.nl [Department of Surgery, Academic Medical Center, University of Amsterdam (Netherlands); Department of Radiology, Academic Medical Center, University of Amsterdam (Netherlands); Wiarda, Bart M. [Department of Radiology, Alkmaar Medical Center, Alkmaar (Netherlands); Jensch, Sebastiaan [Department of Radiology, Sint Lucas Andreas Hospital, Amsterdam (Netherlands); Wouter van Es, H. [Department of Radiology, Sint Antonius Hospital, Nieuwegein (Netherlands); Stockmann, Hein B.A.C. [Department of Surgery, Kennemer Gasthuis, Haarlem (Netherlands); Gratama, Jan Willem C. [Department of Radiology, Gelre Hospitals, Apeldoorn (Netherlands); Cobben, Lodewijk P.J. [Department of Radiology, Haaglanden Medical Center, Leidschendam (Netherlands); Bossuyt, Patrick M.M. [Department of Clinical Epidemiology, Academic Medical Center, University of Amsterdam (Netherlands); Boermeester, Marja A. [Department of Surgery, Academic Medical Center, University of Amsterdam (Netherlands); Stoker, Jaap [Department of Radiology, Academic Medical Center, University of Amsterdam (Netherlands)
2014-01-15
Objective: To compare accuracy and interobserver agreement between radiologists with limited experience in the evaluation of abdominal MRI (non-experts), and radiologists with longer MR reading experience (experts), in reading MRI in patients with suspected appendicitis. Methods: MR imaging was performed in 223 adult patients with suspected appendicitis and read independently by two members of a team of eight MR-inexperienced radiologists, who were trained with 100 MR examinations previous to this study (non-expert reading). Expert reading was performed by two radiologists with a larger abdominal MR experience (>500 examinations) in consensus. A final diagnosis was assigned after three months based on all available information, except MRI findings. We estimated MRI sensitivity and specificity for appendicitis and for all urgent diagnoses separately. Interobserver agreement was evaluated using kappa statistics. Results: Urgent diagnoses were assigned to 147 of 223 patients; 117 had appendicitis. Sensitivity for appendicitis was 0.89 by MR-non-expert radiologists and 0.97 in MR-expert reading (p = 0.01). Specificity was 0.83 for MR-non-experts versus 0.93 for MR-expert reading (p = 0.002). MR-experts and MR-non-experts agreed on appendicitis in 89% of cases (kappa 0.78). Accuracy in detecting urgent diagnoses was significantly lower in MR-non-experts compared to MR-expert reading: sensitivity 0.84 versus 0.95 (p < 0.001) and specificity 0.71 versus 0.82 (p = 0.03), respectively. Agreement on urgent diagnoses was 83% (kappa 0.63). Conclusion: MR-non-experts have sufficient sensitivity in reading MRI in patients with suspected appendicitis, with good agreement with MR-expert reading, but accuracy of MR-expert reading was higher.
International Nuclear Information System (INIS)
Leeuwenburgh, Marjolein M.N.; Wiarda, Bart M.; Jensch, Sebastiaan; Wouter van Es, H.; Stockmann, Hein B.A.C.; Gratama, Jan Willem C.; Cobben, Lodewijk P.J.; Bossuyt, Patrick M.M.; Boermeester, Marja A.; Stoker, Jaap
2014-01-01
Objective: To compare accuracy and interobserver agreement between radiologists with limited experience in the evaluation of abdominal MRI (non-experts), and radiologists with longer MR reading experience (experts), in reading MRI in patients with suspected appendicitis. Methods: MR imaging was performed in 223 adult patients with suspected appendicitis and read independently by two members of a team of eight MR-inexperienced radiologists, who were trained with 100 MR examinations previous to this study (non-expert reading). Expert reading was performed by two radiologists with a larger abdominal MR experience (>500 examinations) in consensus. A final diagnosis was assigned after three months based on all available information, except MRI findings. We estimated MRI sensitivity and specificity for appendicitis and for all urgent diagnoses separately. Interobserver agreement was evaluated using kappa statistics. Results: Urgent diagnoses were assigned to 147 of 223 patients; 117 had appendicitis. Sensitivity for appendicitis was 0.89 by MR-non-expert radiologists and 0.97 in MR-expert reading (p = 0.01). Specificity was 0.83 for MR-non-experts versus 0.93 for MR-expert reading (p = 0.002). MR-experts and MR-non-experts agreed on appendicitis in 89% of cases (kappa 0.78). Accuracy in detecting urgent diagnoses was significantly lower in MR-non-experts compared to MR-expert reading: sensitivity 0.84 versus 0.95 (p < 0.001) and specificity 0.71 versus 0.82 (p = 0.03), respectively. Agreement on urgent diagnoses was 83% (kappa 0.63). Conclusion: MR-non-experts have sufficient sensitivity in reading MRI in patients with suspected appendicitis, with good agreement with MR-expert reading, but accuracy of MR-expert reading was higher
Energy Technology Data Exchange (ETDEWEB)
Hagelstein, Claudia; Weidner, Meike; Schoenberg, Stefan O.; Buesing, Karen A.; Neff, K.W. [University of Heidelberg, Institute of Clinical Radiology and Nuclear Medicine, University Medical Center Mannheim, Mannheim (Germany); Zahn, Katrin [University of Heidelberg, Department of Pediatric Surgery, University Medical Center Mannheim, Mannheim (Germany); Weiss, Christel [University of Heidelberg, Department of Medical Statistics and Biomathematics, University Medical Center Mannheim, Mannheim (Germany); Schaible, Thomas [University of Heidelberg, Department of Pediatrics, University Medical Center Mannheim, Mannheim (Germany)
2015-01-15
To assess whether the need for postnatal prosthetic patch repair of the diaphragmatic defect in neonates with a congenital diaphragmatic hernia (CDH) is associated with the antenatal measured observed-to-expected magnetic resonance fetal lung volume (o/e MR-FLV). The o/e MR-FLV was calculated in 247 fetuses with isolated CDH. Logistic regression analysis was used to assess the prognostic value of the individual o/e MR-FLV for association with the need for postnatal patch repair. Seventy-seven percent (77 %) of patients with a CDH (190/247) required prosthetic patch repair and the defect was closed primarily in 23 % (57/247). Patients requiring a patch had a significantly lower o/e MR-FLV (27.7 ± 10.2 %) than patients with primary repair (40.8 ± 13.8 %, p < 0.001, AUC = 0.786). With an o/e MR-FLV of 20 %, 92 % of the patients required patch repair, compared to only 24 % with an o/e MR-FLV of 60 %. The need for a prosthetic patch was further influenced by the fetal liver position (herniation/no herniation) as determined by magnetic resonance imaging (MRI; p < 0.001). Fetal liver position, in addition to the o/e MR-FLV, improves prognostic accuracy (AUC = 0.827). Logistic regression analysis based on the o/e MR-FLV is useful for prenatal estimation of the prosthetic patch requirement in patients with a CDH. In addition to the o/e MR-FLV, the position of the liver as determined by fetal MRI helps improve prognostic accuracy. (orig.)
Athletic pubalgia and the "sports hernia": MR imaging findings.
Zoga, Adam C; Kavanagh, Eoin C; Omar, Imran M; Morrison, William B; Koulouris, George; Lopez, Hector; Chaabra, Avneesh; Domesek, John; Meyers, William C
2008-06-01
To retrospectively determine the sensitivity and specificity of magnetic resonance (MR) imaging findings in patients with clinical athletic pubalgia, with either surgical or physical examination findings as the reference standard. Institutional review board approval was granted for this HIPAA-compliant study, and informed consent was waived. MR imaging studies in 141 patients (134 male patients, seven female patients; mean age, 30.1 years; range, 17-71 years) who had been referred to a subspecialist because of groin pain were reviewed for findings including hernia, pubic bone marrow edema, secondary cleft sign, and rectus abdominis and adductor tendon injury. MR imaging findings were compared with surgical findings for 102 patients, physical examination findings for all 141 patients, and MR imaging findings in an asymptomatic control group of 25 men (mean age, 29.8 years; range, 18-39 years). Sensitivity and specificity of MR imaging for rectus abdominis and adductor tendon injury were determined by using a chi(2) analysis, and significance of the findings was analyzed with an unpaired Student t test. Disease patterns seen at MR imaging were compared with those reported in the surgical and sports medicine literature. One hundred thirty-eight (98%) of 141 patients had findings at MR imaging that could cause groin pain. Compared with surgery, MR imaging had a sensitivity and specificity, respectively, of 68% and 100% for rectus abdominis tendon injury and 86% and 89% for adductor tendon injury. Injury in each of these structures was significantly more common in the patient group than in the control group (P pubalgia, including rectus abdominis insertional injury, thigh adductor injury, and articular diseases at the pubic symphysis (osteitis pubis). (c) RSNA, 2008.
Synthesis and characterization of low cost magnetorheological (MR) fluids
Sukhwani, V. K.; Hirani, H.
2007-04-01
Magnetorheological fluids have great potential for engineering applications due to their variable rheological behavior. These fluids find applications in dampers, brakes, shock absorbers, and engine mounts. However their relatively high cost (approximately US600 per liter) limits their wide usage. Most commonly used magnetic material "Carbonyl iron" cost more than 90% of the MR fluid cost. Therefore for commercial viability of these fluids there is need of alternative economical magnetic material. In the present work synthesis of MR fluid has been attempted with objective to produce low cost MR fluid with high sedimentation stability and greater yield stress. In order to reduce the cost, economical electrolytic Iron powder (US 10 per Kg) has been used. Iron powder of relatively larger size (300 Mesh) has been ball milled to reduce their size to few microns (1 to 10 microns). Three different compositions have been prepared and compared for MR effect produced and stability. All have same base fluid (Synthetic oil) and same magnetic phase i.e. Iron particles but they have different additives. First preparation involves organic additives Polydimethylsiloxane (PDMS) and Stearic acid. Other two preparations involve use of two environmental friendly low-priced green additives guar gum (US 2 per Kg) and xanthan gum (US 12 per Kg) respectively. Magnetic properties of Iron particles have been measured by Vibrating Sample Magnetometer (VSM). Morphology of Iron particles and additives guar gum and xanthan gum has been examined by Scanning Electron Microscopy (SEM) and Particles Size Distribution (PSD) has been determined using Particle size analyzer. Microscopic images of particles, MH plots and stability of synthesized MR fluids have been reported. The prepared low cost MR fluids showed promising performance and can be effectively used for engineering applications demanding controllability in operations.
MR Measurement Technique of Rapidly Switched Gradient Magnetic Fields in MR Tomography
Czech Academy of Sciences Publication Activity Database
Bartušek, Karel; Gescheidtová, E.
2005-01-01
Roč. 29, č. 4 (2005), s. 675-686 ISSN 0937-9347 Institutional research plan: CEZ:AV0Z20650511 Keywords : MR tomography * gradiernt magnet ic field * IF method * IFSE method * IFSES method * spin echo Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.743, year: 2005
Smart Demand Response Based on Smart Homes
Directory of Open Access Journals (Sweden)
Jingang Lai
2015-01-01
Full Text Available Smart homes (SHs are crucial parts for demand response management (DRM of smart grid (SG. The aim of SHs based demand response (DR is to provide a flexible two-way energy feedback whilst (or shortly after the consumption occurs. It can potentially persuade end-users to achieve energy saving and cooperate with the electricity producer or supplier to maintain balance between the electricity supply and demand through the method of peak shaving and valley filling. However, existing solutions are challenged by the lack of consideration between the wide application of fiber power cable to the home (FPCTTH and related users’ behaviors. Based on the new network infrastructure, the design and development of smart DR systems based on SHs are related with not only functionalities as security, convenience, and comfort, but also energy savings. A new multirouting protocol based on Kruskal’s algorithm is designed for the reliability and safety of the SHs distribution network. The benefits of FPCTTH-based SHs are summarized at the end of the paper.
Co-Planning of Demand Response and Distributed Generators in an Active Distribution Network
Directory of Open Access Journals (Sweden)
Yi Yu
2018-02-01
Full Text Available The integration of renewables is fast-growing, in light of smart grid technology development. As a result, the uncertain nature of renewables and load demand poses significant technical challenges to distribution network (DN daily operation. To alleviate such issues, price-sensitive demand response and distributed generators can be coordinated to accommodate the renewable energy. However, the investment cost for demand response facilities, i.e., load control switch and advanced metering infrastructure, cannot be ignored, especially when the responsive demand is large. In this paper, an optimal coordinated investment for distributed generator and demand response facilities is proposed, based on a linearized, price-elastic demand response model. To hedge against the uncertainties of renewables and load demand, a two-stage robust investment scheme is proposed, where the investment decisions are optimized in the first stage, and the demand response participation with the coordination of distributed generators is adjusted in the second stage. Simulations on the modified IEEE 33-node and 123-node DN demonstrate the effectiveness of the proposed model.
78 FR 23630 - Notice of Final Federal Agency Actions on State Highway 99 (Segment C) in Texas
2013-04-19
... INFORMATION CONTACT: Mr. Gregory Punske, P.E., District Engineer, District B (South), Federal Highway...)]; Archeological and Historic Preservation Act [16 U.S.C. 469-469(c)]. 6. Social and Economic: Civil Rights Act of... Engineer. [FR Doc. 2013-08853 Filed 4-18-13; 8:45 am] BILLING CODE 4910-RY-P ...
Vasseur, Francis; Sendid, Boualem; Broly, Franck; Gower-Rousseau, Corinne; Sarazin, Aurore; Standaert-Vitse, Annie; Colombel, Jean-Frederic; Poulain, Daniel; Jouault, Thierry
2013-03-18
Crohn's disease (CD) is associated with elevated anti-glycans antibody response in 60% of CD patients, and 25% of healthy first-degree relatives (HFDRs), suggesting a genetic influence for this humoral response. In mice, anti-glucan antibody response depends on the NLRP3 inflammasome. Here, we explored the effect of mutated CARD8, a component of the inflammasome, on anti-glycans antibody response in human. The association between p.C10X mutation (rs2043211) of the CARD8 gene and the levels of anti-glycans antibody response was examined in 39 CD families. The family-based QTDT association test was used to test for the genetic association between CARD8 p.C10X mutation and anti-glycan antibodies in the pedigrees. The difference in antibody responses determined by ELISA was tested in a subgroup of CD probands (one per family) and in a subgroup of HFDRs using the Wilcoxon Kruskal Wallis non-parametric test. The QTDT familial transmission tests showed that the p.C10X mutation of CARD8 was significantly associated with lower levels of antibody to mannans and glucans but not chitin (p=0.024, p=0.0028 and p=0.577, for ASCA, ALCA and ACCA, respectively). These associations were independent of NOD2 and NOD1 genetic backgrounds. The p.C10X mutation significantly associated or displayed a trend toward lower ASCA and ALCA levels (p=0.038 and p=0.08, respectively) only in the subgroup of CD probands. Such associations were not significant for ACCA levels in both subgroups of CD probands and of HFDRs. Our results show that ASCA and ALCA but not ACCA levels are under the influence of CARD8 genotype. Alteration of CARD8, a component of inflammasome, is associated with lower levels of antibodies directed to mannans and glucans at least in CD patients.
Energy Technology Data Exchange (ETDEWEB)
Goshima, Satoshi, E-mail: gossy@par.odn.ne.jp [Department of Radiology, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1193 (Japan); Kanematsu, Masayuki [Department of Radiology, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1193 (Japan); Department of Radiology Services, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1193 (Japan); Watanabe, Haruo; Kondo, Hiroshi; Mizuno, Nozomi; Kawada, Hiroshi [Department of Radiology, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1193 (Japan); Shiratori, Yoshimune [Department of Medical Informatics, Gifu University School of Medicine, Gifu (Japan); Onozuka, Minoru [Department of Physiology and Neuroscience, Kanagawa Dental College, Yokosuka (Japan); Moriyama, Noriyuki [Research Center for Cancer Prevention and Screening, National Cancer Center Hospital, Tsukiji (Japan); Bae, Kyongtae T. [Department of Radiology, University of Pittsburgh Medical Center, Pittsburgh, PA (United States)
2011-08-15
Purpose: To retrospectively assess imaging features that help differentiate early-enhancing non-tumorous (EN) hepatic lesions from hepatocellular carcinomas (HCCs) on gadoxetate disodium-enhanced MR imaging. Materials and methods: Our institutional review board approved this retrospective study. We reviewed the studies of 158 patients (92 men and 65 women; age range: 29-91; mean age: 65.6 years) with chronic liver damage, who underwent gadoxetate disodium-enhanced MR imaging at 3T MR scanner. Hypervascular lesions identified during the hepatic artery phase were selected for a study cohort. The location, shape, size (maximum diameter and maximum area), and contrast enhancement signal intensity characteristics of the lesions were evaluated, then compared between the EN and HCC lesions. Results: A total of 65 EN lesions (range: 3-60 mm, mean: 13.6 {+-} 10.6 mm) from 35 patients and 33 HCCs (range: 9-61 mm, mean: 19.3 {+-} 12.6 mm) from 20 patients were identified. Lesions were more frequently round or oval in shape for HCCs (n = 29; 88%) than ENs (n = 26; 40%) (P < 0.01). Unexpectedly, some ENs (n = 12; 18%) showed hypointensity on hepatocyte-phase, and 6 (50%) of them were T2 hyperintense. For lesions smaller than 2 cm (9 ENs and 21 HCCs) on hepatic arterial-phase images, the mean area of hypointensity in hepatocyte-phase (54.2 {+-} 33.1 mm{sup 2}) was significantly smaller than those of the corresponding hyperintensity in hepatic arterial-phase (97.1 {+-} 42.0 mm{sup 2}) for EN lesions (P = 0.019), whereas no significant difference in area was found for HCCs. Conclusion: EN lesions may occasionally present with hypointensity during the hepatocyte-phase; presenting a diagnostic dilemma. In this situation, EN lesions may be differentiated from HCCs when a hypointense area in hepatocyte-phase is smaller than the corresponding hypervascular area in hepatic-arterial phase.
Energy Technology Data Exchange (ETDEWEB)
Kato, Hiroki, E-mail: hkato@gifu-u.ac.jp [Department of Radiology, Gifu University School of Medicine, 1-1 Yanagido, Gifu 501-1194 (Japan); Kanematsu, Masayuki, E-mail: masa_gif@yahoo.co.jp [Department of Radiology, Gifu University School of Medicine, 1-1 Yanagido, Gifu 501-1194 (Japan); High-level Imaging Diagnosis Center, Gifu University Hospital, Gifu (Japan); Kato, Zenichiro, E-mail: zenkato@mac.com [Department of Pediatrics, Gifu University School of Medicine, Gifu (Japan); Teramoto, Takahide, E-mail: t-tera@gifu-u.ac.jp [Department of Pediatrics, Gifu University School of Medicine, Gifu (Japan); Mizuta, Keisuke, E-mail: kmizuta@gifu-u.ac.jp [Department of Otolaryngology, Gifu University School of Medicine, Gifu (Japan); Aoki, Mitsuhiro, E-mail: aoki@gifu-u.ac.jp [Department of Otolaryngology, Gifu University School of Medicine, Gifu (Japan); Makita, Hiroki, E-mail: makitah@gifu-u.ac.jp [Department of Oral and Maxillofacial Sciences, Gifu University School of Medicine, Gifu (Japan); Kato, Keizo, E-mail: keizo@gifu-u.ac.jp [Department of Oral and Maxillofacial Sciences, Gifu University School of Medicine, Gifu (Japan)
2013-01-15
Purpose: The purpose of this study was to assess the efficacy of diffusion-weighted (DW) MR imaging for the differentiation between suppurative lymphadenitis and malignancy in necrotic cervical lymph nodes. Materials and methods: Fifteen patients with suppurative lymphadenitis, 40 with squamous cell carcinoma (SCC), eight with lymphoma, and six with thyroid cancer were accompanied by necrotic cervical nodes. All 69 patients underwent 1.5-T MR imaging including DW and 58 underwent gadolinium-enhanced MR imaging. Necrotic area-to-spinal cord signal intensity ratios (SIR) on T1-, T2- and DW images and apparent diffusion coefficients (ADCs) [10{sup −3} mm{sup 2}/s] were correlated with the pathologies. Results: Nineteen necrotic cervical nodes with suppurative lymphadenitis, 67 with SCC, 10 with lymphoma, and 12 with thyroid cancer were identified. SIR on DW images was higher in suppurative lymphadenitis (2.50 ± 1.21) than in malignancies (1.29 ± 0.67) (p < .01), and ADC value was lower in suppurative lymphadenitis (0.89 ± 0.21) than in malignancies (1.46 ± 0.46) (p < .01). SIR on T1-weighted images was higher in thyroid cancer (1.95 ± 0.53) than in suppurative lymphadenitis (0.87 ± 0.17), SCC (0.92 ± 0.13), and lymphoma (0.95 ± 0.09) (p < .01). No significant difference in SIR on T2-weighted images was found between suppurative lymphadenitis (1.46 ± 0.50) and malignancies (1.61 ± 0.56). Conclusion: DW imaging with ADC measurements may play a supplementary role in the differentiation of necrotic cervical nodes between suppurative lymphadenitis and malignancy.
Power systems balancing with high penetration renewables: The potential of demand response in Hawaii
International Nuclear Information System (INIS)
Critz, D. Karl; Busche, Sarah; Connors, Stephen
2013-01-01
Highlights: • Demand response for Oahu results in system cost savings. • Demand response improves thermal power plant operations. • Increased use of wind generation possible with demand response. • WILMAR model used to simulate various levels and prices of demand response. - Abstract: The State of Hawaii’s Clean Energy policies call for 40% of the state’s electricity to be supplied by renewable sources by 2030. A recent study focusing on the island of Oahu showed that meeting large amounts of the island’s electricity needs with wind and solar introduced significant operational challenges, especially when renewable generation varies from forecasts. This paper focuses on the potential of demand response in balancing supply and demand on an hourly basis. Using the WILMAR model, various levels and prices of demand response were simulated. Results indicate that demand response has the potential to smooth overall power system operation, with production cost savings arising from both improved thermal power plant operations and increased wind production. Demand response program design and cost structure is then discussed drawing from industry experience in direct load control programs
Energy Technology Data Exchange (ETDEWEB)
Ikeda, Osamu; Morishita, Shoji; Kido, Taeko; Kitajima, Mika; Okamura, Kenji; Fukuda, Seiji [Kumamoto Rosai Hospital, Yatsushiro (Japan); Yamashita, Yasuyuki; Takahashi, Mutsumasa
1998-07-01
To differentiate between malignant and benign breast masses using a compartmental analysis, 55 patients with breast masses (fibroadenoma, n=22; invasive ductal carcinoma, n=29; noninvasive ductal carcinoma, n=8) underwent Gd-DTPA enhanced dynamic MR imaging. Dynamic MR images obtained using two-dimensional fat-saturated fast multiplanar corrupted gradient echo technique over 10 minutes following bolus injection of Gd-DTPA. The triexponential concentration curve of Gd-DTPA was fitted to a theoretical model based on compartmental analysis. Using this method, the transfer constant (or permeability surface product per unit volume of component k) and f{sub 3}/f{sub 1}=f were measured, where f{sub 1} represents tumor vessel volume and f{sub 3} represents extracellular volume. The k value was significantly greater (p<0.01) for malignant tumors, and the k value seen in cases of noninvasive ductal carcinoma was less than that for invasive ductal carcinoma. The f value was significantly smaller (p<0.01) for malignant tumors, whereas the f value for noninvasive ductal carcinoma was not significantly different from that for invasive ductal carcinoma. We believe that this type of compartmental analysis may be of value for the evaluation of breast masses. (author)
International Nuclear Information System (INIS)
Adeyemi, Olutomi I.; Hunt, Lester C.
2014-01-01
This paper explores the way technical progress and improvements in energy efficiency are captured when modelling OECD industrial energy demand. The industrial sectors of the developed world involve a number of different practices and processes utilising a range of different technologies. Consequently, given the derived demand nature of energy, it is vital when modelling industrial energy demand that the impact of technical progress is appropriately captured. However, the energy economics literature does not give a clear guide on how this can be achieved; one strand suggests that technical progress is ‘endogenous’ via asymmetric price responses whereas another strand suggests that it is ‘exogenous’. More recently, it has been suggested that potentially there is a role for both ‘endogenous’ technical progress and ‘exogenous’ technical progress and consequently the general model should be specified accordingly. This paper therefore attempts to model OECD industrial energy demand using annual time series data over the period 1962–2010 for 15 OECD countries. Using the Structural Time Series Model framework, the general specifications allow for both asymmetric price responses (for technical progress to impact endogenously) and an underlying energy demand trend (for technical progress and other factors to impact exogenously, but in a non-linear way). The results show that almost all of the preferred models for OECD industrial energy demand incorporate both a stochastic underlying energy demand trend and asymmetric price responses. This gives estimated long-run income elasticities in the range of 0.34 to 0.96; estimated long-run price-maximum elasticities in the range of − 0.06 to − 1.22; estimated long-run price-recovery elasticities in the range of 0.00 to − 0.27; and estimated long-run price-cut elasticities in the range of 0.00 to − 0.18. Furthermore, the analysis suggests that when modelling industrial energy demand there is a place for
Speeding up PET/MR for cancer staging of children and young adults
Energy Technology Data Exchange (ETDEWEB)
Aghighi, Maryam; Pisani, Laura Jean; Sun, Ziyan; Klenk, Christopher; Madnawat, Himani; Owen, Daniel; Quon, Andrew; Moseley, Michael; Daldrup-Link, Heike E. [Stanford University, Department of Radiology, Molecular Imaging Program at Stanford, Stanford, CA (United States); Fineman, Sandra Luna [Stanford University, Department of Pediatrics, Lucile Packard Children' s Hospital, Stanford, CA (United States); Advani, Ranjana [Stanford University, Department of Medicine, Stanford Hospital, Stanford, CA (United States); Von Eyben, Rie [Stanford University, Department of Radiation and Oncology, Stanford, CA (United States)
2016-12-15
Combining {sup 18}F-FDG PET with whole-body MR for paediatric cancer staging is practically feasible if imaging protocols can be streamlined. We compared {sup 18}F-FDG PET/STIR with accelerated {sup 18}F-FDG PET/FSPGR for whole-body tumour imaging in children and young adults. Thirty-three children and young adults (17.5 ± 5.5 years, range 10-30) with malignant lymphoma or sarcoma underwent a {sup 18}F-FDG PET staging examination, followed by ferumoxytol-enhanced STIR and FSPGR whole-body MR. {sup 18}F-FDG PET scans were fused with MR data and the number and location of tumours on each integrated examination were determined. Histopathology and follow-up imaging served as standard of reference. The agreement of each MR sequence with the reference and whole-body imaging times were compared using Cohen's kappa coefficient and Student's t-test, respectively. Comparing {sup 18}F-FDG PET/FSPGR to {sup 18}F-FDG PET/STIR, sensitivities were 99.3 % for both, specificities were statistically equivalent, 99.8 versus 99.9 %, and the agreement with the reference based on Cohen's kappa coefficient was also statistically equivalent, 0.989 versus 0.992. However, the total scan-time for accelerated FSPGR of 19.8 ± 5.3 minutes was significantly shorter compared to 29.0 ± 7.6 minutes for STIR (p = 0.001). F-FDG PET/FSPGR demonstrated equivalent sensitivities and specificities for cancer staging compared to {sup 18}F-FDG PET/STIR, but could be acquired with shorter acquisition time. (orig.)
International Nuclear Information System (INIS)
Shen Huicong; Dai Jianping; Wei Xinhua; Wang Jianjiao; Li Shaowu; Ma Jun; Ai Lin; Liu Fengsheng; Chai Qi; Zhao Weijiang; Gao Peiyi
2008-01-01
Objective: To evaluate the use of diffusion-weighted imaging (DWI) for early detection of tumor response to Angiostatin-Endostatin (Statin-AE) fusion gene therapy in a rat C6 glioma model. Methods: Fifty male wistar rats with C6 tumor cells implanted into the striatum were examined by a 3.0T MR scanner, then the rats bearing tumors were divided into two groups, treatment group and control group. Rats in the treatment group received 107 plaque forming unit (pfu) recombinant herps simplex viral (R-HSV) mediated Statin-AE fusion gene therapy on day 7, and then the tumors were conformed on MRI. Conventional MR and DWI examination were acquired on 1, 2, 3 weeks after implantation with a 5-inch surface coil. Two (1 w), eight (2 w) and all the residual rats (3 w) of each group were sacrificed to perform the histopathological examination after each MRI examination. Pretreatment and post treatment tumor volumes and apparent diffusion coefficient (ADC) values were calculated. Bank sum test and t test were employed for statistical analysis. Results: On MRI, 43 rats demonstrated tumors on day 7 with a successful rate of 86%. On week 2, the tumor volumes of the controls and treatment group were 90. 6 and 91.64 mm 3 , with no significant difference (Z=-0.14, P>0.05). On week 3, the tumor volumes of the controls and treatment group were 156.64 and 29.64 mm 3 , and a significant difference was observed (Z=-3.45, P -3 and (0.99 ± 0.08) x 10 -3 mm 2 /s, and the values of the tumor peripheral parts of the two groups were (1.00 ± 0.25) x 10 -3 and (0.83 ± 0.12) x 10 -3 mm 2 /s, the ADC values of both tumor centers and peripheral parts of the treatment group were significantly higher than those of the control group (t=-0.82 and -0.46, P -3 and (0.99 ± 0.09) x 10 -3 mm 2 /s, and the values of the tumor peripheral parts of the two groups were (0.81±0.19) x 10 -3 and (0.78±0.11) x 10 -3 mm 2 /s, there were no statistical difference between the two groups (t=0.82, and -0.46, P<0
Gagliardi, J A; Chung, E M; Chandnani, V P; Kesling, K L; Christensen, K P; Null, R N; Radvany, M G; Hansen, M F
1994-09-01
Chondromalacia patellae is a condition characterized by softening, fraying, and ulceration of patellar articular cartilage. We compare the sensitivity, specificity, and accuracy of conventional MR imaging, MR arthrography, and CT arthrography in detecting and staging this abnormality. Twenty-seven patients with pain in the anterior part of the knee were prospectively examined with MR imaging, including T1-weighted (650/16), proton density-weighted (2000/20), T2-weighted (2000/80), and spoiled two-dimensional gradient-recalled acquisition in the steady state (SPGR/)/35 degrees (51/10) with fat saturation pulse sequences. All were also examined with T1-weighted MR imaging after intraarticular injection of dilute gadopentetate dimeglumine and with double-contrast CT arthrography. Each imaging technique was evaluated independently by two observers, who reached a consensus interpretation. The signal characteristics of cartilage on MR images and contour abnormalities noted with all imaging techniques were evaluated and graded according to a modification of the classification of Shahriaree. Twenty-six of the 54 facets examined had chondromalacia shown by arthroscopy, which was used as the standard of reference. The sensitivity, specificity, and accuracy of each imaging technique in the diagnosis of each stage of chondromalacia patellae were determined and compared by using the McNemar two-tailed analysis. Arthroscopy showed that 28 facets were normal. Grade 1 chondromalacia patellae was diagnosed only with MR and CT arthrography in two (29%) of seven facets. Intermediate (grade 2 or 3) chondromalacia patellae was detected in two (13%) of 15 facets with T1-weighted and SPGR MR imaging, in three (20%) of 15 facets with proton density-weighted MR imaging, in seven (47%) of 15 facets with T2-weighted MR imaging, in 11 (73%) of 15 facets with CT arthrography, and in 12 (80%) of 15 facets with MR arthrography. Grade 4 was detected in three (75%) of four facets with T1-, proton
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Sound. 29.2550 Section 29.2550 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...-Cured Tobacco (u.s. Types 22, 23, and Foreign Type 96) § 29.2550 Sound. Free of damage. [37 FR 13626...
10 CFR 609.15 - Default, demand, payment, and collateral liquidation.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Default, demand, payment, and collateral liquidation. 609... PROJECTS THAT EMPLOY INNOVATIVE TECHNOLOGIES § 609.15 Default, demand, payment, and collateral liquidation... Guaranteed Obligation. Such assignment shall include all related liens, security, and collateral rights to...
Hines, Catherine D. G.; Hamilton, Gavin; Sirlin, Claude B.; McKenzie, Charles A.; Yu, Huanzhou; Brittain, Jean H.; Reeder, Scott B.
2011-01-01
Purpose: To prospectively compare an investigational version of a complex-based chemical shift–based fat fraction magnetic resonance (MR) imaging method with MR spectroscopy for the quantification of hepatic steatosis. Materials and Methods: This study was approved by the institutional review board and was HIPAA compliant. Written informed consent was obtained before all studies. Fifty-five patients (31 women, 24 men; age range, 24–71 years) were prospectively imaged at 1.5 T with quantitative MR imaging and single-voxel MR spectroscopy, each within a single breath hold. The effects of T2* correction, spectral modeling of fat, and magnitude fitting for eddy current correction on fat quantification with MR imaging were investigated by reconstructing fat fraction images from the same source data with different combinations of error correction. Single-voxel T2-corrected MR spectroscopy was used to measure fat fraction and served as the reference standard. All MR spectroscopy data were postprocessed at a separate institution by an MR physicist who was blinded to MR imaging results. Fat fractions measured with MR imaging and MR spectroscopy were compared statistically to determine the correlation (r2), and the slope and intercept as measures of agreement between MR imaging and MR spectroscopy fat fraction measurements, to determine whether MR imaging can help quantify fat, and examine the importance of T2* correction, spectral modeling of fat, and eddy current correction. Two-sided t tests (significance level, P = .05) were used to determine whether estimated slopes and intercepts were significantly different from 1.0 and 0.0, respectively. Sensitivity and specificity for the classification of clinically significant steatosis were evaluated. Results: Overall, there was excellent correlation between MR imaging and MR spectroscopy for all reconstruction combinations. However, agreement was only achieved when T2* correction, spectral modeling of fat, and magnitude
Predictive Control of a Domestic Freezer for Real-Time Demand Response Applications
Baghina, N.G.; Lampropoulos, I.; Asare-Bediako, B.; Kling, W.L.; Ribeiro, P.F.
2012-01-01
Demand side management and demand response aim to maximize the efficiency of the electricity delivery process by exploiting the flexibility of customers. At residential level, demand response can be applied only to a limited number of appliances, through load management, due to user intervention or
Demand Response Programs Design and Use Considering Intensive Penetration of Distributed Generation
Directory of Open Access Journals (Sweden)
Pedro Faria
2015-06-01
Full Text Available Further improvements in demand response programs implementation are needed in order to take full advantage of this resource, namely for the participation in energy and reserve market products, requiring adequate aggregation and remuneration of small size resources. The present paper focuses on SPIDER, a demand response simulation that has been improved in order to simulate demand response, including realistic power system simulation. For illustration of the simulator’s capabilities, the present paper is proposes a methodology focusing on the aggregation of consumers and generators, providing adequate tolls for the demand response program’s adoption by evolved players. The methodology proposed in the present paper focuses on a Virtual Power Player that manages and aggregates the available demand response and distributed generation resources in order to satisfy the required electrical energy demand and reserve. The aggregation of resources is addressed by the use of clustering algorithms, and operation costs for the VPP are minimized. The presented case study is based on a set of 32 consumers and 66 distributed generation units, running on 180 distinct operation scenarios.
Study of the D(p,π+)T and 9Be(p,π+)10Be from 400 to 800MeV
International Nuclear Information System (INIS)
Aslanides, E.; Bauer, T.; Bertini, R.; Beurtey, R.; Bimbot, L.; Bing, O.; Boudard, A.; Brochard, F.; Bruge, G.; Catz, H.; Chaumeaux, A.; Couvert, P.; Duchazeaubeneix, J.C.; Duhm, H.; Garreta, D.; Gorodetzky, P.; Habault, J.; Hibou, F.; Igo, G.; Le Bornec, Y.; Lugol, J.C.; Matoba, M.; Tatischeff, B.; Terrien, Y.
Pion production on CD 2 and 9 Be targets has been observed using the high resolution, energy loss, spectrometer SPES I. Differential cross sections for the D(p,π + ) reaction have been determined at 410, 605 and 809MeV and for the 9 Be(p,π + ) reaction at 410 and 605MeV. The 3.37MeV (2 + ) state in 10 Be is populated preferentially, but a significant part of the transition strength seems to populate the ground state and the higher lying multiplets at about 6.1MeV, 7.4MeV and 9.4MeV [fr
Contrast-enhanced MR imaging monitoring of acute tumor response to chemotherapy
International Nuclear Information System (INIS)
Ranney, D.F.; Cohen, J.M.; Antich, P.P.; Endman, W.A.; Kulkarni, P.; Weinreb, J.C.; Giovanella, B.
1987-01-01
Treatment responses of human malignant melanomas were monitored at millimeter resolution in athymic mice by injecting a new polymeric contrast agent, Gd-DTPA-dextran (0.1 mmol Gd/kg, intravenously). Proton MR imaging (0.35 T, spin-echo, repetition time = 0.5 second, echo time = 50 msec) was performed 30 hours after administering diphtheria toxin. Pre-contrast medium images revealed only homogeneous intermediate-intensity tumor masses. Post-contrast medium images of untreated (viable) tumors demonstrated 32% enhancement throughout the entire mass. Post-contrast medium images of toxin-treated tumors revealed marked enhancement (65%) of the histologically viable outer rims, lesser enhancement (38%) of heavily damaged subregions, and no enhancement of dead tumor. These acute, contrast medium-enhanced MR images accurately identified tumor subregions that survived for longer than one week
Demand Response at the Naval Postgraduate School
National Research Council Canada - National Science Library
Stouffer, Dean; Wilson, Daryl
2008-01-01
The purpose of this MBA project is to assist the Naval Postgraduate School's Public Works department to assimilate into a Demand Response program that will not only benefit the school but also the community...
Demand Response in Low Voltage Distribution Networks with High PV Penetration
DEFF Research Database (Denmark)
Nainar, Karthikeyan; Pokhrel, Basanta Raj; Pillai, Jayakrishnan Radhakrishna
2017-01-01
the required flexibility from the electricity market through an aggregator. The optimum demand response enables consumption of maximum renewable energy within the network constraints. Simulation studies are conducted using Matlab and DigSilent Power factory software on a Danish low-voltage distribution system......In this paper, application of demand response to accommodate maximum PV power in a low-voltage distribution network is discussed. A centralized control based on model predictive control method is proposed for the computation of optimal demand response on an hourly basis. The proposed method uses PV...
MR-guided direct arthrography of the glenohumeral joint
International Nuclear Information System (INIS)
Soh, E.; Bearcroft, P.W.P.; Graves, M.J.; Black, R.; Lomas, D.J.
2008-01-01
Aim: To evaluate the feasibility of magnetic resonance (MR)-guided direct arthrography of the glenohumeral joint with a 1.5 T MR system, performing the entire procedure in a single MR examination. Materials and methods: MR-guided direct arthrography was performed on 11 patients. MR imaging guidance and interactive MR fluoroscopy, with in-room control and display system, were used for needle placement and contrast medium injection. The outcome measures were success or failure of joint puncture, the time taken for introduction of contrast medium, and the diagnostic quality of the subsequent MR arthrography images. Results: Contrast medium was successfully instilled into the joint and diagnostic quality MR arthrography images were obtained in all cases. The median time from initial placement of the skin marker to introduction of the contrast medium was 17 min (range 11-29 min). There were no immediate post-procedure complications. Conclusion: Accurate needle placement is feasible in a single MR examination on a commercial 1.5 T closed-bore MR system, using an in-room control and display system together with interactive fluoroscopic imaging, and this was used to provide direct MR arthrography in this study
Characterization of a prototype MR-compatible Delta4 QA-system in a 1.5 tesla MR-linac
de Vries, Wilfred J H; Seravalli, Enrica; Houweling, Anette; Woodings, Simon J; van Rooij, Rob; Wolthaus, Jochem W H; Lagendijk, JJW; Raaymakers, Bas W
2018-01-01
To perform patient plan-quality assurance (QA) on the newly installed MR-Linac (MRL) there was a need for having an MR-compatible QA-device. An MR compatible device (MR-Delta4) was developed together with Scandidos AB (Uppsala, Sweden). The basic characteristics of the detector response
Chondromalacia patellae: diagnosis with MR imaging.
McCauley, T R; Kier, R; Lynch, K J; Jokl, P
1992-01-01
Most previous studies of MR imaging for detection of chondromalacia have used T1-weighted images. We correlated findings on axial MR images of the knee with arthroscopic findings to determine MR findings of chondromalacia patellae on T2-weighted and proton density-weighted images. The study population included 52 patients who had MR examination of the knee with a 1.5-T unit and subsequent arthroscopy, which documented chondromalacia patellae in 29 patients and normal cartilage in 23. The patellar cartilage was assessed retrospectively for MR signal and contour characteristics. MR diagnosis based on the criteria of focal signal or focal contour abnormality on either the T2-weighted or proton density-weighted images yielded the highest correlation with the arthroscopic diagnosis of chondromalacia. When these criteria were used, patients with chondromalacia were detected with 86% sensitivity, 74% specificity, and 81% accuracy. MR diagnosis based on T2-weighted images alone was more sensitive and accurate than was diagnosis based on proton density-weighted images alone. In conclusion, most patients with chondromalacia patellae have focal signal or focal contour defects in the patellar cartilage on T2-weighted MR images. These findings are absent in most patients with arthroscopically normal cartilage.
Home Network Technologies and Automating Demand Response
Energy Technology Data Exchange (ETDEWEB)
McParland, Charles
2009-12-01
Over the past several years, interest in large-scale control of peak energy demand and total consumption has increased. While motivated by a number of factors, this interest has primarily been spurred on the demand side by the increasing cost of energy and, on the supply side by the limited ability of utilities to build sufficient electricity generation capacity to meet unrestrained future demand. To address peak electricity use Demand Response (DR) systems are being proposed to motivate reductions in electricity use through the use of price incentives. DR systems are also be design to shift or curtail energy demand at critical times when the generation, transmission, and distribution systems (i.e. the 'grid') are threatened with instabilities. To be effectively deployed on a large-scale, these proposed DR systems need to be automated. Automation will require robust and efficient data communications infrastructures across geographically dispersed markets. The present availability of widespread Internet connectivity and inexpensive, reliable computing hardware combined with the growing confidence in the capabilities of distributed, application-level communications protocols suggests that now is the time for designing and deploying practical systems. Centralized computer systems that are capable of providing continuous signals to automate customers reduction of power demand, are known as Demand Response Automation Servers (DRAS). The deployment of prototype DRAS systems has already begun - with most initial deployments targeting large commercial and industrial (C & I) customers. An examination of the current overall energy consumption by economic sector shows that the C & I market is responsible for roughly half of all energy consumption in the US. On a per customer basis, large C & I customers clearly have the most to offer - and to gain - by participating in DR programs to reduce peak demand. And, by concentrating on a small number of relatively
International Nuclear Information System (INIS)
Rzanny, R.; Reichenbach, J.R.; Mentzel, H.J.; Pfleiderer, S.O.R.; Kaiser, W.A.; Freesmeyer, D.; Klemm, S.; Gerhard, U.J.; Blanz, B.
2003-01-01
Purpose: To investigate whether 31 P-MR spectroscopy can detect reduced concentrations of high-energy phosphates, like PCr and NTP, caused by decreased metabolic activity in the brain of patients with anorexia nervosa (AN) and, furthermore, whether any impairment of the cerebral membrane metabolism can be derived from the spectra. Material and Methods: 10 female patients, age range 12 - 20 years and mean BMI (body mass index) of 14.8 ± 1.6 kg/m 2 , with clinically diagnosed AN (ICD-10, F50.0) and 10 healthy control subjects, age range 12 - 21 years and mean BMI 19.0 ± 2.1 kg/m 2 , without nutritional disturbances: were investigated. 31 P-MR spectroscopy was performed with a 1.5 T MRI unit using single volume selection in the frontal/prefrontal region of brain. Relative metabolic concentrations were quantified by normalizing the peak areas of the metabolites with the total area of the complete phosphorous spectrum, P tot , as well as with the peak area of β;-NTP. Results: Significant differences between the two groups were observed for the metabolic ratios PDE/P tot , PDE/β;-NTP and α-NTP/P tot which were lower in the patient group except for α-NTP/P tot . These ratios also revealed a statistically significant correlation with the BMI (r PDE/Ptot = 0.747, r PDE/β;-NTP = 0.57, r α-NTP/Ptot = -0.56; p ≤ 0.1). Reduced relative concentrations of PCr/P tot , β;-NTP/P tot or Pi/P tot were not encountered. Conclusion: The lowered PDE/P tot ratio for patients with AN and its correlation with BMI suggests that decreased BMI induces compositional changes of the phospholipids in the brain, which decrease the fraction of mobile phospholipids. (orig.) [de
Epstein-Barr virus encephalitis and encephalomyelitis: MR findings
International Nuclear Information System (INIS)
Shian, W.J.; Chi, C.S.
1996-01-01
The purpose of this project is to investigate the clinical and brain MR characteristics of Epstein-Barr virus (EBV) encephalitis and encephalomyelitis. Clinical and 30 MR findings of 29 patients with EBV encephalitis or encephalomyelitis were retrospectively reviewed. Patients included 24 with encephalitis, 3 with encephalomyelitis, and 2 with brain-stem encephalitis. Altered consciousness, seizures, visual hallucination, and acute psychotic reaction were the common presentations. Eight patients had positive MR findings. These included T2 prolongation over gray and white matter, periventricular leukomalacia, and brain atrophy. Transient T2 prolongation over gray and white matter was found in one patient. Our results indicate that EBV encephalitis and encephalomyelitis have a wide range of both clinical and MR findings. The MR lesions may disappear in a short period, so the timing for the MR scan may be critical. (orig.). With 5 figs., 2 tabs
Epstein-Barr virus encephalitis and encephalomyelitis: MR findings
Energy Technology Data Exchange (ETDEWEB)
Shian, W.J. [Department of Pediatrics, Tao-Yuan Veterans Hospital, No. 100, Sec 3, Cheng-Kung Rd, City of Tao-Yuan, Taiwan (Taiwan, Province of China); Chi, C.S. [Department of Pediatrics, Taichung Veterans General Hospital, Taichung, Taiwan (Taiwan, Province of China)
1996-09-01
The purpose of this project is to investigate the clinical and brain MR characteristics of Epstein-Barr virus (EBV) encephalitis and encephalomyelitis. Clinical and 30 MR findings of 29 patients with EBV encephalitis or encephalomyelitis were retrospectively reviewed. Patients included 24 with encephalitis, 3 with encephalomyelitis, and 2 with brain-stem encephalitis. Altered consciousness, seizures, visual hallucination, and acute psychotic reaction were the common presentations. Eight patients had positive MR findings. These included T2 prolongation over gray and white matter, periventricular leukomalacia, and brain atrophy. Transient T2 prolongation over gray and white matter was found in one patient. Our results indicate that EBV encephalitis and encephalomyelitis have a wide range of both clinical and MR findings. The MR lesions may disappear in a short period, so the timing for the MR scan may be critical. (orig.). With 5 figs., 2 tabs.
Clinical estimation of myocardial infarct volume with MR imaging
International Nuclear Information System (INIS)
Johns, J.A.; Leavitt, M.B.; Field, B.D.; Yasuda, T.; Gold, H.; Leinbach, R.C.; Brady, T.J.; Dinsmore, R.E.
1987-01-01
MR imaging has not previously been used to assess infarct size in humans. Short-axis spin-echo cardiac MR imaging was performed in 20 patients who had undergone intravenous thrombolytic therapy and angiography, 10 days after myocardial infarct. A semi-automated computer program was used to outline the infarct region on each section. The outlines were algorithmically stacked and a three-dimensional representation of the infarct was created. The MR imaging infarct volume was then computed using the Simpson rule. Comparison with ventriculographic infarct size as determined by the computed severely hypokinetic segment length showed excellent correlation (r = .84, P < .001)
International Nuclear Information System (INIS)
Le Blanche, Alain-Ferdinand; Rossert, Jerome; Wassef, Michel; Levy, Bernard; Bigot, Jean-Michel; Boudghene, Frank
2000-01-01
Purpose: To assess in vivo 1) MR-guided percutaneous transluminal renal angioplasty (PTRA) in experimental bilateral rabbit renal artery stenosis (RAS); 2) postprocedural follow-up by gadolinium-enhanced MR angiography versus histomorphometry.Methods: Fifteen male NZW rabbits of mean weight 4.0 kg (range 3.5-4.2 kg) underwent bilateral RAS induction by combined overdilation-deendothelialization with a gadolinium-filled balloon, passively MR-guided by the artifact of a 0.014-inch guidewire. After 4 weeks the rabbits were randomized into two groups: group A (n = 8) underwent right-sided PTRA for treatment of RAS, group B (n = 7) underwent left-sided PTRA. After another 4 weeks the rabbits were killed to assess by histomorphometry recurrent stenosis and contralateral induction injury stenosis lesions. Each step was preceded by gadolinium-enhanced three-dimensional MR angiography, and the cortex-to-aorta (C/A) signal intensity ratio was calculated.Results: RAS induction was successful in all cases. Fourteen arteries developed restenosis and 13 only initial stenosis. MR-guided PTRAs were feasible in 22 arteries (73%). For a successful catheterization of the ostium (20 arteries, 66% success rate), 10-25 steps were required. Five to eight steps were required for balloon localization and inflation for each PTRA. The restenosis effect was reflected by a 16% (12%-27%) decrease in C/A values on MR angiograms (p < 0.05).Conclusion: MR guidance and MR angiography represent a feasible, less invasive alternative for performing and assessing experimental PTRA in RAS
29 CFR 417.10 - Rights of participants.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Rights of participants. 417.10 Section 417.10 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR-MANAGEMENT.... Every interested person shall have the right to present oral or documentary evidence, to submit evidence...
Demand Response Programs Design and Use Considering Intensive Penetration of Distributed Generation
Faria, Pedro; Vale, Zita; Baptista, José
2015-01-01
Further improvements in demand response programs implementation are needed in order to take full advantage of this resource, namely for the participation in energy and reserve market products, requiring adequate aggregation and remuneration of small size resources. The present paper focuses on SPIDER, a demand response simulation that has been improved in order to simulate demand response, including realistic power system simulation. For illustration of the simulator’s capabilities, the prese...
The power to choose. Demand response in liberalized electricity markets
International Nuclear Information System (INIS)
2003-01-01
Highly volatile electricity prices are becoming a more frequent and unwanted characteristic of modern electricity wholesale markets. But low demand elasticity, mainly the result of a lack of incentives and consumers' inability to control demand, means that consumer behaviour is not reflected in the cost of energy. This study analyses the impact of price-responsive demand and shows how pricing, policy and technology can be used to inform consumer behaviour and choice. Informed choice and market-based valuation of electricity supply will ensure liberalized markets are competitive, efficient, less volatile and able to provide long term security of supply. Significant benefits will occur even if only 5% of customers become responsive to price-incentives and information. And customers will respond to well designed programs, thereby developing a role in ensuring efficient price formulation for electricity. This study analyses the economic, efficiency and security benefits and identifies the changes in electricity tariffs and the network infrastructure needed to achieve greater demand response
The Role of Demand Response in Default Service Pricing
International Nuclear Information System (INIS)
Barbose, Galen; Goldman, Charles; Neenan, Bernie
2006-01-01
In designing default service for competitive retail markets, demand response has been an afterthought at best. But that may be changing, as states that initiated customer choice in the past five to seven years reach an important juncture in retail market design and consider an RTP-type default service for large commercial and industrial customers. The authors describe the experience to date with RTP as a default service, focusing on its role as an instrument for cultivating price-responsive demand. (author)
Electric Water Heater Modeling and Control Strategies for Demand Response
Energy Technology Data Exchange (ETDEWEB)
Diao, Ruisheng; Lu, Shuai; Elizondo, Marcelo A.; Mayhorn, Ebony T.; Zhang, Yu; Samaan, Nader A.
2012-07-22
Abstract— Demand response (DR) has a great potential to provide balancing services at normal operating conditions and emergency support when a power system is subject to disturbances. Effective control strategies can significantly relieve the balancing burden of conventional generators and reduce investment on generation and transmission expansion. This paper is aimed at modeling electric water heaters (EWH) in households and tests their response to control strategies to implement DR. The open-loop response of EWH to a centralized signal is studied by adjusting temperature settings to provide regulation services; and two types of decentralized controllers are tested to provide frequency support following generator trips. EWH models are included in a simulation platform in DIgSILENT to perform electromechanical simulation, which contains 147 households in a distribution feeder. Simulation results show the dependence of EWH response on water heater usage . These results provide insight suggestions on the need of control strategies to achieve better performance for demand response implementation. Index Terms— Centralized control, decentralized control, demand response, electrical water heater, smart grid
Meniscal tear. Diagnostic errors in MR imaging
International Nuclear Information System (INIS)
Barrera, M. C.; Recondo, J. A.; Gervas, C.; Fernandez, E.; Villanua, J. A.M.; Salvador, E.
2003-01-01
To analyze diagnostic discrepancies found between magnetic resonance (MR) and arthroscopy, and the determine the reasons that they occur. Two-hundred and forty-eight MR knee explorations were retrospectively checked. Forty of these showed diagnostic discrepancies between MR and arthroscopy. Two radiologists independently re-analyzed the images from 29 of the 40 studies without knowing which diagnosis had resulted from which of the two techniques. Their interpretations were correlated with the initial MR diagnosis, MR images and arthroscopic results. Initial errors in MR imaging were classified as either unavoidable, interpretive, or secondary to equivocal findings. Eleven MR examinations could not be checked since their corresponding imaging results could not be located. Of 34 errors found in the original diagnoses, 12 (35.5%)were classified as unavoidable, 14 (41.2%) as interpretative and 8 (23.5%) as secondary to equivocal findings. 41.2% of the errors were avoided in the retrospective study probably due to our department having greater experience in interpreting MR images, 25.5% were unavailable even in the retrospective study. A small percentage of diagnostic errors were due to the presence of subtle equivocal findings. (Author) 15 refs
MR Neurography of Greater Occipital Nerve Neuropathy: Initial Experience in Patients with Migraine.
Hwang, L; Dessouky, R; Xi, Y; Amirlak, B; Chhabra, A
2017-11-01
MR imaging of peripheral nerves (MR neurography) allows improved assessment of nerve anatomy and pathology. The objective of this study was to evaluate patients with unilateral occipital neuralgia using MR neurography and to assess the differences in greater occipital nerve signal and size between the symptomatic and asymptomatic sides. In this case-control evaluation using MR neurography, bilateral greater occipital nerve caliber, signal intensity, signal-to-noise ratios, and contrast-to-noise ratios were determined by 2 observers. Among 18 subjects with unilateral occipital migraines, the average greater occipital nerve diameter for the symptomatic side was significantly greater at 1.77 ± 0.4 mm than for the asymptomatic side at 1.29 ± 0.25 mm ( P = .001). The difference in nerve signal intensity between the symptomatic and asymptomatic sides was statistically significant at 269.06 ± 170.93 and 222.44 ± 170.46, respectively ( P = .043). The signal-to-noise ratios on the symptomatic side were higher at 15.79 ± 4.59 compared with the asymptomatic nerve at 14.02 ± 5.23 ( P = .009). Contrast-to-noise ratios were significantly higher on the symptomatic side than on the asymptomatic side at 2.57 ± 4.89 and -1.26 ± 5.02, respectively ( P = .004). Intraobserver performance was good to excellent (intraclass coefficient correlation, 0.68-0.93), and interobserver performance was fair to excellent (intraclass coefficient correlation, 0.54-0.81). MR neurography can be reliably used for the diagnosis of greater occipital nerve neuropathy in patients with unilateral occipital migraines with a good correlation of imaging findings to the clinical presentation. © 2017 by American Journal of Neuroradiology.
The Role of MR Enterography in Assessing Crohn’s Disease Activity and Treatment Response
Directory of Open Access Journals (Sweden)
Matthew P. Moy
2016-01-01
Full Text Available MR enterography (MRE has become the primary imaging modality in the assessment of Crohn’s disease (CD in both children and adults at many institutions in the United States and worldwide, primarily due to its noninvasiveness, superior soft tissue contrast, and lack of ionizing radiation. MRE technique includes distention of the small bowel with oral contrast media with the acquisition of T2-weighted, balanced steady-state free precession, and multiphase T1-weighted fat suppressed gadolinium contrast-enhanced sequences. With the introduction of molecule-targeted biologic agents into the clinical setting for CD and their potential to reverse the inflammatory process, MRE is increasingly utilized to evaluate disease activity and response to therapy as an imaging complement to clinical indices or optical endoscopy. New and emerging MRE techniques, such as diffusion-weighted imaging (DWI, magnetization transfer, ultrasmall superparamagnetic iron oxide- (USPIO- enhanced MRI, and PET-MR, offer the potential for an expanded role of MRI in detecting occult disease activity, evaluating early treatment response/resistance, and differentiating inflammatory from fibrotic strictures. Familiarity with MR enterography is essential for radiologists and gastroenterologists as the technique evolves and is further incorporated into the clinical management of CD.
International Nuclear Information System (INIS)
Puig, J.; Martin, J.; Donoso, L.; Falco, J.; Rue, M.
1997-01-01
To assess the agreement between biphasic helical computerized tomography (BHCT) and dynamic gadolinium-enhanced magnetic resonance (MR) in the detection and characterization of focal hepatic lesions in a group of cirrhotic patients. A prospective study was done in 50 cirrhotic patients suspected of having hepatocarcinoma (HC) on the basis of ultrasonographic images evaluated by means of BHCT and dynamic gadolinium-enhanced MR using fast low-angle shot (FLASH) sequences (110-135/4/90 degree centigree). The images were assessed jointly by four radiologists. Between the two techniques, a total of 83 lesions were detected. MR disclosed more lesions (n=79) than BHCT (n=67) (p<0.005). Moreover, 25 of the lesions that were visible by both techniques were more clearly evident in MR images (p<0.01). MR correctly classified 6 of 7 benign lesions (85%) and 49 of 66 malignant ones (74%). BHCT correctly classifed 2 of 7 benign lesions (28%) and 32 of 66 malignant ones (48%). The sensitivities of MR and BHCT for the characterization of these lesions were 74% and 48%, respectively (p=0.0009), while the respective specificities were 86% and 29% (P<0.001). Dynamic gadolinium-enhanced MR with FLASH sequences is more efficient than BHCT in the detection and characterization of focal lesions in cirrhotic patients. (Author) 37 refs
A Novel Technique to Enhance Demand Responsiveness
DEFF Research Database (Denmark)
Farashbashi-Astaneh, Seyed-Mostafa; Bhattarai, Bishnu Prasad; Bak-Jensen, Birgitte
2015-01-01
In this study, a new pricing approach is proposed to increase demand responsiveness. The proposed approach considers two well-known demand side management techniques, namely peak shaving and valley filling. This is done by incentivising consumers by magnifying price difference between peak and off......-peak hours. The usefulness of the suggested method is then investigated by its combination with an electric vehicle optimal scheduling methodology which captures both economic valuation and grid technical constraints. This case is chosen in this study to address network congestion issues, namely under...
Demand response policies for the implementation of smart grids
Koliou, E.
2016-01-01
With the grasp of a smart grid in sight, discussions have shifted the focus of system security measures away from generation capacity; apart from modifying the supply side, demand may also be exploited to keep the system in balance. Specifically, Demand Response (DR) is the concept of consumer load
International Nuclear Information System (INIS)
Zhou, Nan; Chu, Chen; Dou, Xin; Li, Ming; Liu, Song; Zhu, Lijing; Liu, Baorui; Guo, Tingting; Chen, Weibo; He, Jian; Yan, Jing; Zhou, Zhengyang; Yang, Xiaofeng; Liu, Tian
2016-01-01
Radiation-induced parotid damage is one of the most common complications in patients with nasopharyngeal carcinoma (NPC) undergoing radiotherapy (RT). Intravoxel incoherent motion (IVIM) magnetic resonance (MR) imaging has been reported for evaluating irradiated parotid damage. However, the changes of IVIM perfusion-related parameters in irradiated parotid glands have not been confirmed by conventional perfusion measurements obtained from dynamic contrast-enhanced (DCE) MR imaging. The purposes of this study were to monitor radiation-induced parotid damage using IVIM and DCE MR imaging and to investigate the correlations between changes of these MR parameters. Eighteen NPC patients underwent bilateral parotid T1-weighted, IVIM and DCE MR imaging pre-RT (2 weeks before RT) and post-RT (4 weeks after RT). Parotid volume; IVIM MR parameters, including apparent diffusion coefficient (ADC), pure diffusion coefficient (D), pseudo-diffusion coefficient (D*), and perfusion fraction (f); and DCE MR parameters, including maximum relative enhancement (MRE), time to peak (TTP), Wash in Rate, and the degree of xerostomia were recorded. Correlations of parotid MR parameters with mean radiation dose, atrophy rate and xerostomia degree, as well as the relationships between IVIM and DCE MR parameters, were investigated. From pre-RT to post-RT, all of the IVIM and DCE MR parameters increased significantly (p < 0.001 for ADC, D, f, MRE, Wash in Rate; p = 0.024 for D*; p = 0.037 for TTP). Change rates of ADC, f and MRE were negatively correlated with atrophy rate significantly (all p < 0.05). Significant correlations were observed between the change rates of D* and MRE (r = 0.371, p = 0.026) and between the change rates of D* and TTP (r = 0.396, p = 0.017). The intra- and interobserver reproducibility of IVIM and DCE MR parameters was good to excellent (intraclass correlation coefficient, 0.633–0.983). Early radiation-induced changes of parotid glands could be evaluated by IVIM and
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Quality. 29.2542 Section 29.2542 Agriculture...-Cured Tobacco (u.s. Types 22, 23, and Foreign Type 96) § 29.2542 Quality. A division of a group or the second factor of a grade based on the relative degree of one or more elements of quality. [37 FR 13626...
Hawaiian Electric Company Demand Response Roadmap Project
Energy Technology Data Exchange (ETDEWEB)
Levy, Roger [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Kiliccote, Sila [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2013-01-12
The objective of this project was to develop a “roadmap” to guide the Hawaiian Electric Company (HECO) demand response (DR) planning and implementation in support of the Hawaii Clean Energy Initiative (HCEI) 70% clean energy goal by 2030.
Directory of Open Access Journals (Sweden)
Yang Liu
2017-11-01
Full Text Available A pH-responsive conjugate based 10-hydroxycamptothecin-thiosemicarbazide-polyethene glycol 2000 (10-HCPT-hydro-PEG nano-micelles were prepared in our previous study. In the present study, ultra-performance liquid chromatography (UPLC-MS method is developed to investigate its pharmacokinetics and biodistribution in tumor bearing mice. The results demonstrated that the conjugate circulated for a much longer time in the blood circulation system than commercial 10-HCPT injection, and bioavailability was significantly improved compared with 10-HCPT. In vivo biodistribution study showed that the conjugate could enhance the targeting and residence time in tumor site.
Aggregate modeling of fast-acting demand response and control under real-time pricing
International Nuclear Information System (INIS)
Chassin, David P.; Rondeau, Daniel
2016-01-01
Highlights: • Demand elasticity for fast-acting demand response load under real-time pricing. • Validated first-principles logistic demand curve matches random utility model. • Logistic demand curve suitable for diversified aggregate loads market-based transactive control systems. - Abstract: This paper develops and assesses the performance of a short-term demand response (DR) model for utility load control with applications to resource planning and control design. Long term response models tend to underestimate short-term demand response when induced by prices. This has two important consequences. First, planning studies tend to undervalue DR and often overlook its benefits in utility demand management program development. Second, when DR is not overlooked, the open-loop DR control gain estimate may be too low. This can result in overuse of load resources, control instability and excessive price volatility. Our objective is therefore to develop a more accurate and better performing short-term demand response model. We construct the model from first principles about the nature of thermostatic load control and show that the resulting formulation corresponds exactly to the Random Utility Model employed in economics to study consumer choice. The model is tested against empirical data collected from field demonstration projects and is shown to perform better than alternative models commonly used to forecast demand in normal operating conditions. The results suggest that (1) existing utility tariffs appear to be inadequate to incentivize demand response, particularly in the presence of high renewables, and (2) existing load control systems run the risk of becoming unstable if utilities close the loop on real-time prices.
Modeling, Analysis, and Control of Demand Response Resources
Energy Technology Data Exchange (ETDEWEB)
Mathieu, Johanna L. [Univ. of California, Berkeley, CA (United States)
2012-05-01
While the traditional goal of an electric power system has been to control supply to fulfill demand, the demand-side can plan an active role in power systems via Demand Response (DR), defined by the Department of Energy (DOE) as “a tariff or program established to motivate changes in electric use by end-use customers in response to changes in the price of electricity over time, or to give incentive payments designed to induce lower electricity use at times of high market prices or when grid reliability is jeopardized” [29]. DR can provide a variety of benefits including reducing peak electric loads when the power system is stressed and fast timescale energy balancing. Therefore, DR can improve grid reliability and reduce wholesale energy prices and their volatility. This dissertation focuses on analyzing both recent and emerging DR paradigms. Recent DR programs have focused on peak load reduction in commercial buildings and industrial facilities (C&I facilities). We present methods for using 15-minute-interval electric load data, commonly available from C&I facilities, to help building managers understand building energy consumption and ‘ask the right questions’ to discover opportunities for DR. Additionally, we present a regression-based model of whole building electric load, i.e., a baseline model, which allows us to quantify DR performance. We use this baseline model to understand the performance of 38 C&I facilities participating in an automated dynamic pricing DR program in California. In this program, facilities are expected to exhibit the same response each DR event. We find that baseline model error makes it difficult to precisely quantify changes in electricity consumption and understand if C&I facilities exhibit event-to-event variability in their response to DR signals. Therefore, we present a method to compute baseline model error and a metric to determine how much observed DR variability results from baseline model error rather than real
International Nuclear Information System (INIS)
Izquierdo-Garcia, David; Sawiak, Stephen J.; Knesaurek, Karin; Machac, Joseph; Narula, Jagat; Fuster, Valentin; Fayad, Zahi A.
2014-01-01
The objective of this study was to evaluate the performance of the built-in MR-based attenuation correction (MRAC) included in the combined whole-body Ingenuity TF PET/MR scanner and compare it to the performance of CT-based attenuation correction (CTAC) as the gold standard. Included in the study were 26 patients who underwent clinical whole-body FDG PET/CT imaging and subsequently PET/MR imaging (mean delay 100 min). Patients were separated into two groups: the alpha group (14 patients) without MR coils during PET/MR imaging and the beta group (12 patients) with MR coils present (neurovascular, spine, cardiac and torso coils). All images were coregistered to the same space (PET/MR). The two PET images from PET/MR reconstructed using MRAC and CTAC were compared by voxel-based and region-based methods (with ten regions of interest, ROIs). Lesions were also compared by an experienced clinician. Body mass index and lung density showed significant differences between the alpha and beta groups. Right and left lung densities were also significantly different within each group. The percentage differences in uptake values using MRAC in relation to those using CTAC were greater in the beta group than in the alpha group (alpha group -0.2 ± 33.6 %, R 2 = 0.98, p 2 = 0.97, p < 0.001). In comparison to CTAC, MRAC led to underestimation of the PET values by less than 10 % on average, although some ROIs and lesions did differ by more (including the spine, lung and heart). The beta group (imaged with coils present) showed increased overall PET quantification as well as increased variability compared to the alpha group (imaged without coils). PET data reconstructed with MRAC and CTAC showed some differences, mostly in relation to air pockets, metallic implants and attenuation differences in large bone areas (such as the pelvis and spine) due to the segmentation limitation of the MRAC method. (orig.)
MR findings of cerebral palsy and clinical correlation
Energy Technology Data Exchange (ETDEWEB)
Kim, Sun Ho; Kim, In One; Kim, Woo Sun; Yeon, Kyung Mo [Seoul National Univ. College of Medicine, Seoul (Korea, Republic of)
1997-04-01
To demonstrate MR findings of cerebral palsy (CP), correlation with clinical findings, and differences between the full-term and pre-term group. Brain MRI of 94 patients with cerebral palsy (CP) were reviewed. The frequency of each MR finding, statistical correlation with clinical findings including type, severity and extent of CP, and differences between the full-term and pre-term group were analyzed. Abnormal MR findings were found in 83 patients(88%), and were as follows : diffuse brain atrophy(30%); periventricular leukomalacia(PVL)(28%); infarction(11%), basal ganglia abnormality(11%); delayed myelination(10%); nonspecific tissue loss or encephalomalacia(9%); and cortical dysplasia(7%). Hemiplegia was the most common condition among patients with infarction, and was found in 80% of this group; diplegia was found in 50% of cases with diffuse brain atrophy, while paraplegia was found in 36% of those with normal MR findings (p < .05). Mild symptoms were dominant in patients with normal MR findings(82%) and in those with infarctions(90%)(p < .05). PVL was the dominant finding in the pre-term group (65%) whereas findings in the full-term group varied; in this group, 38% of MR findings suggested prenatal insults. Possible causative factors were found in 66% of the full-term and 80% of the pre-term group. Perinatal factors were dominant in the pre-term group(81%), whereas prenatal and postnatal factors showed relatively higher frequencies in the full-term group(30% and 24%, respectively). Diffuse brain atrophy and PVL were the most common MR findings. The extent of CP the pre-term correlated well with MR findings. PVL and perinatal factors were dominant in the pre-term group, whereas variable MR findings and relatively higher frequencies of pre- and postnatal factors were found in the full-term group.
MR findings of cerebral palsy and clinical correlation
International Nuclear Information System (INIS)
Kim, Sun Ho; Kim, In One; Kim, Woo Sun; Yeon, Kyung Mo
1997-01-01
To demonstrate MR findings of cerebral palsy (CP), correlation with clinical findings, and differences between the full-term and pre-term group. Brain MRI of 94 patients with cerebral palsy (CP) were reviewed. The frequency of each MR finding, statistical correlation with clinical findings including type, severity and extent of CP, and differences between the full-term and pre-term group were analyzed. Abnormal MR findings were found in 83 patients(88%), and were as follows : diffuse brain atrophy(30%); periventricular leukomalacia(PVL)(28%); infarction(11%), basal ganglia abnormality(11%); delayed myelination(10%); nonspecific tissue loss or encephalomalacia(9%); and cortical dysplasia(7%). Hemiplegia was the most common condition among patients with infarction, and was found in 80% of this group; diplegia was found in 50% of cases with diffuse brain atrophy, while paraplegia was found in 36% of those with normal MR findings (p < .05). Mild symptoms were dominant in patients with normal MR findings(82%) and in those with infarctions(90%)(p < .05). PVL was the dominant finding in the pre-term group (65%) whereas findings in the full-term group varied; in this group, 38% of MR findings suggested prenatal insults. Possible causative factors were found in 66% of the full-term and 80% of the pre-term group. Perinatal factors were dominant in the pre-term group(81%), whereas prenatal and postnatal factors showed relatively higher frequencies in the full-term group(30% and 24%, respectively). Diffuse brain atrophy and PVL were the most common MR findings. The extent of CP the pre-term correlated well with MR findings. PVL and perinatal factors were dominant in the pre-term group, whereas variable MR findings and relatively higher frequencies of pre- and postnatal factors were found in the full-term group
29 CFR 99.300 - Auditee responsibilities.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Auditee responsibilities. 99.300 Section 99.300 Labor Office... § 99.300 Auditee responsibilities. The auditee shall: (a) Identify, in its accounts, all Federal awards... the schedule of expenditures of Federal awards in accordance with § 99.310. (e) Ensure that the audits...
Price responsive load programs: U.S. experience in creating markets for peak demand reductions
International Nuclear Information System (INIS)
Goldberg, Miriam L.; Michelman, Thomas; Rosenberg, Mitchell
2003-01-01
Demand response programs use a variety of pricing mechanisms to induce end-use customers to reduce demand at specified periods. U.S. distribution utilities, regional market operators, and their regulators have implemented demand response programs with the objectives of improving electric system reliability, avoiding price spikes, and relieving local transmission congestion. This paper reviews the design and performance of market-linked demand response programs operated in 2001 and 2002, focusing on the relationship between program design and customer participation and the development of accurate and feasible methods to measure demand response at the facility level
Nanotherapeutics shielded with a pH responsive polymeric layer
Czech Academy of Sciences Publication Activity Database
Kostka, Libor; Šubr, Vladimír; Laga, Richard; Chytil, Petr; Ulbrich, Karel; Seymour, L. W.; Etrych, Tomáš
2015-01-01
Roč. 64, Suppl. 1 (2015), S29-S40 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) EE2.3.30.0029; GA MŠk(CZ) ED1.1.00/02.0109; GA ČR(CZ) GAP301/12/1254 Institutional support: RVO:61389013 Keywords : nanotherapeutics * coating * pH responsive Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.643, year: 2015 http://www.biomed.cas.cz/physiolres/pdf/64%20Suppl%201/64_S29.pdf
7 CFR 29.8001 - Designation of tobacco markets.
2010-01-01
..., Ky. Mayfield, Ky. Murray Ky. Madisonville, Ky. Henderson, Ky. June 18, 1936. 1 FR 757. (b) Virginia...) Kentucky ......do Henderson, Ky Oct. 29, 1942 20 FR 8142. Virginia. Gate City, Va. (tt) Florida All Madison... 2169. (h) Kentucky Burley—Type 31 Danville, Ky Dec. 3, 1937 2 FR 3102. (i) Virginia Flue-cured South...
International Nuclear Information System (INIS)
1985-06-01
The French Rules of Mechanical equipments of Fast Neutron nuclear Reactors (RCC-MR) aims at equipments included in a safety classification. The equipments concerned are those of the nuclear boiler and its auxiliaries: tanks, vessels, internal equipments of the reactor, exchangers, pumps, fittings, pipes, and supports. The present edition of the RCC-MR comprises 12 books presented in the present one in the volume A. The chapter RA 3000 defines the documents to be established in application of the RCC-MR rules. The chapter RA 5000 defines the requirements to take into account to establish and carry out quality Assurance programs according to the RCC-MR rules [fr
29 CFR 100.610 - Written demand for payment.
2010-07-01
... Procedures § 100.610 Written demand for payment. (a) The NLRB will promptly make written demand upon the debtor for payment of money or the return of specific property. The written demand for payment will be... late charges will be 60 days from the date that the demand letter is mailed or hand-delivered. (b) The...
Control for large scale demand response of thermostatic loads
DEFF Research Database (Denmark)
Totu, Luminita Cristiana; Leth, John; Wisniewski, Rafal
2013-01-01
appliances with on/off operation. The objective is to reduce the consumption peak of a group of loads composed of both flexible and inflexible units. The power flexible units are the thermostat-based appliances. We discuss a centralized, model predictive approach and a distributed structure with a randomized......Demand response is an important Smart Grid concept that aims at facilitating the integration of volatile energy resources into the electricity grid. This paper considers a residential demand response scenario and specifically looks into the problem of managing a large number thermostatbased...
Authentically radiolabelled Mn(II) complexes as bimodal PET/MR tracers
Energy Technology Data Exchange (ETDEWEB)
Vanasschen, Christian; Brandt, Marie; Ermert, Johannes [Institute of Neuroscience and Medicine, INM-5 - Nuclear Chemistry, Forschungszentrum Jülich (Germany); Neumaier, Bernd [Institute for Radiochemistry and Experimental Molecular Imaging, Medical Clinics, University of Cologne (Germany); Coenen, Heinz H [Institute of Neuroscience and Medicine, INM-5 - Nuclear Chemistry, Forschungszentrum Jülich (Germany)
2015-05-18
The development of small molecule bimodal PET/MR tracers is mainly hampered by the lack of dedicated preparation methods. Authentic radiolabelling of MR contrast agents ensures easy access to such probes: a ligand, chelating a paramagnetic metal ion (e.g. Mn2+) and the corresponding PET isotope (e.g. 52gMn), leads to a “cocktail mixture” where both imaging reporters exhibit the same pharmacokinetics. Paramagnetic [55Mn(CDTA)]2- shows an excellent compromise between thermodynamic stability, kinetic inertness and MR contrast enhancement. Therefore, the aim of this study was to develop new PET/MR tracers by labelling CDTA ligands with paramagnetic manganese and the β+-emitter 52gMn. N.c.a. 52gMn (t1/2: 5.6 d; Eβ+: 575.8 keV (29.6%)) was produced by proton irradiation of a natCr target followed by cation-exchange chromatography. CDTA was radiolabelled with n.c.a. 52gMn2+ in NaOAc buffer (pH 6) at RT. The complex was purified by RP-HPLC and its stability tested in PBS and blood plasma at 37°C. The redox stability was assessed by monitoring the T1 relaxation (20 MHz) in HEPES buffer (pH 7.4). A functionalized CDTA ligand was synthesized in 5 steps. [52gMn(CDTA)]2- was quantitatively formed within 30 min at RT. The complex was stable for at least 6 days in PBS and blood plasma at 37°C and no oxidation occurred within 7 months storage at RT. Labelling CDTA with an isotopic 52g/55Mn2+ mixture led to the corresponding bimodal PET/MR tracer. Furthermore, a functionalized CDTA ligand was synthesized with an overall yield of 18-25%. [52g/55Mn(CDTA)]2-, the first manganese-based bimodal PET/MR tracer prepared, exhibits excellent stability towards decomplexation and oxidation. This makes the functionalized CDTA ligand highly suitable for designing PET/MR tracers with high relaxivity or targeting properties.
Authentically radiolabelled Mn(II) complexes as bimodal PET/MR tracers
International Nuclear Information System (INIS)
Vanasschen, Christian; Brandt, Marie; Ermert, Johannes; Neumaier, Bernd; Coenen, Heinz H
2015-01-01
The development of small molecule bimodal PET/MR tracers is mainly hampered by the lack of dedicated preparation methods. Authentic radiolabelling of MR contrast agents ensures easy access to such probes: a ligand, chelating a paramagnetic metal ion (e.g. Mn2+) and the corresponding PET isotope (e.g. 52gMn), leads to a “cocktail mixture” where both imaging reporters exhibit the same pharmacokinetics. Paramagnetic [55Mn(CDTA)]2- shows an excellent compromise between thermodynamic stability, kinetic inertness and MR contrast enhancement. Therefore, the aim of this study was to develop new PET/MR tracers by labelling CDTA ligands with paramagnetic manganese and the β+-emitter 52gMn. N.c.a. 52gMn (t1/2: 5.6 d; Eβ+: 575.8 keV (29.6%)) was produced by proton irradiation of a natCr target followed by cation-exchange chromatography. CDTA was radiolabelled with n.c.a. 52gMn2+ in NaOAc buffer (pH 6) at RT. The complex was purified by RP-HPLC and its stability tested in PBS and blood plasma at 37°C. The redox stability was assessed by monitoring the T1 relaxation (20 MHz) in HEPES buffer (pH 7.4). A functionalized CDTA ligand was synthesized in 5 steps. [52gMn(CDTA)]2- was quantitatively formed within 30 min at RT. The complex was stable for at least 6 days in PBS and blood plasma at 37°C and no oxidation occurred within 7 months storage at RT. Labelling CDTA with an isotopic 52g/55Mn2+ mixture led to the corresponding bimodal PET/MR tracer. Furthermore, a functionalized CDTA ligand was synthesized with an overall yield of 18-25%. [52g/55Mn(CDTA)]2-, the first manganese-based bimodal PET/MR tracer prepared, exhibits excellent stability towards decomplexation and oxidation. This makes the functionalized CDTA ligand highly suitable for designing PET/MR tracers with high relaxivity or targeting properties.
Fat suppression at 2D MR imaging of the hands: Dixon method versus CHESS technique and STIR sequence
International Nuclear Information System (INIS)
Kirchgesner, Thomas; Perlepe, Vasiliki; Michoux, Nicolas; Larbi, Ahmed; Vande Berg, Bruno
2017-01-01
Highlights: • Dixon yields effective fat suppression at 2D MRI of the hands. • CHESS fat suppression is less effective especially in the coronal plane. • SNR is higher with Dixon than with CHESS at T1-weighted MR imaging. • SNR is higher with CHESS than with Dixon and STIR at T2-weighted MR imaging. - Abstract: Objective: To compare the effectiveness of fat suppression and the signal-to-noise ratio (SNR) of the Dixon method with those of the CHESS (Chemical Shift-Selective) technique and STIR (Short Tau Inversion Recovery) sequence in hands of normal subjects at 2D MR imaging. Material and methods: 14 healthy volunteers (mean age of 29.4 years) consented to have both hands prospectively imaged with SE T1 Dixon, T1 CHESS, T2 Dixon, T2 CHESS and STIR sequences in a 1.5T MR scanner. Three radiologists scored the effectiveness of fat suppression in bone marrow (EFS BM ) and soft tissues (EFS ST ) in 20 joints per subject. One radiologist measured the SNR in 10 bones per subject. Statistical analysis used two-way ANOVA with random effects, paired t-test and observed agreement to assess differences in effectiveness of fat suppression, differences in SNR and inter-observer agreement. Results: EFS BM was statistically significantly higher for T1 Dixon than for T1 CHESS and for T2 Dixon than for T2 CHESS (p < 0.0001). EFS BM was significantly higher for T2 Dixon than for STIR in the coronal plane (p = 0.0020). The SNR was significantly higher for T1 Dixon than for T1 CHESS and for T2 Dixon than for STIR (p < 0.0001). The SNR was significantly lower for T2 Dixon than for T2 CHESS (p < 0.0001). Conclusion: The Dixon method yields more effective fat suppression and higher SNR than the CHESS technique at 2D T1-weighted MR imaging of the hands. At T2-weighted MR imaging, fat suppression is more effective with the Dixon method while SNR is higher with the CHESS technique.
Fat suppression at 2D MR imaging of the hands: Dixon method versus CHESS technique and STIR sequence
Energy Technology Data Exchange (ETDEWEB)
Kirchgesner, Thomas, E-mail: Thomas.Kirchgesner@uclouvain.be; Perlepe, Vasiliki, E-mail: Vasiliki.Perlepe@uclouvain.be; Michoux, Nicolas, E-mail: Nicolas.Michoux@uclouvain.be; Larbi, Ahmed, E-mail: Ahmed.Larbi@chu-nimes.fr; Vande Berg, Bruno, E-mail: Bruno.VandeBerg@uclouvain.be
2017-04-15
Highlights: • Dixon yields effective fat suppression at 2D MRI of the hands. • CHESS fat suppression is less effective especially in the coronal plane. • SNR is higher with Dixon than with CHESS at T1-weighted MR imaging. • SNR is higher with CHESS than with Dixon and STIR at T2-weighted MR imaging. - Abstract: Objective: To compare the effectiveness of fat suppression and the signal-to-noise ratio (SNR) of the Dixon method with those of the CHESS (Chemical Shift-Selective) technique and STIR (Short Tau Inversion Recovery) sequence in hands of normal subjects at 2D MR imaging. Material and methods: 14 healthy volunteers (mean age of 29.4 years) consented to have both hands prospectively imaged with SE T1 Dixon, T1 CHESS, T2 Dixon, T2 CHESS and STIR sequences in a 1.5T MR scanner. Three radiologists scored the effectiveness of fat suppression in bone marrow (EFS{sup BM}) and soft tissues (EFS{sup ST}) in 20 joints per subject. One radiologist measured the SNR in 10 bones per subject. Statistical analysis used two-way ANOVA with random effects, paired t-test and observed agreement to assess differences in effectiveness of fat suppression, differences in SNR and inter-observer agreement. Results: EFS{sup BM} was statistically significantly higher for T1 Dixon than for T1 CHESS and for T2 Dixon than for T2 CHESS (p < 0.0001). EFS{sup BM} was significantly higher for T2 Dixon than for STIR in the coronal plane (p = 0.0020). The SNR was significantly higher for T1 Dixon than for T1 CHESS and for T2 Dixon than for STIR (p < 0.0001). The SNR was significantly lower for T2 Dixon than for T2 CHESS (p < 0.0001). Conclusion: The Dixon method yields more effective fat suppression and higher SNR than the CHESS technique at 2D T1-weighted MR imaging of the hands. At T2-weighted MR imaging, fat suppression is more effective with the Dixon method while SNR is higher with the CHESS technique.
Directory of Open Access Journals (Sweden)
Shengchun Yang
2016-01-01
Full Text Available Demand response (DR programs provide an effective approach for dealing with the challenge of wind power output fluctuations. Given that uncertain DR, such as price elastic load (PEL, plays an important role, the uncertainty of demand response behavior must be studied. In this paper, a multi-objective stochastic optimization problem of PEL is proposed on the basis of the analysis of the relationship between price elasticity and probabilistic characteristic, which is about stochastic demand models for consumer loads. The analysis aims to improve the capability of accommodating wind output uncertainty. In our approach, the relationship between the amount of demand response and interaction efficiency is developed by actively participating in power grid interaction. The probabilistic representation and uncertainty range of the PEL demand response amount are formulated differently compared with those of previous research. Based on the aforementioned findings, a stochastic optimization model with the combined uncertainties from the wind power output and the demand response scenario is proposed. The proposed model analyzes the demand response behavior of PEL by maximizing the electricity consumption satisfaction and interaction benefit satisfaction of PEL. Finally, a case simulation on the provincial power grid with a 151-bus system verifies the effectiveness and feasibility of the proposed mechanism and models.
Verbickas, Vaidas; Kamandulis, Sigitas; Snieckus, Audrius; Venckunas, Tomas; Baranauskiene, Neringa; Brazaitis, Marius; Satkunskiene, Danguole; Unikauskas, Alvydas; Skurvydas, Albertas
2018-01-01
The aim of this study was to follow circulating brain-derived neurotrophic factor (BDNF) and interleukin-6 (IL-6) levels in response to severe muscle-damaging exercise. Young healthy men (N = 10) performed a bout of mechanically demanding stretch-shortening cycle exercise consisting of 200 drop jumps. Voluntary and electrically induced knee extension torque, serum BDNF levels, and IL-6 levels were measured before and for up to 7 days after exercise. Muscle force decreased by up to 40% and did not recover by 24 hours after exercise. Serum BDNF was decreased 1 hour and 24 hours after exercise, whereas IL-6 increased immediately and 1 hour after but recovered to baseline by 24 hours after exercise. IL-6 and 100-Hz stimulation torque were correlated (r = -0.64, P exercise. In response to acute, severe muscle-damaging exercise, serum BDNF levels decrease, whereas IL-6 levels increase and are associated with peripheral fatigue. Muscle Nerve 57: E46-E51, 2018. © 2017 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Block, W.; Traeber, F.; Kuhl, C.K.; Keller, E.; Rink, H.; Schild, H.H.; Karitzky, J.
1998-01-01
Purpose: 31 P-MR spectroscopy of skeletal muscle under ecercise was used to obtain the range of normal variation and comparison was made for different neuromascular diseases. Methods: 41 examinations of 24 volunteers and 41 investigations in 35 patients were performed on 1.5 T MR systems (Gyroscan S15 und S15/ACSII, Philips). Localised 31 P-MR spectra of the calf muscle were obtained in time series with a resolution of 12 s. Results: Two types of muscle energy metabolism were identified from the pattern of spectroscopic time course in volunteers: While the first group was characterised by a remarkable decline to lower pH values during exercise, the second group showed only small pH shifts (minimum pH: 6.48±0.13 vs 6.87±0.07, p -6 ) although comparable workload conditions were maintained. The pH-values correlated well with blood lactate analysis. Patients with metabolic disorders and chronic fatigue syndrome (CFS) showed decreased resting values of PCr/(PCr+P i ) and increased pH levels during exercise. PCr recovery was significantly delayed (0.31 vs 0.65 min -1 , p i ), altered pH time courses, and decreased PCr recovery seem to be helpful indicators for diagnosis of metabolic muscle disorders. (orig./MG) [de
Social implications of residential demand response in cool temperate climates
International Nuclear Information System (INIS)
Darby, Sarah J.; McKenna, Eoghan
2012-01-01
Residential electrical demand response (DR) offers the prospect of reducing the environmental impact of electricity use, and also the supply costs. However, the relatively small loads and numerous actors imply a large effort: response ratio. Residential DR may be an essential part of future smart grids, but how viable is it in the short to medium term? This paper reviews some DR concepts, then evaluates the propositions that households in cool temperate climates will be in a position to contribute to grid flexibility within the next decade, and that that they will allow some automated load control. Examples of demand response from around the world are discussed in order to assess the main considerations for cool climates. Different tariff types and forms of control are assessed in terms of what is being asked of electricity users, with a focus on real-time pricing and direct load control in energy systems with increasingly distributed resources. The literature points to the significance of thermal loads, supply mix, demand-side infrastructure, market regulation, and the framing of risks and opportunities associated with DR. In concentrating on social aspects of residential demand response, the paper complements the body of work on technical and economic potential. - Highlights: ► Demand response implies major change in governance of electricity systems. ► Households in cool temperate climates can be flexible, mainly with thermal loads. ► DR requires simple tariffs, appropriate enabling technology, education, and feedback. ► Need to test consumer acceptance of DR in specific conditions. ► Introduce tariffs with technologies e.g., TOU tariff plus DLC with electric vehicles.
McKenna, E.; Higginson, S.; Grunewald, P.; Darby, S. J.
2017-01-01
Demand response is receiving increasing interest as a new form of flexibility within low-carbon power systems. Energy models are an important tool to assess the potential capability of demand side contributions. This paper critically reviews the assumptions in current models and introduces a new conceptual framework to better facilitate such an assessment. We propose three dimensions along which change could occur, namely technology, activities and service expectations. Using this framework, ...
Demand response in Indian electricity market
International Nuclear Information System (INIS)
Siddiqui, Md Zakaria; Maere d'Aertrycke, Gauthier de; Smeers, Yves
2012-01-01
This paper outlines a methodology for implementing cost of service regulation in retail market for electricity in India when wholesale market is liberalised and operates through an hourly spot market. As in a developing country context political considerations make tariff levels more important than supply security, satisfying the earmarked level of demand takes a back seat. Retail market regulators are often forced by politicians to keep the retail tariff at suboptimal level. This imposes budget constraint on distribution companies to procure electricity that it requires to meet the earmarked level of demand. This is the way demand response is introduced in the system and has its impact on spot market prices. We model such a situation of not being able to serve the earmarked demand as disutility to the regulator which has to be minimised and we compute associated equilibrium. This results in systematic mechanism for cutting loads. We find that even a small cut in ability of the distribution companies to procure electricity from the spot market has profound impact on the prices in the spot market. - Highlights: ► Modelling the impact of retail tariff in different states on spot prices of electricity in India. ► Retail tariffs are usually fixed below appropriate levels by states due to political reasons. ► Due to revenue constraint distribution utility withdraws demand from spot market in peak hours. ► This adversely affects the scarcity rent of generators and subsequently future investment. ► We show possibility of strategic behaviour among state level regulators in setting retail tariff.
Energy Technology Data Exchange (ETDEWEB)
Li, Chun Ai; Kim, Min Ki; Kim, In Hwan; Lee, Ju Hong; Jang, Kyu Yun; Lee, Sang Yong [Chonbuk National University Hospital, Chonbuk National University College of Medicine, Jeonju (Korea, Republic of)
2013-12-15
To document the causes of high signal intensity of the meniscus which is not caused by definite meniscal tears on MR imaging, through correlation with histological examination. For the correlation between the MR image and histology, we obtained prospectively 31 meniscal specimens from 21 patients. Proton density-weighted turbo spin-echo MR images were used. Minimal tear, thinning of the lamellar layer, degeneration of the central layer, and radial tie fibers were detected upon histological examination, and were correlated with the corresponding MR images. Minimal tear of the lamellar layer was seen in 60 zones out of 100 slides. On MR images, 29 (48.3%) of these 60 zones had high signal intensity. Thinning of the lamellar layer was seen in 24 zones, with 7 (29.2%) having high signal intensity. 57 central zones showed degenerative change in the central layer and high signal intensity on all corresponding MR images. Radial tie fibers in the central layer appeared as high signal intensity areas. Minimal tear and thinning of the lamellar layer, degeneration and radial tie fibers of the central layer of the meniscus cause high signal intensity on MR images.
MR imaging appearance of discoid menisci of the knee
International Nuclear Information System (INIS)
Silverman, J.; Mink, J.H.; Deutsch, A.L.
1988-01-01
Although discoid menisci of the knee have been recognized with magnetic resonance (MR) imaging, there are no MR criteria for their diagnosis. In this paper the authors define a discord meniscus as three or more 5-mm-thick interleaved sagittal sections that demonstrate continuity of the meniscus between the anterior and posterior horns. High-resolution coronal images allow more graphic depiction of the abnormally wide meniscus. They present a total of 29 cases imaged with MR. In approximately one-third of their cases, the measurable height difference between the discoid meniscus and the adjacent meniscus was at least 2 mm. Surgical correlation revealed only two discrepancies between MR imaging and arthrography
Demand Response Integration Through Agent-Based Coordination of Consumers in Virtual Power Plants
DEFF Research Database (Denmark)
Clausen, Anders; Umair, Aisha; Ma, Zheng
2016-01-01
of industrial loads. Coordination happens in response to Demand Response events, while considering local objectives in the industrial domain. We illustrate the applicability of our approach on a Virtual Power Plant scenario with three simulated greenhouses. The results suggest that the proposed design is able...... Power Plant design that is able to balance the demand of energy-intensive, industrial loads with the supply situation in the electricity grid. The proposed Virtual Power Plant design uses a novel inter-agent, multi-objective, multi-issue negotiation mechanism, to coordinate the electricity demands...... to coordinate the electricity demands of industrial loads, in compliance with external Demand Response events....
A consolidated solution of a demand dispatch problem for different demand response schemes
Babar, M.; Nguyen, P.H.; Cuk, V.; Kamphuis, I.G.
2014-01-01
Advance infrastructures have changed the passive consumers into active because now they can share information, perform automatic control as well as directly influence the electricity market via demand response (DR) programs. Till today, many DR Programs are proposed in Smart Grid (SG) paradigm and
International Nuclear Information System (INIS)
Wu Huawei; Cheng Jiejun; Xu Jianrong; Lu Qing; Ge Xin; Li Lei
2008-01-01
Objective: To evaluate maximum intensity projection (MIP) images and apparent diffusion coefficient (ADC) values of MR diffusion weighted imaging with background body signal suppression (DWIBS) on pulmonary diseases. Methods: Sixty-one patients with pulmonary diseases underwent DWlBS. The findings in three dimensional(3D) MIP image were observed and the ADC values of diseased region were measured. The diagnostic value of DWIBS on pulmonary diseases was evaluated. Results: Lung cancer and inflammatory disease were all demonstrated as dense intensity area on DWIBS. The mean ADC value of central lung cancer was (1.05±0.23) x 10 -3 mm 2 /s. The mean ADC value of peripheral lung cancer was (1.10 ± 0.17) x 10 -3 mm 2 /s. The mean ADC value of the inflammatory disease was (1.69 ± 0.29) x 10 -3 mm 2 /s. The mean ADC value had significant difference between peripheral lung cancer and the inflammatory disease (P<0.05). The MR sensitivity, specificity and accuracy in diagnosing the pulmonary diseases with DWIBS (86.84%, 82.60%, 85.24%, respectively) was higher than conventional MRI(78.94%, 78.26%, and 78.68%, respectively). Conclusion: DWIBS can demonstrate clearly the lesion's shape with 3D display. The quantitative measurement of ADC values is feasible. DWIBS may be a potential diagnostic method for differentiation on pulmonary diseases. (authors)
Northwest Open Automated Demand Response Technology Demonstration Project
Energy Technology Data Exchange (ETDEWEB)
Kiliccote, Sila; Dudley, Junqiao Han; Piette, Mary Ann
2009-08-01
Lawrence Berkeley National Laboratory (LBNL) and the Demand Response Research Center (DRRC) performed a technology demonstration and evaluation for Bonneville Power Administration (BPA) in Seattle City Light's (SCL) service territory. This report summarizes the process and results of deploying open automated demand response (OpenADR) in Seattle area with winter morning peaking commercial buildings. The field tests were designed to evaluate the feasibility of deploying fully automated demand response (DR) in four to six sites in the winter and the savings from various building systems. The project started in November of 2008 and lasted 6 months. The methodology for the study included site recruitment, control strategy development, automation system deployment and enhancements, and evaluation of sites participation in DR test events. LBNL subcontracted McKinstry and Akuacom for this project. McKinstry assisted with recruitment, site survey collection, strategy development and overall participant and control vendor management. Akuacom established a new server and enhanced its operations to allow for scheduling winter morning day-of and day-ahead events. Each site signed a Memorandum of Agreement with SCL. SCL offered each site $3,000 for agreeing to participate in the study and an additional $1,000 for each event they participated. Each facility and their control vendor worked with LBNL and McKinstry to select and implement control strategies for DR and developed their automation based on the existing Internet connectivity and building control system. Once the DR strategies were programmed, McKinstry commissioned them before actual test events. McKinstry worked with LBNL to identify control points that can be archived at each facility. For each site LBNL collected meter data and trend logs from the energy management and control system. The communication system allowed the sites to receive day-ahead as well as day-of DR test event signals. Measurement of DR was
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Steam-dried. 29.3548 Section 29.3548 Agriculture... Type 95) § 29.3548 Steam-dried. The condition of unfermented tobacco as customarily prepared for storage by means of a redrying machine or other steam-conditioning equipment. [30 FR 9207, July 23, 1965...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Steam-dried. 29.1060 Section 29.1060 Agriculture... Type 92) § 29.1060 Steam-dried. The condition of unfermented tobacco as customarily prepared for storage by means of a redrying machine or other steam-conditioning equipment. [42 FR 21092, Apr. 25, 1977...
Energy Technology Data Exchange (ETDEWEB)
Lekov, Alex; Thompson, Lisa; McKane, Aimee; Rockoff, Alexandra; Piette, Mary Ann
2009-05-11
This report summarizes the Lawrence Berkeley National Laboratory's research to date in characterizing energy efficiency and open automated demand response opportunities for industrial refrigerated warehouses in California. The report describes refrigerated warehouses characteristics, energy use and demand, and control systems. It also discusses energy efficiency and open automated demand response opportunities and provides analysis results from three demand response studies. In addition, several energy efficiency, load management, and demand response case studies are provided for refrigerated warehouses. This study shows that refrigerated warehouses can be excellent candidates for open automated demand response and that facilities which have implemented energy efficiency measures and have centralized control systems are well-suited to shift or shed electrical loads in response to financial incentives, utility bill savings, and/or opportunities to enhance reliability of service. Control technologies installed for energy efficiency and load management purposes can often be adapted for open automated demand response (OpenADR) at little additional cost. These improved controls may prepare facilities to be more receptive to OpenADR due to both increased confidence in the opportunities for controlling energy cost/use and access to the real-time data.
77 FR 65545 - Mr. Jesse S. Capel and Mr. Hilton J. Cochran; EWP LLC; Notice of Transfer of Exemption
2012-10-29
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 4815-009] Mr. Jesse S. Capel and Mr. Hilton J. Cochran; EWP LLC; Notice of Transfer of Exemption 1. By application filed on July 30, 2012 and supplemented on August 14, 2012, Mr. Jesse S. Capel and Mr. Hilton J. Cochran and EWP...
Development and evaluation of fully automated demand response in large facilities
Energy Technology Data Exchange (ETDEWEB)
Piette, Mary Ann; Sezgen, Osman; Watson, David S.; Motegi, Naoya; Shockman, Christine; ten Hope, Laurie
2004-03-30
This report describes the results of a research project to develop and evaluate the performance of new Automated Demand Response (Auto-DR) hardware and software technology in large facilities. Demand Response (DR) is a set of activities to reduce or shift electricity use to improve electric grid reliability, manage electricity costs, and ensure that customers receive signals that encourage load reduction during times when the electric grid is near its capacity. The two main drivers for widespread demand responsiveness are the prevention of future electricity crises and the reduction of electricity prices. Additional goals for price responsiveness include equity through cost of service pricing, and customer control of electricity usage and bills. The technology developed and evaluated in this report could be used to support numerous forms of DR programs and tariffs. For the purpose of this report, we have defined three levels of Demand Response automation. Manual Demand Response involves manually turning off lights or equipment; this can be a labor-intensive approach. Semi-Automated Response involves the use of building energy management control systems for load shedding, where a preprogrammed load shedding strategy is initiated by facilities staff. Fully-Automated Demand Response is initiated at a building or facility through receipt of an external communications signal--facility staff set up a pre-programmed load shedding strategy which is automatically initiated by the system without the need for human intervention. We have defined this approach to be Auto-DR. An important concept in Auto-DR is that a facility manager is able to ''opt out'' or ''override'' an individual DR event if it occurs at a time when the reduction in end-use services is not desirable. This project sought to improve the feasibility and nature of Auto-DR strategies in large facilities. The research focused on technology development, testing
Cardiac responsiveness to attention-demanding tasks in socially maladaptive children
Althaus, M; Aarnoudse, CC; Minderaa, RB; Mulder, Gysbertus; Mulder, Lambertus
Cardiac responsiveness to attention-demanding tasks in socially maladaptive children A psychofysiological study of the cardiac adaptivity to attention-demanding reaction time tasks demonstrated that children with a lesser variant of the pervasive developmental disorder (DSM-IV: PDDNOS) exhibit less
The optimization of demand response programs in smart grids
International Nuclear Information System (INIS)
Derakhshan, Ghasem; Shayanfar, Heidar Ali; Kazemi, Ahad
2016-01-01
The potential to schedule portion of the electricity demand in smart energy systems is clear as a significant opportunity to enhance the efficiency of the grids. Demand response is one of the new developments in the field of electricity which is meant to engage consumers in improving the energy consumption pattern. We used Teaching & Learning based Optimization (TLBO) and Shuffled Frog Leaping (SFL) algorithms to propose an optimization model for consumption scheduling in smart grid when payment costs of different periods are reduced. This study conducted on four types residential consumers obtained in the summer for some residential houses located in the centre of Tehran city in Iran: first with time of use pricing, second with real-time pricing, third one with critical peak pricing, and the last consumer had no tariff for pricing. The results demonstrate that the adoption of demand response programs can reduce total payment costs and determine a more efficient use of optimization techniques. - Highlights: •An optimization model for the demand response program is made. •TLBO and SFL algorithms are applied to reduce payment costs in smart grid. •The optimal condition is provided for the maximization of the social welfare problem. •An application to some residential houses located in the centre of Tehran city in Iran is demonstrated.
Scavone, Paola; Villar, Silvia; Umpiérrez, Ana; Zunino, Pablo
2015-06-01
Proteus mirabilis is frequently associated with complicated urinary tract infections (UTI). It is proposed that several virulence factors are associated with P. mirabilis uropathogenicity. The aim of this work was to elucidate genotoxic and cytotoxic effects mediated by MR/P fimbriae and flagella in eukaryotic cells in vitro. Two cell lines (kidney- and bladder-derived) were infected with a clinical wild-type P. mirabilis strain and an MR/P and a flagellar mutant. We evaluated adhesion, genotoxicity and cytotoxicity by microscopy, comet assay and triple staining technique, respectively. Mutant strains displayed lower adhesion rates than the P. mirabilis wild-type strain and were significantly less effective to induce genotoxic and cytotoxic effects compared to the wild type. We report for the first time that P. mirabilis MR/P fimbriae and flagella mediate genotoxic and cytotoxic effects on eukaryotic cells, at least in in vitro conditions. These results could contribute to design new strategies for the control of UTI. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Kwok, Percy Lai Yin
2010-01-01
Based on some longitudinal studies of private tutoring in twelve cities, towns, municipalities and provinces of China, the paper endeavours to depict demand intensity, articulate market parameters and reflect on policy responses towards the demand-supply mechanism of the vast shadowy educational phenomena at primary and secondary levels. Such…
MR myelography of sacral meningeal cysts
International Nuclear Information System (INIS)
Tsuchiya, K.; Katase, S.; Hachiya, J.
1999-01-01
Purpose: To describe the findings of sacral meningeal cysts (SMCs) on MR myelography and assess its value for the diagnosis of SMCs. Material and Methods: We evaluated the MR images and MR myelograms obtained from 10 patients with SMC. MR myelograms were obtained using a 2D or 3D single-shot fast spin-echo sequence. In 5 patients, X-ray myelograms and postmyelographic CT images were compared with the MR myelograms. Results: A total of 33 SMCs were diagnosed within the spinal canal and/or sacral foramen. MR myelograms clearly revealed each cyst as a well-defined mass showing hyperintensity (10 cysts) or isointensity (23 cysts) compared to cerebrospinal fluid. MR myelograms demonstrated SMCs better than X-ray myelograms and postmyelographic CT images in 3 of the 5 patients. Conclusion: MR myelography can be an adjunct to conventional imaging techniques when surgical treatment is indicated, because it can precisely delineate the extent of SMCs. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Inada, Yuki [Department of Radiology, Osaka Medical College, 2-7 Daigaku-machi, Takatsuki City, Osaka 569-8686 (Japan)], E-mail: rad068@poh.osaka-med.ac.jp; Matsuki, Mitsuru; Nakai, Go; Tatsugami, Fuminari; Tanikake, Masato; Narabayashi, Isamu [Department of Radiology, Osaka Medical College, 2-7 Daigaku-machi, Takatsuki City, Osaka 569-8686 (Japan); Yamada, Takashi; Tsuji, Motomu [Department of Pathology, Osaka Medical College, 2-7 Daigaku-machi, Takatsuki City, Osaka 569-8686 (Japan)
2009-04-15
Objective: In this study, the authors discussed the feasibility and value of diffusion-weighted (DW) MR imaging in the detection of uterine endometrial cancer in addition to conventional nonenhanced MR images. Methods and materials: DW images of endometrial cancer in 23 patients were examined by using a 1.5-T MR scanner. This study investigated whether or not DW images offer additional incremental value to conventional nonenhanced MR imaging in comparison with histopathological results. Moreover, the apparent diffusion coefficient (ADC) values were measured in the regions of interest within the endometrial cancer and compared with those of normal endometrium and myometrium in 31 volunteers, leiomyoma in 14 patients and adenomyosis in 10 patients. The Wilcoxon rank sum test was used, with a p < 0.05 considered statistically significant. Results: In 19 of 23 patients, endometrial cancers were detected only on T2-weighted images. In the remaining 4 patients, of whom two had coexisting leiomyoma, no cancer was detected on T2-weighted images. This corresponds to an 83% detection sensitivity for the carcinomas. When DW images and fused DW images/T2-weighted images were used in addition to the T2-weighted images, cancers were identified in 3 of the remaining 4 patients in addition to the 19 patients (overall detection sensitivity of 96%). The mean ADC value of endometrial cancer (n = 22) was (0.97 {+-} 0.19) x 10{sup -3} mm{sup 2}/s, which was significantly lower than those of the normal endometrium, myometrium, leiomyoma and adenomyosis (p < 0.05). Conclusion: DW imaging can be helpful in the detection of uterine endometrial cancer in nonenhanced MR imaging.
Estimating deficit probabilities with price-responsive demand in contract-based electricity markets
International Nuclear Information System (INIS)
Galetovic, Alexander; Munoz, Cristian M.
2009-01-01
Studies that estimate deficit probabilities in hydrothermal systems have generally ignored the response of demand to changing prices, in the belief that such response is largely irrelevant. We show that ignoring the response of demand to prices can lead to substantial over or under estimation of the probability of an energy deficit. To make our point we present an estimation of deficit probabilities in Chile's Central Interconnected System between 2006 and 2010. This period is characterized by tight supply, fast consumption growth and rising electricity prices. When the response of demand to rising prices is acknowledged, forecasted deficit probabilities and marginal costs are shown to be substantially lower
On the demand for prescription drugs: heterogeneity in price responses.
Skipper, Niels
2013-07-01
This paper estimates the price elasticity of demand for prescription drugs using an exogenous shift in consumer co-payment caused by a reform in the Danish subsidy scheme for the general public. Using purchasing records for the entire Danish population, I show that the average price response for the most commonly used drug yields demand elasticities in the range of -0.36 to -0.5. The reform is shown to affect women, the elderly, and immigrants the most. Furthermore, this paper shows significant heterogeneity in the price response over different types of antibiotics, suggesting that the price elasticity of demand varies considerably even across relatively similar drugs. Copyright © 2012 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
Jiang, Yibo; Xu, Jian; Sun, Yuanzhang; Wei, Congying; Wang, Jing; Ke, Deping; Li, Xiong; Yang, Jun; Peng, Xiaotao; Tang, Bowen
2017-01-01
Highlights: • Improving the utilization of wind power by the demand response of residential hybrid energy system. • An optimal scheduling of home energy management system integrating micro-CHP. • The scattered response capability of consumers is aggregated by demand bidding curve. • A stochastic day-ahead economic dispatch model considering demand response and wind power. - Abstract: As the installed capacity of wind power is growing, the stochastic variability of wind power leads to the mismatch of demand and generated power. Employing the regulating capability of demand to improve the utilization of wind power has become a new research direction. Meanwhile, the micro combined heat and power (micro-CHP) allows residential consumers to choose whether generating electricity by themselves or purchasing from the utility company, which forms a residential hybrid energy system. However, the impact of the demand response with hybrid energy system contained micro-CHP on the large-scale wind power utilization has not been analyzed quantitatively. This paper proposes an operation optimization model of the residential hybrid energy system based on price response, integrating micro-CHP and smart appliances intelligently. Moreover, a novel load aggregation method is adopted to centralize scattered response capability of residential load. At the power grid level, a day-ahead stochastic economic dispatch model considering demand response and wind power is constructed. Furthermore, simulation is conducted respectively on the modified 6-bus system and IEEE 118-bus system. The results show that with the method proposed, the wind power curtailment of the system decreases by 78% in 6-bus system. In the meantime, the energy costs of residential consumers and the operating costs of the power system reduced by 10.7% and 11.7% in 118-bus system, respectively.
What is demand response? Contributing to secure security-of-supply at the electricity markets
International Nuclear Information System (INIS)
Grenaa Jensen, Stine; Skytte, Klaus; Togeby, Mikael
2004-01-01
There is a common understanding that demand response can reduce the total costs of electricity reliability. There has especially been a growing interest in the electricity market where high spot prices in peak periods and blackouts have recently been seen. It is not easy from the existing literature to find a common definition of demands response. Often the term demand response is used broadly without looking at the time dimension. However, it does not make sense to talk about demand response without talking about when, for how long the energy is used or saved, and at which costs. This paper surveys these subjects and set up a systematic grouping of the different characteristics of demand response. It especially looks at the time dimension. (au)
Demand response impacts on off-grid hybrid photovoltaic-diesel generator microgrids
Directory of Open Access Journals (Sweden)
Aaron St. Leger
2015-08-01
Full Text Available Hybrid microgrids consisting of diesel generator set(s and converter based power sources, such as solar photovoltaic or wind sources, offer an alternative to generator based off-grid power systems. The hybrid approach has been shown to be economical in many off-grid applications and can result in reduced generator operation, fuel requirements, and maintenance. However, the intermittent nature of demand and renewable energy sources typically require energy storage, such as batteries, to properly operate the hybrid microgrid. These batteries increase the system cost, require proper operation and maintenance, and have been shown to be unreliable in case studies on hybrid microgrids. This work examines the impacts of leveraging demand response in a hybrid microgrid in lieu of energy storage. The study is performed by simulating two different hybrid diesel generator—PV microgrid topologies, one with a single diesel generator and one with multiple paralleled diesel generators, for a small residential neighborhood with varying levels of demand response. Various system designs are considered and the optimal design, based on cost of energy, is presented for each level of demand response. The solar resources, performance of solar PV source, performance of diesel generators, costs of system components, maintenance, and operation are modeled and simulated at a time interval of ten minutes over a twenty-five year period for both microgrid topologies. Results are quantified through cost of energy, diesel fuel requirements, and utilization of the energy sources under varying levels of demand response. The results indicate that a moderate level of demand response can have significant positive impacts to the operation of hybrid microgrids through reduced energy cost, fuel consumption, and increased utilization of PV sources.
7 CFR 29.3026 - General quality.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false General quality. 29.3026 Section 29.3026 Agriculture... General quality. The quality of tobacco considered in relation to the type as a whole. General quality is distinguished from the restricted use of the term “quality” within a group. [24 FR 8771, Oct. 29, 1959...
Characterisation of musculoskeletal tumours by multivoxel proton MR spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Patni, Ruchi S.; Gogoi, Nripen [Assam Medical College, Department of Radio-diagnosis, Dibrugarh, Assam (India); Boruah, Deb K. [Assam Medical College, Department of Radio-diagnosis, Dibrugarh, Assam (India); M-Lane, RCC-4, Assam Medical College Campus, Dibrugarh, Assam (India); Sanyal, Shantiranjan [Airedale General Hospital, Consultant Radiologist, West Yorkshire (United Kingdom); Gogoi, Bidyut B. [NEIGHRMS, Department of Pathology, Shillong, Meghalaya (India); Patni, Maninder [Geetanjali Medical College, Department of Anesthesiology, Udaipur, Rajasthan (India); Khandelia, Rosy [Assam Medical College, Department of Pathology, Dibrugarh, Assam (India)
2017-04-15
The purpose of this study is to evaluate the role of multi-voxel proton MR spectroscopy in differentiating benign and malignant musculoskeletal tumours in a more objective way and to correlate the MRS data parameters with histopathology. A hospital-based prospective study was carried out comprising 42 patients who underwent MRI examinations from 1 July 2013 to 30 June 2014. After routine sequences, single-slice multi-voxel proton MR spectroscopy was included at TE-135 using the PRESS sequence. The voxel with the maximum choline/Cr ratio was used for analysis of data in 32 patients. The strength of association between the MR spectroscopy findings and the nature of tumour and histopathological grading were assessed. Of the 42 patients, the MR spectra were not of diagnostic quality in 10. In the remaining 32 patients, 12 (37.5%) had benign and 20 (62.5%) malignant tumours. The mean choline/Cr ratio was 6.97 ± 5.95 (SD) for benign tumours and 25.39 ± 17.72 (SD) for malignant tumours. In our study statistical significance was noted between the choline/Cr ratio and the histological nature of musculoskeletal tumours (p = 0.002) assessed by unpaired t-test. The choline/Cr ratio and histological grading were also found to be significant (p = 0.001) when assessed by one-way ANOVA test. Multi-voxel MR spectroscopy showed a higher choline/Cr ratio in malignant musculoskeletal tumours than in benign ones (p = 0.002). The choline/Cr ratio and histological grading of musculoskeletal tumours also showed statistical significance (p = 0.001). (orig.)
Demand Response Valuation Frameworks Paper
Energy Technology Data Exchange (ETDEWEB)
Heffner, Grayson
2009-02-01
While there is general agreement that demand response (DR) is a valued component in a utility resource plan, there is a lack of consensus regarding how to value DR. Establishing the value of DR is a prerequisite to determining how much and what types of DR should be implemented, to which customers DR should be targeted, and a key determinant that drives the development of economically viable DR consumer technology. Most approaches for quantifying the value of DR focus on changes in utility system revenue requirements based on resource plans with and without DR. This ''utility centric'' approach does not assign any value to DR impacts that lower energy and capacity prices, improve reliability, lower system and network operating costs, produce better air quality, and provide improved customer choice and control. Proper valuation of these benefits requires a different basis for monetization. The review concludes that no single methodology today adequately captures the wide range of benefits and value potentially attributed to DR. To provide a more comprehensive valuation approach, current methods such as the Standard Practice Method (SPM) will most likely have to be supplemented with one or more alternative benefit-valuation approaches. This report provides an updated perspective on the DR valuation framework. It includes an introduction and four chapters that address the key elements of demand response valuation, a comprehensive literature review, and specific research recommendations.
Market Design for Rapid Demand Response - The Case of Kenya
Kurt Nielsen; Tseganesh Wubale Tamirat
2014-01-01
We suggest a market design for rapid demand response in electricity markets. The solution consists of remotely controlled switches, meters, forecasting models as well as a flexible auction market to set prices and select endusers job by job. The auction market motivates truth-telling and makes it simple to involve the endusers in advance and to activate demand response immediately. The collective solution is analyzed and economic simulations are conducted for the case of Kenya. Kenya has been...
Traumatic cervical root injury: Diagnostic value of MR imaging
International Nuclear Information System (INIS)
Lee, Seon Kyu; Chang, Kee Hyun; Han, Moon Hee; Kim, Ho Chul; Kim, Jea Seung; Cha, Sang Hoon
1993-01-01
Although superior soft tissue contrast and direct multiplanar imaging capability of MRI are well recognized, myelography has been the imaging modality of choice in evaluation cervical root injury. We assessed the role of MRI and compared its diagnostic accuracy with myelography in the evaluation of cervical root injury. MR imagings of cervical root injury in ten patients (55 roots) were retrospectively reviewed. In 26 explored roots (6 patients). MR findings were compared with myelography and surgical results. In 29 roots (8 patients), which were confirmed by myelography or exploration, the MR findings were focal extradural CSF collections (pseudomeningocele) in 21/29 (72.4%, 8 patients), thickening of extradural roots in 4/29 (13.6%, 5 patients), and thickening of dura in 12/29 (41.4%, 6 patients) roots. T2-weighted axial image was superior to T1-weighted and protein-density- weighted images for delineation root avulsion. The sensitivity and specificity of MRI were 72.7% and 93.3% respectively, while those of myelography were 83% and 90%. Overall diagnostic accuracy of MRI and myelography were comparable (84.6% vs 87.5%). In conclusion, myelography is still considered as the modality of choice in the preoperative evaluation of the cervical root avulsion because of its higher sensitivity. MRI, however, may obviate the myelography with some technical refinements
Energy Technology Data Exchange (ETDEWEB)
Sommer, T.; Vahlensieck, M.; Lutterbey, G.; Pauleit, D.; Kreft, B.; Keller, E.; Schild, H. [Radiologische Universitaetsklinik Bonn (Germany); Wallny, T. [Orthopaedische Universitaetsklinik Bonn (Germany); Steuer, K.; Golombek, V. [Klinik fuer Unfallchirurgie, Univ. Bonn (Germany)
1997-07-01
Purpose: It has been shown that intravenous administration of contrast media produces an MR arthrographic effect without the need for intraarticular injection. This is the first study evaluating this new technique of indirect MR arthrography in the diagnosis of glenoid labrum tears. Methods: 28 patients with clinically suspected labral injuries were prospectively investigated (1.5 Tesla, flexible surface coil). A plain MR examination of the shoulder (transverse and oblique-coronal orientation, T{sub 1}-weighted spin- [T{sub E}/T{sub R} 15/675], proton density- and T{sub 2}*-weighted gradient echo [T{sub E}/T{sub R}/Flip 14,32/600/30 ] sequences) and indirect MR arthrography (transverse and oblique-coronal orientation, fat-suppressed T{sub 1}-weighted spin-echo sequences [T{sub E}/T{sub R} 15/675], intravenous injection of gadopentetate dimeglumine [0.1 mmol/kg], followed by 10-15 min of joint movement) were performed. Results were confirmed by arthroscopy and/or open surgery. Results: Indirect MR arthrography significantly improved delineation of the glenoid labrum and hyaline cartilage (p<0.05). Sensitivity and specificity of indirect MR arthrography in the diagnosis of labral injuries were 90% and 89%, compared to 79% and 67% of the native MR examination. Conclusion: Indirect MR arthrography is a promising non-invasive technique in the evaluation of the glenoid labrum. (orig.) [Deutsch] Ziel: In frueheren Studien wurde gezeigt, dass die intravenoese Injektion gadoliniumhaltiger Kontrastmittel zur Signalintensitaetssteigerung im Gelenkkavum fuehrt. In dieser Studie wurde erstmals diese Technik der indirekten MR-Arthrographie am Schultergelenk in der Diagnostik von Labrumlaesionen evaluiert. Methode: 28 Patienten mit klinischem Verdacht auf eine Verletzung des Labrum glenoidale und/oder der Rotatorenmanschette wurden prospektiv nach folgendem Protokoll an einem 1,5-Tesla-System mit einer Oberflaechen-Ringspule untersucht: 1. Native MR-Standard-Untersuchung mit
MR findings of brainstem injury
Energy Technology Data Exchange (ETDEWEB)
Park, Man Soo; Hwang, Woo Cheol; Park, Choong Ki [Hallym University College of Medicine, Seoul (Korea, Republic of); Suh, Dae Chul [University of Ulsan College of Medicine, Seoul (Korea, Republic of); Kim, Sang Joon [Dankook University of College of Medicine, Cheonan (Korea, Republic of)
1995-02-15
To analyze the characteristics of traumatic brainstem injury by CT and MR. CT and MR studies of 10 patients with traumatic brainstem lesion in MR were retrospectively reviewed, particularly attended to location, signal intensity and associated lesions. CT failed to depict 8 of 10 brainstem lesions. All lesions were detected in MR images with T2-weighted images showing higher detection rate (n = 10) (100%) than T1-weighted images (n = 3) (30%) or CT (n = 2) (20%). The brainstem lesions located in the dorsolateral aspects of the rostral brainstem (mid brain and upper pons) in 7 (70%) cases, in ventral aspects of rostral brain in 2 (20%) cases and in median portion of pons in 1 (10%) case. Corpus callosal (n = 5), lobar white matter (n = 5) diffuse axonal injury, and 2 hemorrhagic lesions in basal ganglia were the associated findings. MR imaging is more helpful than CT in the detection of brainstem injury, especially T2 weighted images. Primary brainstem lesions were typically located in the dorsolateral aspect of rostral brainstem (midbrain and upper pons). Corpus callosum and white matter lesions were frequently associated.
Cui, Gaoying; Fan, Jie; Qin, Yuchen; Wang, Dong; Chen, Guangyan
2017-05-01
In order to promote the effective use of demand response load side resources, promote the interaction between supply and demand, enhance the level of customer service and achieve the overall utilization of energy, this paper briefly explain the background significance of design demand response information platform and current situation of domestic and foreign development; Analyse the new demand of electricity demand response combined with the application of Internet and big data technology; Design demand response information platform architecture, construct demand responsive system, analyse process of demand response strategy formulate and intelligent execution implement; study application which combined with the big data, Internet and demand response technology; Finally, from information interaction architecture, control architecture and function design perspective design implementation of demand response information platform, illustrate the feasibility of the proposed platform design scheme implemented in a certain extent.
International Nuclear Information System (INIS)
Einarsdottir, H.; Wejde, J.; Bauer, H.C.F.
2000-01-01
To evaluate if static post-contrast MR imaging was adequate to assess tumor viability after pre-operative radiotherapy in soft tissue sarcoma. Post-contrast MR imaging of 36 soft tissue sarcomas performed 0 - 54 days (median 13 days) after pre-operative radiotherapy, were retrospectively reviewed and compared to post-operative histopathology reports. The contrast enhancement of the tumor was visually graded as minor, moderate or extensive. From the post-operative histopathology reports, three types of tumor response to radiotherapy were defined: Poor, intermediate or good. The size of the tumors before and after radiation was compared. Even if most viable tumors enhanced more than non-viable tumors, there was major overlapping and significant contrast enhancement could be seen in tumors where histopathological examination revealed no viable tumor tissue. Based on histopathology, there were 12 good responders; 8 of these showed minor, 3 moderate and 1 extensive contrast enhancement on MR imaging. Sixteen tumors had an intermediate response; 3 showed minor, 8 moderate and 5 extensive enhancement. Eight tumors had poor response; none showed minor enhancement, 3 moderate and 5 extensive enhancement. Both increase and Decrease in tumor size was seen in lesions with a good therapy response. Static post-contrast MR imaging cannot reliably assess tumor viability after pre-operative radiotherapy in soft tissue sarcoma. In tumors with no viable tumor tissue, moderate and extensive contrast enhancement can be seen
Significance of MR imaging in patients with pulmonary hypertension
International Nuclear Information System (INIS)
Frank, H.; Globits, S.; Mayr, H.; Lang, I.; Kneussl, M.; Glogar, D.; Miczoch, J.; Neuhold, A.; Imhof, H.
1989-01-01
To determine the diagnostic impact of MR imaging in pulmonary hypertension (PH), the authors have examined 12 PH patients with a 0.5- or 1.5-T magnet in a double-angulation projection with multisection, multiphase technique and a gradient-echo sequence. MR data were evaluated for right ventricular volumes or function and compared with data from 10 control subjects. In PH patients, MR imaging showed right ventricular enlargement with hypertrophy, right atrial enlargement, and abnormal septal motion. Right ventricular (RV) function was compromised, with reduced RV circumferential shortening. PH patients had a severe reduction of long-axis shortening and variable reduction of short-axis shortening that correlated with the degree of PH (r = .68, P <.01)
International Nuclear Information System (INIS)
Oberholzer, Katja; Menig, Matthias; Kreft, Andreas; Schneider, Astrid; Junginger, Theodor; Heintz, Achim; Kreitner, Karl-Friedrich; Hötker, Andreas M.; Hansen, Torsten; Düber, Christoph; Schmidberger, Heinz
2012-01-01
Purpose: To assess response of locally advanced rectal carcinoma to chemoradiation with regard to mucinous status and local tumor invasion found at pretherapeutic magnetic resonance imaging (MRI). Methods and Materials: A total of 88 patients were included in this prospective study of patients with advanced mrT3 and mrT4 carcinomas. Carcinomas were categorized by MRI as mucinous (mucin proportion >50% within the tumor volume), and as nonmucinous. Patients received neoadjuvant chemoradiation consisting of 50.4 Gy (1.8 Gy/fraction) and 5-fluorouracil on Days 1 to 5 and Days 29 to 33. Therapy response was assessed by comparing pretherapeutic MRI with histopathology of surgical specimens (minimum distance between outer tumor edge and circumferential resection margin = CRM, T, and N category). Results: A mucinous carcinoma was found in 21 of 88 patients. Pretherapeutic mrCRM was 0 mm (median) in the mucinous and nonmucinous group. Of the 88 patients, 83 underwent surgery with tumor resection. The ypCRM (mm) at histopathology was significantly lower in mucinous carcinomas than in nonmucinous carcinomas (p ≤ 0.001). Positive resection margins (ypCRM ≤ 1 mm) were found more frequently in mucinous carcinomas than in nonmucinous ones (p ≤ 0.001). Treatment had less effect on local tumor stage in mucinous carcinomas than in nonmucinous carcinomas (for T downsizing, p = 0.012; for N downstaging, p = 0.007). Disease progression was observed only in patients with mucinous carcinomas (n = 5). Conclusion: Mucinous status at pretherapeutic MRI was associated with a noticeably worse response to chemoradiation and should be assessed by MRI in addition to local tumor staging to estimate response to treatment before it is initiated.
Modeling of demand response in electricity markets : effects of price elasticity
International Nuclear Information System (INIS)
Banda, E.C.; Tuan, L.A.
2007-01-01
A design mechanism for the optimal participation of customer load in electricity markets was presented. In particular, this paper presented a modified market model for the optimal procurement of interruptible loads participating in day-ahead electricity markets. The proposed model considers the effect of price elasticity and demand-response functions. The objective was to determine the role that price elasticity plays in electricity markets. The simulation model can help the Independent System Operator (ISO) identify customers offering the lowest price of interruptible loads and load flow patterns that avoid problems associated with transmission congestion and transmission losses. Various issues associated with procurement of demand-response offerings such as advance notification, locational aspect of load, and power factor of the loads, were considered. It was shown that demand response can mitigate price volatility by allowing the ISO to maintain operating reserves during peak load periods. It was noted that the potential benefits of the demand response program would be reduced when price elasticity of demand is taken into account. This would most likely occur in actual developed open electricity markets, such as Nordpool. This study was based on the CIGRE 32-bus system, which represents the Swedish high voltage power system. It was modified for this study to include a broad range of customer characteristics. 18 refs., 2 tabs., 14 figs
Iguchi, Aya
2016-01-01
Objectives The purpose of this study was to investigate the job demands and job resources of public health nurses based on the Job Demands-Resources (JD-R) model, and to build a model that can estimate turnover intention based on job demands and job resources.Method By adding 12 items to the existing questionnaire, the author created a questionnaire consisting of 10 factors and 167 items, and used statistical analysis to examine job demands and job resources in relation to turnover intention.Results Out of 2,668 questionnaires sent, 1993 (72.5%) were returned. Considering sex-based differences in occupational stress, I analyzed women's answers in 1766 (66.2%) mails among the 1798 valid responses. The average age of respondents was 41.0±9.8 years, and the mean service duration was 17.0±10.0 years. For public health nurses, there was a turnover intention of 9.2%. The "job demands" section consisted of 29 items and 10 factors, while the "job resources" section consisted of 54 items and 22 factors. The result of examining the structure of job demands and job resources, leading to turnover intention was supported by the JD-R model. Turnover intention was strong and the Mental Component Summary (MCS) is low in those who had many job demands and few job resources (experiencing 'burn-out'). Enhancement of work engagement and turnover intention was weak in those who had many job resources. This explained approximately 60% of the dispersion to "burn-out", and approximately 40% to "work engagement", with four factors: work suitability, work significance, positive work self-balance, and growth opportunity of job resources.Conclusion This study revealed that turnover intention is strong in those who are burned out because of many job demands. Enhancement of work engagement and turnover intention is weak in those with many job resources. This suggests that suitable staffing and organized efforts to raise awareness of job significance are effective in reducing
Assessing long-term effects of demand response policies in wholesale electricity markets
International Nuclear Information System (INIS)
Cepeda, Mauricio; Saguan, Marcelo
2014-05-01
This paper deals with the practical problems related to long-term issues in electricity markets in the presence of demand response development. Different policies have been implemented around the world aiming to develop demand response potential. Externalities, in particular the CO_2 externality, have been one of the key elements in the debate on the effectiveness of different policies regarding demand response development. Policy makers have several options to deal with this externality. The most direct one is to correct the externality by setting a CO_2 price at a level that corresponds to the cost to society of the corresponding CO_2 emissions. One alternative solution could be to subsidize carbon-free technologies as demand response. In this paper we examine potential long-term impacts of these two policies. We rely on a long-term market simulation model that characterizes expansion decisions in a competitive regime. We test for each policy two different scenarios regarding the possibility of internalization of the CO_2 externality. The results show that differences in development policies affect both investments and social costs in the wholesale electricity market and confirm previous findings that a market-driven development of demand response with the internalization of the CO_2 externality is the most efficient approach. (authors)
7 CFR 29.3018 - Dark red color (D).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Dark red color (D). 29.3018 Section 29.3018 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... Type 93) § 29.3018 Dark red color (D). A dark reddish brown. [24 FR 8771, Oct. 29, 1959. Redesignated...
Embedded generation for industrial demand response in renewable energy markets
International Nuclear Information System (INIS)
Leanez, Frank J.; Drayton, Glenn
2010-01-01
Uncertainty in the electrical energy market is expected to increase with growth in the percentage of generation using renewable resources. Demand response can play a key role in giving stability to system operation. This paper discusses the embedded generation for industrial demand response in renewable energy markets. The methodology of the demand response is explained. It consists of long-term optimization and stochastic optimization. Wind energy, among all the renewable resources, is becoming increasingly popular. Volatility in the wind energy sector is high and this is explained using examples. Uncertainty in the wind market is shown using stochastic optimization. Alternative techniques for generation of wind energy were seen to be needed. Embedded generation techniques include co-generation (CHP) and pump storage among others. These techniques are analyzed and the results are presented. From these results, it is seen that investment in renewables is immediately required and that innovative generation technologies are also required over the long-term.
Extending the bidding format to promote demand response
International Nuclear Information System (INIS)
Liu, Yanchao; Holzer, Jesse T.; Ferris, Michael C.
2015-01-01
We propose an extended bidding structure to allow more realistic demand characteristics and behaviors to be expressed via flexible bids. In today's ISO-run energy markets, demand bid formats are all separable over time. However, a significant and growing segment of demand can be shifted across time and therefore has no way to bid its true valuation of consumption. We propose additional bid types that allow deferrable, adjustable and storage-type loads to better express their value, and thus elicit demand response in the most natural way – via direct participation in the market. We show that the additional bid types are easily incorporated into the existing market with no technological barrier and that they preserve the market's efficiency and incentive-compatibility properties. Using real market data, we give a numerical demonstration that the extended bid format could substantially increase social welfare, and also present additional insight on storage expansion scenarios. - Highlights: • Three new bid types are proposed to enrich demand-side participation. • Time value of electricity demand can be clearly conveyed to central dispatcher. • The extended format preserves market efficiency and incentive compatibility. • Energy storage is most effective to neutralize price volatility, with a limitation.
Demand response driven load pattern elasticity analysis for smart households
Paterakis, N.G.; Catalao, J.P.S.; Tascikaraoglu, A.; Bakirtzis, A.G.; Erdinc, O.
2015-01-01
The recent interest in smart grid vision enables several smart applications in different parts of the power grid structure, where specific importance should be given to the demand side. As a result, changes in load patterns due to demand response (DR) activities at end-user premises, such as smart
Wilson's disease: {sup 31}P and {sup 1}H MR spectroscopy and clinical correlation
Energy Technology Data Exchange (ETDEWEB)
Sinha, Sanjib; Taly, A.B.; Prashanth, L.K. [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neurology, Bangalore (India); Ravishankar, S.; Vasudev, M.K. [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neuroimaging and Interventional Radiology, Bangalore (India)
2010-11-15
Proton ({sup 1}H) magnetic resonance spectroscopy (MRS) changes are noted in Wilson's disease (WD). However, there are no studies regarding membrane phospholipid abnormality using {sup 31}P MRS in these patients. We aimed to analyze the striatal spectroscopic abnormalities using {sup 31}P and {sup 1}H MRS in WD. Forty patients of WD (treated, 29; untreated,11) and 30 controls underwent routine MR image sequences and in vivo 2-D {sup 31}P and {sup 1}H MRS of basal ganglia using an image-selected technique on a 1.5-T MRI scanner. Statistical analysis was done using Student's t test. The mean durations of illness and treatment were 6.2 {+-} 7.4 and 4.8 {+-} 5.9 years, respectively. MRI images were abnormal in all the patients. {sup 1}H MRS revealed statistically significant reduction of N-acetyl aspartate (NAA)/choline (Cho) and NAA/creatine ratios in striatum ({sup 1}H MRS) of treated patients compared to controls. The mean values of phosphomonoesters (PME) (p < 0.0001), phosphodiesters (PDE) (p < 0.0001), and total phosphorus (TPh) (p < 0.0001) were elevated in patients compared to controls. Statistically significant elevated levels of ratio of PME/PDE (p = 0.05) observed in the striatum were noted in treated patients as compared to controls in the {sup 31}P MRS study. The duration of illness correlated well with increased PME/PDE [p < 0.001], PME/TPh [p < 0.05], and PDE/TPh [p < 0.05] and decreased NAA/Cho [p < 0.05] ratios. There was correlation of MRI score and reduced NAA/Cho ratio with disease severity. The PME/PDE ratio (right) was elevated in the treated group [p < 0.001] compared to untreated group. There is reduced breakdown and/or increased synthesis of membrane phospholipids and increased neuronal damage in basal ganglia in patients with WD. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Matsuno, Y.; Yamashita, Y.; Takahashi, M. [Dept. of Radiology, Kumamoto Univ. School of Medicine, Kumamoto (Japan); Katabuchi, H.; Okamura, H. [Dept. of Gynecology and Obstetrics, Kumamoto Univ. School of Medicine, Kumamoto (Japan); Kitano, Y.; Shimamura, T. [Dept. of Gynecology and Obstetrics, Amakusa Chuou General Hospital, Hondo (Japan)
1999-11-01
Purpose: To test the hypothesis that the simple assessment of signal intensity on T2-weighted MR images is predictive of the effect of hormonal treatment with gonadotropin-releasing hormone (GnRH) analogue. Material and methods: The correlation between T2-weighted MR imaging of uterine leiomyomas and histologic findings was evaluated using 85 leiomyomas from 62 females who underwent myomectomy or hysterectomy. We also correlated the pretreatment MR images features obtained in 110 women with 143 leiomyomas with the effect of GnRH analogue treatment. The size (length x width x depth) of the leiomyoma was evaluated before and at 6 months after treatment by ultrasound. Results: The proportion of leiomyoma cell fascicles and that of extracellular matrix affected signal intensities of uterine leiomyomas on T2-weighted MR images. The amount of extracellular matrix was predominant in hypointense leiomyomas on T2-weighted images, while diffuse intermediate signal leiomyomas were predominantly composed of leiomyoma cell fascicles. Marked degenerative changes were noted in leiomyomas with heterogenous hyperintensity. The homogeneously intermediate signal intensity leiomyomas showed significant size reduction after treatment (size ratio; posttreatment volume/pretreatment volume 0.29{+-}0.11). The size ratio for the hypointense tumors was 0.82{+-}0.14, and 0.82{+-}0.18 for the heterogeneously hyperintense tumors. There was a significant difference in the response to treatment between the homogeneously intermediate signal intensity leiomyomas and the hypointense or heterogeneously hyperintense leiomyomas (both p<0.01). Conclusion: Signal intensity on T2-weighted MR images depends on the amount of leiomyoma cell fascicles and extracellular matrix. Simple assessment of the MR signal intensity is useful in predicting the effect of GnRH analogue on uterine leiomyomas. (orig.)
International Nuclear Information System (INIS)
Matsuno, Y.; Yamashita, Y.; Takahashi, M.; Katabuchi, H.; Okamura, H.; Kitano, Y.; Shimamura, T.
1999-01-01
Purpose: To test the hypothesis that the simple assessment of signal intensity on T2-weighted MR images is predictive of the effect of hormonal treatment with gonadotropin-releasing hormone (GnRH) analogue. Material and methods: The correlation between T2-weighted MR imaging of uterine leiomyomas and histologic findings was evaluated using 85 leiomyomas from 62 females who underwent myomectomy or hysterectomy. We also correlated the pretreatment MR images features obtained in 110 women with 143 leiomyomas with the effect of GnRH analogue treatment. The size (length x width x depth) of the leiomyoma was evaluated before and at 6 months after treatment by ultrasound. Results: The proportion of leiomyoma cell fascicles and that of extracellular matrix affected signal intensities of uterine leiomyomas on T2-weighted MR images. The amount of extracellular matrix was predominant in hypointense leiomyomas on T2-weighted images, while diffuse intermediate signal leiomyomas were predominantly composed of leiomyoma cell fascicles. Marked degenerative changes were noted in leiomyomas with heterogenous hyperintensity. The homogeneously intermediate signal intensity leiomyomas showed significant size reduction after treatment (size ratio; posttreatment volume/pretreatment volume 0.29±0.11). The size ratio for the hypointense tumors was 0.82±0.14, and 0.82±0.18 for the heterogeneously hyperintense tumors. There was a significant difference in the response to treatment between the homogeneously intermediate signal intensity leiomyomas and the hypointense or heterogeneously hyperintense leiomyomas (both p<0.01). Conclusion: Signal intensity on T2-weighted MR images depends on the amount of leiomyoma cell fascicles and extracellular matrix. Simple assessment of the MR signal intensity is useful in predicting the effect of GnRH analogue on uterine leiomyomas. (orig.)
Consequences of the nuclear energy moratorium as demanded by the F.D.P. central committee
International Nuclear Information System (INIS)
1977-08-01
If the construction of nuclear power plants is to be tied to the first partial construction licence for the Germany reprocessing centre, as the F.D.P. especially demands lately (note: superseded since the Party Congress) then this would lead unavoidably to a 3- to 10-year nuclear energy moratorium with extremely serious consequences for the electricity supply and the employment situation in the FRG. In view of the significance of the impending energy policy decisions, the Deutsches Atomforum urges all those responsible in Bund and Laender, to take these interconnections very seriously. Only by solving the apparent conflict between further nuclear energy expansion and reprocessing, can preconditions be created for the realization of an adequate electricity supply which, at the same time, is not harmful to the environment, without serious consequences for energy and employment policies. The fact that these consequences will not be visible until in the eighties, may not be a reason for postponing decisions which have to be taken now. (orig./HP) [de
International Nuclear Information System (INIS)
Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M.
2006-01-01
Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma
Energy Technology Data Exchange (ETDEWEB)
Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M. [Policlinico San Donato, San Donato Milanese, Milan (Italy). Depts. of Radiology, Arrhythmia and Electrophysiology Center
2006-02-15
Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma.
International Nuclear Information System (INIS)
Chu, Chen; Zhou, Nan; Zhang, Huayong; Dou, Xin; Li, Ming; Liu, Song; Zhu, Yun; Chen, Weibo; Chan, Queenie; He, Jian; Sun, Lingyun; Zhou, Zhengyang
2017-01-01
Highlights: • Parotid glands at grade 0–3 had significant values from those in healthy glands. • Parotid D and f values were correlated with MR nodule grade significantly. • There were significant differences of D, f, and D * values among glands at grade 0–3. - Abstract: Purpose: To explore the correlation between intravoxel incoherent motion (IVIM) magnetic resonance (MR) parameters and MR nodular grade of parotid glands in patients with Sjögren’s syndrome (SS). Materials and methods: A total of 31 consecutive patients with SS and 28 gender- and age-matched healthy volunteers underwent bilateral parotid 3.0T MR examination including the IVIM sequence (9 b values, 0–800 s/mm 2 ). The apparent diffusion coefficient (ADC), diffusion coefficient D, pseudo-diffusion coefficient D * , and perfusion fraction f of bilateral parotid glands were obtained, and the nodular grade of each parotid gland was evaluated according to the MR morphological appearance. Results: Sixty-two parotid glands in 31 patients with SS consisted of 32, 14, 8, and 8 parotid glands at MR nodular grades 0, 1, 2, and 3, respectively. In parotid glands of grade 0, 1, 2, 3 and healthy volunteers, the ADC values were (1.13 ± 0.25, 1.11 ± 0.17, 1.05 ± 0.24, 0.89 ± 0.04 and 1.00 ± 0.21) × 10 −3 mm 2 /s, D values were (0.92 ± 0.13, 0.90 ± 0.19, 0.90 ± 0.03, 0.67 ± 0.03, 0.81 ± 0.03) × 10 −3 mm 2 /s, f values were 0.20 ± 0.04, 0.18 ± 0.02, 0.15 ± 0.01, 0.11 ± 0.01, 0.15 ± 0.06, and D * values were (53.89 ± 28.26, 41.78 ± 16.35, 51.24 ± 18.69, 31.83 ± 18.03, 36.83 ± 16.14) × 10 −3 mm 2 /s respectively. The ADC, D, f, and D * values of parotid glands in patients with SS at grade 0 were significantly higher than those in healthy volunteers (all P < 0.05). Significant differences were observed in the D and f values of parotid glands in patients with SS among different grades (P = 0.003, < 0.001, respectively). The IVIM parameters (D, f) of parotid glands at early
Energy Technology Data Exchange (ETDEWEB)
Chu, Chen, E-mail: chuchen19920905@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhou, Nan, E-mail: snscorpion@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhang, Huayong, E-mail: 13770560567@163.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Dou, Xin, E-mail: douxin125@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Li, Ming, E-mail: lm069393@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Liu, Song, E-mail: liusongnj@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhu, Yun, E-mail: qqt111@hotmail.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Chen, Weibo, E-mail: Weibo.Chen@philips.com [Philips Healthcare, Shanghai, 200233 (China); Chan, Queenie, E-mail: queenie.chan@philips.com [Philips Healthcare, Hong Kong (China); He, Jian, E-mail: hjxueren@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Sun, Lingyun, E-mail: lysun_nju@163.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhou, Zhengyang, E-mail: zyzhou@nju.edu.cn [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China)
2017-01-15
Highlights: • Parotid glands at grade 0–3 had significant values from those in healthy glands. • Parotid D and f values were correlated with MR nodule grade significantly. • There were significant differences of D, f, and D{sup *} values among glands at grade 0–3. - Abstract: Purpose: To explore the correlation between intravoxel incoherent motion (IVIM) magnetic resonance (MR) parameters and MR nodular grade of parotid glands in patients with Sjögren’s syndrome (SS). Materials and methods: A total of 31 consecutive patients with SS and 28 gender- and age-matched healthy volunteers underwent bilateral parotid 3.0T MR examination including the IVIM sequence (9 b values, 0–800 s/mm{sup 2}). The apparent diffusion coefficient (ADC), diffusion coefficient D, pseudo-diffusion coefficient D{sup *}, and perfusion fraction f of bilateral parotid glands were obtained, and the nodular grade of each parotid gland was evaluated according to the MR morphological appearance. Results: Sixty-two parotid glands in 31 patients with SS consisted of 32, 14, 8, and 8 parotid glands at MR nodular grades 0, 1, 2, and 3, respectively. In parotid glands of grade 0, 1, 2, 3 and healthy volunteers, the ADC values were (1.13 ± 0.25, 1.11 ± 0.17, 1.05 ± 0.24, 0.89 ± 0.04 and 1.00 ± 0.21) × 10{sup −3} mm{sup 2}/s, D values were (0.92 ± 0.13, 0.90 ± 0.19, 0.90 ± 0.03, 0.67 ± 0.03, 0.81 ± 0.03) × 10{sup −3} mm{sup 2}/s, f values were 0.20 ± 0.04, 0.18 ± 0.02, 0.15 ± 0.01, 0.11 ± 0.01, 0.15 ± 0.06, and D{sup *}values were (53.89 ± 28.26, 41.78 ± 16.35, 51.24 ± 18.69, 31.83 ± 18.03, 36.83 ± 16.14) × 10{sup −3} mm{sup 2}/s respectively. The ADC, D, f, and D{sup *} values of parotid glands in patients with SS at grade 0 were significantly higher than those in healthy volunteers (all P < 0.05). Significant differences were observed in the D and f values of parotid glands in patients with SS among different grades (P = 0.003, < 0.001, respectively). The IVIM
Jin, Guangwei; Li, Kuncheng; Hu, Yingying; Qin, Yulin; Wang, Xiangqing; Xiang, Jie; Yang, Yanhui; Lu, Jie; Zhong, Ning
2011-11-01
To compare the blood oxygen level-dependent (BOLD) response, measured with functional magnetic resonance (MR) imaging, in the posterior cingulate cortex (PCC) and adjacent precuneus regions between healthy control subjects and patients with amnestic mild cognitive impairment (MCI) during problem-solving tasks. This study was approved by the institutional review board. Each subject provided written informed consent. Thirteen patients with amnestic MCI and 13 age- and sex-matched healthy control subjects participated in the study. The functional magnetic resonance (MR) imaging tasks were simplified 4 × 4-grid number placement puzzles that were divided into a simple task (using the row rule or the column rule to solve the puzzle) and a complex task (using both the row and column rules to solve the puzzle). Behavioral results and functional imaging results between the healthy control group and the amnestic MCI group were analyzed. The accuracy for the complex task in the healthy control group was significantly higher than that in the amnestic MCI group (P < .05). The healthy control group exhibited a deactivated BOLD signal intensity (SI) change in the bilateral PCC and adjacent precuneus regions during the complex task, whereas the amnestic MCI group showed activation. The positive linear correlations between the BOLD SI change in bilateral PCC and adjacent precuneus regions and in bilateral hippocampi in the amnestic MCI group were significant (P < .001), while in the healthy control group, they were not (P ≥ .23). These findings suggest that an altered BOLD response in amnestic MCI patients during complex tasks might be related to a decline in problem-solving ability and to memory impairment and, thus, may indicate a compensatory response to memory impairment. RSNA, 2011
29 CFR 452.10 - Retaliation for exercising rights.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Retaliation for exercising rights. 452.10 Section 452.10... exercising rights. Section 609, which prohibits labor organizations or their officials from disciplining members for exercising their rights under the Act, and section 610, which makes it a crime for any person...
The Demand Side Response to Multi-zone Tariffs. Consumer Test Results
Directory of Open Access Journals (Sweden)
Adam Olszewski
2015-12-01
Full Text Available Advanced Metering Infrastructure (AMI is a technologically advanced solution currently implemented by the most innovative distribution system operators. ENERGA-OPERATOR SA set about preparing for smart metering implementation in 2010. So far the company has installed over 400,000 meters in its area, and plans to install a further 450,000 in 2015. Kalisz, the first fully AMI-covered city in Poland, was chosen for an in-depth analysis of the system. In particular, a consumer test was conducted there with the intention of answering the question about the strength of the demand side response to multi-zone tariffs and power reduction. Conclusions from the year-long test show the demand side response to multi-zone tariffs – i.e. the maximum temporary percentage reduction of energy consumption in the time zone with the tariff raised by a min. of 80% – stays within the 5–15% range. In the case of power reduction (the maximum temporary reduction of energy consumption in the time zone when the power available to a household is limited to 1 kW – the demand side response stays within the 10–30% range. An additional effect of tariff diversification and smart metering is a reduction in electricity consumption by 1–4% on working days (i.e. this is the effect of either the consumption reduction or shifting it to weekends. During the test energy consumers were subjected to both price incentives and education. Due to the fact that it is difficult to separate the effects of education and tariff structures, the company plans to continue the research related to verifying the effectiveness of individual activation tools in reducing electricity consumption by households.
International Nuclear Information System (INIS)
Kim, Jeong Ho; Kim, Hyung Jin; Han, Heon; Lee, Hong Lyeol; Kim, Kwang Ho; Suh, Chang Hae
1999-01-01
To evaluate the usefulness of contrast-enhanced dynamic MR imaging for differentiation of benign and malignant solitary pulmonary nodules (SPNs). Twenty-three patients with histologically or radiologically provened SPNs smaller than 40mm (14 benign, 9 malignant) underwent MR examination using the breath-hold fast multiplanar spoiled gradient echo (FMPSPGR) technique. Pre-enhancement MR examination was followed by serial scans obtained at one-minute intervals, beginning one-minute after the onset of bolus injection of paramagnetic contrast agent for a total of five scans. Signal intensities of SPNs were measured from pre- and post-contrast enhanced MR images and peak percentage increase in signal intensity (p%SI) was calculated. Mean percentage increase in signal intensity (m%SI) was also calculated and the time-m%SI curve was plotted. The enhancement patterns of SPNs were classified as homogeneous, peripheral rim-like, inhomogeneous, or no (or minimal) enhancement. We compared differences in p%SI, the pattern of the time-m%SI curve, and the pattern of enhancement between benign and malignant SPNs. On dynamic MR images, alignant SPNs (n=9) showed a significantly higher p%SI than benign SPNs (n=14) (malignant : mean 120.6, range 81.8-171.6; benign : mean 29.5, range 3.7-78.9)(p<0.0001). With 80 p%SI as the threshold for malignancy-positive, both sensitivity and specificity were 100%. The m%SI of malignant SPNs rapidly increased at one minute after enhancement and decreased gradually thereafter, whereas that of benign SPNs increased more slowly to form a plateau. Eighty-nine percent (8/9) of malignant SPNs showed homogeneous enhancement. In contrast, among benign SPNs, peripheral rim-like enhancement and no (or minimal) enhancement occurred in the same proportion of cases : 50%(7/14). The superb demonstration of different enhancement characteristics obtained using dynamic contrast-enhanced MR imaging is useful to discriminate malignant from benign SPNs
Mr imaging and mr spectroscopy of brain metastases by mr perfusion
International Nuclear Information System (INIS)
Weber, Marc-Andre; Lichy, M.P.; Thilmann, C.; Guenther, M.; Bachert, P.; Delorme, S.; Schad, L.R.; Debus, J.; Schlemmer, H.P.; Maudsley, A.A.
2003-01-01
In follow-up examinations of irradiated brain metastases conventional contrast-enhanced morphological MR imaging is often unable to distinguish between transient radiation effects, radionecrosis, and tumor recurrence. To evaluate changes of relative cerebral blood flow (rCBF) in irradiated brain metastases arterial spin-labeling techniques (ASL) were applied and compared to the outcome of 1 H MR spectroscopy and spectroscopic imaging ( 1 H MRS, SI). Patients and methods In 2 patients follow-up examinations of irradiated brain metastases were performed on a 1.5-T tomograph (average single dose: 20 Gy/80% isodose). Relative CBF values of gray matter (GM), white matter (WM), and metastases (Met) were measured by means of the ASL techniques ITS-FAIR and Q2TIPS. 1 H MRS was performed with PRESS 1500/135. In both patients with initially hyperperfused metastases (Met/GM >1) the reduction of rCBF after stereotactic radiosurgery indicated response to treatment - even if the contrast-enhancing region increased - while increasing rCBF values indicated tumor progression. The findings were confirmed by 1 H MRS, SI and subsequent follow-up. The ASL techniques ITS-FAIR and Q2TIPS are able to monitor changes of rCBF in irradiated brain metastases. The two cases imply a possible role for ASL-MR perfusion imaging and 1 H MR spectroscopy in differentiating radiation effects from tumor progression. (orig.) [de
Demand-side management and demand response in the Ontario energy sectors
International Nuclear Information System (INIS)
2003-01-01
In June 2003, the Ontario Energy Board was asked by the Minister of Energy to identify and review options for the delivery of demand-side management (DSM) and demand response (DR) activities within the electricity sector, by consulting with stakeholders. The role of local distribution company (distributor) in such activities was also to be determined. The objective was to balance implementation costs with the benefits to consumers and the entire system. The preliminary research and ideas were presented in this discussion paper. Definitions of both DSM and DR were provided, followed by an overview of economic theory and competitive markets. The framework for discussion was presented, along with a list of issues and other considerations. A spectrum of potential approaches to a DSM and DR framework was included and jurisdictional examples provided. A brief overview of the concept of load aggregation was presented and the next steps for consultations were outlined. 30 refs., 7 tabs
Markowski, V P; Zareba, G; Stern, S; Cox, C; Weiss, B
2001-06-01
Pregnant Holtzman rats were exposed to a single oral dose of 0, 20, 60, or 180 ng/kg 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) on the 18th day of gestation. Their adult female offspring were trained to respond on a lever for brief opportunities to run in specially designed running wheels. Once they had begun responding on a fixed-ratio 1 (FR1) schedule of reinforcement, the fixed-ratio requirement for lever pressing was increased at five-session intervals to values of FR2, FR5, FR10, FR20, and FR30. We examined vaginal cytology after each behavior session to track estrous cyclicity. Under each of the FR values, perinatal TCDD exposure produced a significant dose-related reduction in the number of earned opportunities to run, the lever response rate, and the total number of revolutions in the wheel. Estrous cyclicity was not affected. Because of the consistent dose-response relationship at all FR values, we used the behavioral data to calculate benchmark doses based on displacements from modeled zero-dose performance of 1% (ED(01)) and 10% (ED(10)), as determined by a quadratic fit to the dose-response function. The mean ED(10) benchmark dose for earned run opportunities was 10.13 ng/kg with a 95% lower bound of 5.77 ng/kg. The corresponding ED(01) was 0.98 ng/kg with a 95% lower bound of 0.83 ng/kg. The mean ED(10) for total wheel revolutions was calculated as 7.32 ng/kg with a 95% lower bound of 5.41 ng/kg. The corresponding ED(01) was 0.71 ng/kg with a 95% lower bound of 0.60. These values should be viewed from the perspective of current human body burdens, whose average value, based on TCDD toxic equivalents, has been calculated as 13 ng/kg.
Zhang, Shengjian; Qian, Xiaoqing; Zhang, Linlin; Peng, Weijun; Chen, Yu
2015-04-01
The construction of intelligent stimuli-responsive nanosystems can substantially improve the sensitivity/resolution/specificity of diagnostic imaging and enhance the therapeutic efficiency of chemotherapy for cancer treatment. This work reports on a generic construction strategy to achieve a multiple stimuli-responsive theranostic system for cancer simply by optimizing the chemical compositions of inorganic nanoplatforms to avoid the tedious and complicated synthetic procedure for traditional organic or organic/inorganic nanosystems. Based on the ``breaking up'' nature of manganese oxides and specific features of the carbonaceous framework to interact with aromatic drug molecules, manganese oxide nanoparticles were elaborately integrated into hollow mesoporous carbon nanocapsules by a simple in situ framework redox strategy to realize concurrent pH-sensitive T1-weighted magnetic resonance imaging (MRI) and pH-/HIFU-responsive on-demand drug release. The ultrasensitive disease-triggered MRI performance has been successfully demonstrated by a 52.5-fold increase of longitudinal relaxivity (r1 = 10.5 mM-1 s-1) and on nude mice 4T1 xenograft. The pH- and HIFU-triggered doxorubicin release and enhanced therapeutic outcome against multidrug resistance of cancer cells were systematically confirmed. In particular, the fabricated inorganic composite nanocapsules were found to feature unique biological behaviours, such as antimetastasis effect, extremely low hemolysis against red blood cells and high in vivo histocompatibility. This report on the successful construction of a pure inorganic nanosystem with multiple stimuli-responsivenesses may pave the way to new methods for the development of intelligent nanofamilies for cancer therapy.The construction of intelligent stimuli-responsive nanosystems can substantially improve the sensitivity/resolution/specificity of diagnostic imaging and enhance the therapeutic efficiency of chemotherapy for cancer treatment. This work reports
Prediction Models for Dynamic Demand Response
Energy Technology Data Exchange (ETDEWEB)
Aman, Saima; Frincu, Marc; Chelmis, Charalampos; Noor, Muhammad; Simmhan, Yogesh; Prasanna, Viktor K.
2015-11-02
As Smart Grids move closer to dynamic curtailment programs, Demand Response (DR) events will become necessary not only on fixed time intervals and weekdays predetermined by static policies, but also during changing decision periods and weekends to react to real-time demand signals. Unique challenges arise in this context vis-a-vis demand prediction and curtailment estimation and the transformation of such tasks into an automated, efficient dynamic demand response (D2R) process. While existing work has concentrated on increasing the accuracy of prediction models for DR, there is a lack of studies for prediction models for D2R, which we address in this paper. Our first contribution is the formal definition of D2R, and the description of its challenges and requirements. Our second contribution is a feasibility analysis of very-short-term prediction of electricity consumption for D2R over a diverse, large-scale dataset that includes both small residential customers and large buildings. Our third, and major contribution is a set of insights into the predictability of electricity consumption in the context of D2R. Specifically, we focus on prediction models that can operate at a very small data granularity (here 15-min intervals), for both weekdays and weekends - all conditions that characterize scenarios for D2R. We find that short-term time series and simple averaging models used by Independent Service Operators and utilities achieve superior prediction accuracy. We also observe that workdays are more predictable than weekends and holiday. Also, smaller customers have large variation in consumption and are less predictable than larger buildings. Key implications of our findings are that better models are required for small customers and for non-workdays, both of which are critical for D2R. Also, prediction models require just few days’ worth of data indicating that small amounts of
Semiautomated spleen volumetry with diffusion-weighted MR imaging.
Lee, Jeongjin; Kim, Kyoung Won; Lee, Ho; Lee, So Jung; Choi, Sanghyun; Jeong, Woo Kyoung; Kye, Heewon; Song, Gi-Won; Hwang, Shin; Lee, Sung-Gyu
2012-07-01
In this article, we determined the relative accuracy of semiautomated spleen volumetry with diffusion-weighted (DW) MR images compared to standard manual volumetry with DW-MR or CT images. Semiautomated spleen volumetry using simple thresholding followed by 3D and 2D connected component analysis was performed with DW-MR images. Manual spleen volumetry was performed on DW-MR and CT images. In this study, 35 potential live liver donor candidates were included. Semiautomated volumetry results were highly correlated with manual volumetry results using DW-MR (r = 0.99; P volumetry was significantly shorter compared to that of manual volumetry with DW-MR (P volumetry with DW-MR images can be performed rapidly and accurately when compared with standard manual volumetry. Copyright © 2011 Wiley Periodicals, Inc.
MR and angiography: Evaluation of the hemodynamics of portal hypertension
International Nuclear Information System (INIS)
Torres, W.E.; Gaylord, G.M.; Whitmire, L.; Chuang, V.P.; Bernardino, M.E.
1986-01-01
Forty-two MR imaging examinations and angiographic procedures in 38 patients with portal hypertension were compared for how well the images depicted portal perfusion and direction of flow, portal vein thrombosis, and the presence and type of shunt. Thirty-three MR imaging studies indicated grade I or II portal flow. In 29 cases portal flow was grade I or II by angiography; in the remaining cases the flow was grade IV. In a total of eight cases portal flow was grade IV by angiography, but none appeared to be grade IV on MR imaging. Both MR imaging and angiography detected portal vein thrombosis (41 of 42 cases). MR imaging and angiography agreed as to whether a shunt was present or absent, and patent or occluded (41 of 42 cases). Currently, MR imaging is an unsatisfactory modality by which to grade portal flow. MR imaging does depict portal vein thrombosis well, and can be used to determine patency of surgical shunts
A Dynamic Market Mechanism for Markets with Shiftable Demand Response
DEFF Research Database (Denmark)
Hansen, Jacob; Knudsen, Jesper Viese; Kiani, Arman
2014-01-01
renewables, this mechanism accommodates both consumers with a shiftable Demand Response and an adjustable Demand Response. The overall market mechanism is evaluated in a Day Ahead Market and is shown in a numerical example to result in a reduction of the cost of electricity for the consumer, as well......In this paper, we propose a dynamic market mechanism that converges to the desired market equilibrium. Both locational marginal prices and the schedules for generation and consumption are determined through a negotiation process between the key market players. In addition to incorporating...
Evaluation of Representative Smart Grid Investment Project Technologies: Demand Response
Energy Technology Data Exchange (ETDEWEB)
Fuller, Jason C.; Prakash Kumar, Nirupama; Bonebrake, Christopher A.
2012-02-14
This document is one of a series of reports estimating the benefits of deploying technologies similar to those implemented on the Smart Grid Investment Grant (SGIG) projects. Four technical reports cover the various types of technologies deployed in the SGIG projects, distribution automation, demand response, energy storage, and renewables integration. A fifth report in the series examines the benefits of deploying these technologies on a national level. This technical report examines the impacts of a limited number of demand response technologies and implementations deployed in the SGIG projects.
Energy Technology Data Exchange (ETDEWEB)
Overduin, Christiaan G.; Jenniskens, Sjoerd F.M.; Bomers, Joyce G.R. [Radboud University Medical Center, Department of Radiology and Nuclear Medicine, Nijmegen (Netherlands); Sedelaar, J.P.M. [Radboud University Medical Center, Department of Urology, Nijmegen (Netherlands); Fuetterer, Jurgen J. [Radboud University Medical Center, Department of Radiology and Nuclear Medicine, Nijmegen (Netherlands); University of Twente, MIRA Institute for Biomedical Engineering and Technical Medicine, Enschede (Netherlands)
2017-11-15
To evaluate iceball margins after magnetic resonance (MR)-guided focal salvage prostate cryoablation and determine the correlation with local outcome. A retrospective review was performed on 47 patients that underwent percutaneous MR-guided focal cryoablation for biopsy-proven locally recurrent prostate cancer after primary radiotherapy. Preprocedural diagnostic and intraprocedural MR images were analysed to derive three-directional iceball margins. Local tumour progression after cryoablation was defined as evident tumour recurrence on follow-up MRI, positive MR-guided biopsy or biochemical failure without radiological evidence of metastatic disease. Mean iceball margins were 8.9 mm (range -7.1 to 16.2), 10.1 mm (range 1.1-20.3) and 12.5 mm (range -1.5 to 22.2) in anteroposterior, left-right and craniocaudal direction respectively. Iceball margins were significantly smaller for tumours that were larger (P =.008) or located in the posterior gland (P =.047). Significantly improved local progression-free survival at 1 year post focal cryoablation was seen between patients with iceball margin >10 mm (100%), 5-10 mm (84%) and <5 mm (15%) (P <.001). Iceball margins appear to correlate with local outcome following MR-guided focal salvage prostate cryoablation. Our initial data suggest that freezing should be applied at minimum 5 mm beyond the border of an MR-visible recurrent prostate tumour for successful ablation, with a wider margin appearing desirable. (orig.)
International Nuclear Information System (INIS)
Liberman, Gilad; Louzoun, Yoram; Aizenstein, Orna; Blumenthal, Deborah T.; Bokstein, Felix; Palmon, Mika; Corn, Benjamin W.; Ben Bashat, Dafna
2013-01-01
Background: Current methods for evaluation of treatment response in glioblastoma are inaccurate, limited and time-consuming. This study aimed to develop a multi-modal MRI automatic classification method to improve accuracy and efficiency of treatment response assessment in patients with recurrent glioblastoma (GB). Materials and methods: A modification of the k-Nearest-Neighbors (kNN) classification method was developed and applied to 59 longitudinal MR data sets of 13 patients with recurrent GB undergoing bevacizumab (anti-angiogenic) therapy. Changes in the enhancing tumor volume were assessed using the proposed method and compared with Macdonald's criteria and with manual volumetric measurements. The edema-like area was further subclassified into peri- and non-peri-tumoral edema, using both the kNN method and an unsupervised method, to monitor longitudinal changes. Results: Automatic classification using the modified kNN method was applicable in all scans, even when the tumors were infiltrative with unclear borders. The enhancing tumor volume obtained using the automatic method was highly correlated with manual measurements (N = 33, r = 0.96, p < 0.0001), while standard radiographic assessment based on Macdonald's criteria matched manual delineation and automatic results in only 68% of cases. A graded pattern of tumor infiltration within the edema-like area was revealed by both automatic methods, showing high agreement. All classification results were confirmed by a senior neuro-radiologist and validated using MR spectroscopy. Conclusion: This study emphasizes the important role of automatic tools based on a multi-modal view of the tissue in monitoring therapy response in patients with high grade gliomas specifically under anti-angiogenic therapy
Empirical analysis of the spot market implications of price-responsive demand
International Nuclear Information System (INIS)
Siddiqui, A.S.
2006-01-01
Although electricity is theoretically an inelastic good in the short term, the steep slope of the supply stack implies that even modest response by demand could translate into reduced capacity requirements and significant price decreases. This article examined the effect of price-responsive demand strategies in an actual deregulated electricity industry. Auction data from the New York Independent System Operator (NYISO) day-ahead electricity market were used to form supply stacks for various zones. A simple linear demand function was used to determine the effect of price responsiveness on equilibrium spot market price and consumption. The aim was to quantify the benefits from the pricing protocol and to determine whether modest levels of price elasticity can significantly lower prices and consumption. Market-clearing prices and quantities were estimated using various supply curves in order to quantify the responsiveness necessary to achieve given price reductions. Price response was induced in the demand curve by varying its slope. Estimates were then used to estimate the average level of slope needed to reduce the average market-clearing price during the year by a certain percentage. Results showed that an average slope of -50.04 was necessary for prices to be reduced by 25 per cent. Results also showed that necessary price responses can be ascertained for any desired reduction in the market-clearing price or quantity. Although price responsiveness unambiguously reduces the spot market price and quantity, its effect on the forward price is not yet clear. It was concluded that a separate analysis of peak hours may reveal the effectiveness of enhanced price response. 8 refs., 1 tab., 8 figs
International Nuclear Information System (INIS)
Centolella, Paul
2010-01-01
A number of states and utilities are pursuing demand response based on dynamic and time-differentiated retail prices and utility investments in Advanced Metering Infrastructure (AMI), often as part of Smart Grid initiatives. These developments could produce large amounts of Price Responsive Demand, demand that predictably responds to changes in wholesale prices. Price Responsive Demand could provide significant reliability and economic benefits. However, existing RTO tariffs present potential barriers to the development of Price Responsive Demand. Effectively integrating Price Responsive Demand into RTO markets and operations will require changes in demand forecasting, scarcity pricing reform, synchronization of scarcity pricing with capacity markets, tracking voluntary hedging by price responsive loads, and a non-discriminatory approach in curtailments in capacity emergencies. The article describes changes in RTO policies and systems needed incorporate Price Responsive Demand. (author)
A Distributed Intelligent Automated Demand Response Building Management System
Energy Technology Data Exchange (ETDEWEB)
Auslander, David [Univ. of California, Berkeley, CA (United States); Culler, David [Univ. of California, Berkeley, CA (United States); Wright, Paul [Univ. of California, Berkeley, CA (United States); Lu, Yan [Siemens Corporate Research Inc., Princeton, NJ (United States); Piette, Mary [Univ. of California, Berkeley, CA (United States)
2013-03-31
The goal of the 2.5 year Distributed Intelligent Automated Demand Response (DIADR) project was to reduce peak electricity load of Sutardja Dai Hall at UC Berkeley by 30% while maintaining a healthy, comfortable, and productive environment for the occupants. We sought to bring together both central and distributed control to provide “deep” demand response1 at the appliance level of the building as well as typical lighting and HVAC applications. This project brought together Siemens Corporate Research and Siemens Building Technology (the building has a Siemens Apogee Building Automation System (BAS)), Lawrence Berkeley National Laboratory (leveraging their Open Automated Demand Response (openADR), Auto-Demand Response, and building modeling expertise), and UC Berkeley (related demand response research including distributed wireless control, and grid-to-building gateway development). Sutardja Dai Hall houses the Center for Information Technology Research in the Interest of Society (CITRIS), which fosters collaboration among industry and faculty and students of four UC campuses (Berkeley, Davis, Merced, and Santa Cruz). The 141,000 square foot building, occupied in 2009, includes typical office spaces and a nanofabrication laboratory. Heating is provided by a district heating system (steam from campus as a byproduct of the campus cogeneration plant); cooling is provided by one of two chillers: a more typical electric centrifugal compressor chiller designed for the cool months (Nov- March) and a steam absorption chiller for use in the warm months (April-October). Lighting in the open office areas is provided by direct-indirect luminaries with Building Management System-based scheduling for open areas, and occupancy sensors for private office areas. For the purposes of this project, we focused on the office portion of the building. Annual energy consumption is approximately 8053 MWh; the office portion is estimated as 1924 MWh. The maximum peak load
Aghaei, Faranak; Tan, Maxine; Hollingsworth, Alan B.; Zheng, Bin; Cheng, Samuel
2016-03-01
Dynamic contrast-enhanced breast magnetic resonance imaging (DCE-MRI) has been used increasingly in breast cancer diagnosis and assessment of cancer treatment efficacy. In this study, we applied a computer-aided detection (CAD) scheme to automatically segment breast regions depicting on MR images and used the kinetic image features computed from the global breast MR images acquired before neoadjuvant chemotherapy to build a new quantitative model to predict response of the breast cancer patients to the chemotherapy. To assess performance and robustness of this new prediction model, an image dataset involving breast MR images acquired from 151 cancer patients before undergoing neoadjuvant chemotherapy was retrospectively assembled and used. Among them, 63 patients had "complete response" (CR) to chemotherapy in which the enhanced contrast levels inside the tumor volume (pre-treatment) was reduced to the level as the normal enhanced background parenchymal tissues (post-treatment), while 88 patients had "partially response" (PR) in which the high contrast enhancement remain in the tumor regions after treatment. We performed the studies to analyze the correlation among the 22 global kinetic image features and then select a set of 4 optimal features. Applying an artificial neural network trained with the fusion of these 4 kinetic image features, the prediction model yielded an area under ROC curve (AUC) of 0.83+/-0.04. This study demonstrated that by avoiding tumor segmentation, which is often difficult and unreliable, fusion of kinetic image features computed from global breast MR images without tumor segmentation can also generate a useful clinical marker in predicting efficacy of chemotherapy.
Characterization of a prototype MR-compatible Delta4 QA system in a 1.5 tesla MR-linac
de Vries, J. H. W.; Seravalli, E.; Houweling, A. C.; Woodings, S. J.; van Rooij, R.; Wolthaus, J. W. H.; Lagendijk, J. J. W.; Raaymakers, B. W.
2018-01-01
To perform patient plan quality assurance (QA) on a newly installed MR-linac (MRL) it is necessary to have an MR-compatible QA device. An MR compatible device (MR-Delta4) has been developed together with Scandidos AB (Uppsala, Sweden). The basic characteristics of the detector response, such as short-term reproducibility, dose linearity, field size dependency, dose rate dependency, dose-per-pulse dependency and angular dependency, were investigated for the clinical Delta4-PT as well as for the MR compatible version. All tests were performed with both devices on a conventional linac and the MR compatible device was tested on the MRL as well. No statistically significant differences were found in the short-term reproducibility (tesla magnetic field of the Elekta MR-linac
International Nuclear Information System (INIS)
Jang, Jin Hee; Kim, Bum Soo; KIm, Bom Yi; Choi, Hyun Seok; Jung, So Lyung; Ahn, Kook Jin; Sung, Ji Kyeong
2015-01-01
To evaluate the image characteristics of subtraction magnetic resonance venography (SMRV) from time-resolved contrast-enhanced MR angiography (TRMRA) compared with phase-contrast MR venography (PCMRV) and single-phase contrast-enhanced MR venography (CEMRV). Twenty-one patients who underwent brain MR venography (MRV) using standard protocols (PCMRV, CEMRV, and TRMRA) were included. SMRV was made by subtracting the arterial phase data from the venous phase data in TRMRA. Co-registration and subtraction of the two volume data was done using commercially available software. Image quality and the degree of arterial contamination of the three MRVs were compared. In the three MRVs, 19 pre-defined venous structures (14 dural sinuses and 5 cerebral veins) were evaluated. The signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) of the three MRVs were also compared. Single-phase contrast-enhanced MR venography showed better image quality (median score 4 in both reviewers) than did the other two MRVs (p < 0.001), whereas SMRV (median score 3 in both reviewers) and PCMRV (median score 3 in both reviewers) had similar image quality (p ≥ 0.951). SMRV (median score 0 in both reviewers) suppressed arterial signal better than did the other MRVs (median score 1 in CEMRV, median score 2 in PCMRV, both reviewers) (p < 0.001). The dural sinus score of SMRV (median and interquartile range [IQR] 48, 43-50 for reviewer 1, 47, 43-49 for reviewer 2) was significantly higher than for PCMRV (median and IQR 31, 25-34 for reviewer 1, 30, 23-32 for reviewer 2) (p < 0.01) and did not differ from that of CEMRV (median and IQR 50, 47-52 for reviewer 1, 49, 45-51 for reviewer 2) (p = 0.146 in reviewer 1 and 0.123 in reviewer 2). The SNR and CNR of SMRV (median and IQR 104.5, 83.1-121.2 and 104.1, 74.9-120.5, respectively) were between those of CEMRV (median and IQR 150.3, 111-182.6 and 148.4, 108-178.2) and PCMRV (median and IQR 59.4, 49.2-74.9 and 53.6, 43.8-69.2). Subtraction magnetic
Smart Grid as advanced technology enabler of demand response
Energy Technology Data Exchange (ETDEWEB)
Gellings, C.W.; Samotyj, M. [Electric Power Research Institute (EPRI), Palo Alto, CA (United States)
2013-11-15
Numerous papers and articles presented worldwide at different conferences and meetings have already covered the goals, objectives, architecture, and business plans of Smart Grid. The number of electric utilities worldwide has followed up with demonstration and deployment efforts. Our initial assumptions and expectations of Smart Grid functionality have been confirmed. We have indicated that Smart Grid will fulfill the following goals: enhance customer service, improve operational efficiency, enhance demand response and load control, transform customer energy use behavior, and support new utility business models. For the purpose of this paper, we shall focus on which of those above-mentioned Smart Grid functionalities are going to facilitate the ever-growing need for enhanced demand response and load control.
Lee-Felker, Stephanie A; Tekchandani, Leena; Thomas, Mariam; Gupta, Esha; Andrews-Tang, Denise; Roth, Antoinette; Sayre, James; Rahbar, Guita
2017-11-01
Purpose To compare the diagnostic performances of contrast material-enhanced spectral mammography and breast magnetic resonance (MR) imaging in the detection of index and secondary cancers in women with newly diagnosed breast cancer by using histologic or imaging follow-up as the standard of reference. Materials and Methods This institutional review board-approved, HIPAA-compliant, retrospective study included 52 women who underwent breast MR imaging and contrast-enhanced spectral mammography for newly diagnosed unilateral breast cancer between March 2014 and October 2015. Of those 52 patients, 46 were referred for contrast-enhanced spectral mammography and targeted ultrasonography because they had additional suspicious lesions at MR imaging. In six of the 52 patients, breast cancer had been diagnosed at an outside institution. These patients were referred for contrast-enhanced spectral mammography and targeted US as part of diagnostic imaging. Images from contrast-enhanced spectral mammography were analyzed by two fellowship-trained breast imagers with 2.5 years of experience with contrast-enhanced spectral mammography. Sensitivity, specificity, positive predictive value (PPV), and negative predictive value were calculated for both imaging modalities and compared by using the Bennett statistic. Results Fifty-two women with 120 breast lesions were included for analysis (mean age, 50 years; range, 29-73 years). Contrast-enhanced spectral mammography had similar sensitivity to MR imaging (94% [66 of 70 lesions] vs 99% [69 of 70 lesions]), a significantly higher PPV than MR imaging (93% [66 of 71 lesions] vs 60% [69 of 115 lesions]), and fewer false-positive findings than MR imaging (five vs 45) (P contrast-enhanced spectral mammography depicted 11 of the 11 secondary cancers (100%) and MR imaging depicted 10 (91%). Conclusion Contrast-enhanced spectral mammography is potentially as sensitive as MR imaging in the evaluation of extent of disease in newly diagnosed
Multiparametric MR assessment of pediatric brain tumors
International Nuclear Information System (INIS)
Tzika, A.A.; Astrakas, L.G.; Zarifi, M.K.; Petridou, N.; Young-Poussaint, T.; Goumnerova, L.; Black, P.McL.; Zurakowski, D.; Anthony, D.C.
2003-01-01
MR assessment of pediatric brain tumors has expanded to include physiologic information related to cellular metabolites, hemodynamic and diffusion parameters. The purpose of this study was to investigate the relationship between MR and proton MR spectroscopic imaging in children with primary brain tumors. Twenty-one patients (mean age 9 years) with histologically verified brain tumors underwent conventional MR imaging, hemodynamic MR imaging (HMRI) and proton MR spectroscopic imaging (MRSI). Fourteen patients also had diffusion-weighted MR imaging (DWMRI). Metabolic indices including choline-containing compounds (Cho), total creatine (tCr) and lipids/lactate (L) were derived by proton MRSI, relative cerebral blood volume (rCBV) by HMRI, and apparent tissue water diffusion coefficients (ADC) by DWMRI. Variables were examined by linear regression and correlation as well as by ANOVA. Cho (suggestive of tumor cellularity and proliferative activity) correlated positively with rCBV, while the relationship between Cho and ADC (suggestive of cellular density) was inverse (P<0.001). The relationship between rCBV and ADC was also inverse (P=0.004). Cho and lipids (suggestive of necrosis and/or apoptosis) were not significantly correlated (P=0.51). A positive relationship was found between lipids and ADC (P=0.002). The relationships between Cho, rCBV, ADC and lipids signify that tumor physiology is influenced by the tumor's physical and chemical environment. Normalized Cho and lipids distinguished high-grade from low-grade tumors (P<0.05). Multiparametric MR imaging using MRSI, HMRI and DWMRI enhances assessment of brain tumors in children and improves our understanding of tumor physiology while promising to distinguish higher- from lower-malignancy tumors, a distinction that is particularly clinically important among inoperable tumors. (orig.)
7 CFR 29.1036 - Mixed Group (M).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Mixed Group (M). 29.1036 Section 29.1036 Agriculture... Type 92) § 29.1036 Mixed Group (M). This group consists of tobacco from three or more groups or two distinctly different groups which are mixed together in various combinations. [49 FR 16755, Apr. 20, 1984...
Demand response power system optimization in presence of renewable energy sources
Directory of Open Access Journals (Sweden)
Dumbrava Virgil
2017-07-01
Full Text Available This paper optimizes the price-based demand response of a large customer in a power system with stochastic production and classical fuel-supplied power plants. The implemented method of optimization, under uncertainty, is helpful to model both the utility functions for the consumers and their technical limitations. The consumers exposed to price-based demand can reduce their cost for electricity procurement by modifying their behavior, possibly shifting their consumption during the day to periods with low electricity prices. The demand is considered elastic to electricity price if the consumer is willing and capable to buy various amounts of energy at different price levels, the demand function being represented as purchasing bidding blocks. The demand response is seen also by the scientific literature as a possible source of the needed flexibility of modern power systems, while the flexibility of conventional generation technologies is restricted by technical constraints, such as ramp rates. This paper shows how wind power generation affects short term operation of the electricity system. Fluctuations in the amount of wind power fed into the grid require, without storage capacities, compensating changes in the output of flexible generators or in the consumers’ behavior. In the presented case study, we show the minimization of the overall costs in presence of stochastic wind power production. For highlighting the variability degree of production from renewable sources, four scenarios of production were formulated, with different probabilities of occurrence. The contribution brought by the paper is represented by the optimization model for demand-response of a large customer in a power system with fossil fueled generators and intermittent renewable energy sources. The consumer can reduce the power system costs by modifying his demand. The demand function is represented as purchasing bidding blocks for the possible price forecasted realizations
The utility of diffusion-weighted MR imaging in cervical cancer
International Nuclear Information System (INIS)
Chen Jianyu; Zhang Yun; Liang Biling; Yang Zehong
2010-01-01
Purpose: To investigate the value of diffusion-weighted MR imaging (DWI) in detection of cervical cancer, and to determine the diagnostic accuracy of apparent diffusion coefficient (ADC) values for evaluating cervical cancer before and after chemoradiotherapy. Materials and methods: Thirty-three patients with cervical squamous carcinoma and 20 patients with other pelvic abnormalities underwent diffusion-weighted imaging (DWI) in addition to routine MR imaging. The ADC values of normal cervical tissue, cervical area before and after chemoradiotherapy were measured and compared. Receiver operating characteristic (ROC) analysis was employed to investigate whether ADC values could help in discrimination among normal cervical tissue, cervical cancer before and after therapy, and to obtain the optimal ADC threshold value. Results: Cervical cancer lesion demonstrated obviously hyperintensity on DWI images. The mean ADC value of cervical carcinoma (1.110 ± 0.175 x 10 -3 mm 2 /s) was significantly lower than that of normal cervical tissue (1.593 ± 0.151 x 10 -3 mm 2 /s) (P -3 mm 2 /s) was significantly higher than that before therapy (1.013 ± 0.094 x 10 -3 mm 2 /s) (P -3 mm 2 /s, between cervical area before and after therapy was 1.255 x 10 -3 mm 2 /s, between normal cervical tissue and cervical area after therapy was 1.525 x 10 -3 mm 2 /s. The sensitivity and specificity were 100% and 84.8%, 95.5% and 100%, 70% and 81.8%, respectively. Conclusion: DWI can be applied for the detection of cervical cancer because of its superior disease contrast with normal tissue. The measurement of the ADC values can be a useful tool to monitor the response to therapy for cervical carcinoma.
International Nuclear Information System (INIS)
Faria, Pedro; Vale, Zita; Baptista, Jose
2015-01-01
Highlights: • Consumption reduction and/or shift to several periods before and after. • Optimization problem for scheduling of demand response and distributed generation. • Minimization of the Virtual Power Player operation (remuneration) costs. • Demand response can be efficient to meet distributed generation shortages. • Consumers benefit with the remuneration of the participation in demand response. - Abstract: Demand response concept has been gaining increasing importance while the success of several recent implementations makes this resource benefits unquestionable. This happens in a power systems operation environment that also considers an intensive use of distributed generation. However, more adequate approaches and models are needed in order to address the small size consumers and producers aggregation, while taking into account these resources goals. The present paper focuses on the demand response programs and distributed generation resources management by a Virtual Power Player that optimally aims to minimize its operation costs taking the consumption shifting constraints into account. The impact of the consumption shifting in the distributed generation resources schedule is also considered. The methodology is applied to three scenarios based on 218 consumers and 4 types of distributed generation, in a time frame of 96 periods
Influential Factors for Accurate Load Prediction in a Demand Response Context
DEFF Research Database (Denmark)
Wollsen, Morten Gill; Kjærgaard, Mikkel Baun; Jørgensen, Bo Nørregaard
2016-01-01
Accurate prediction of a buildings electricity load is crucial to respond to Demand Response events with an assessable load change. However, previous work on load prediction lacks to consider a wider set of possible data sources. In this paper we study different data scenarios to map the influence....... Next, the time of day that is being predicted greatly influence the prediction which is related to the weather pattern. By presenting these results we hope to improve the modeling of building loads and algorithms for Demand Response planning.......Accurate prediction of a buildings electricity load is crucial to respond to Demand Response events with an assessable load change. However, previous work on load prediction lacks to consider a wider set of possible data sources. In this paper we study different data scenarios to map the influence...
Lahrsow, Maximilian; Albrecht, Moritz H; Bickford, Matthew W; Vogl, Thomas J
2017-06-01
To use absolute pretreatment apparent diffusion coefficients (ADC) derived from diffusion-weighted MR imaging (DWI) to predict response to repetitive cTACE for unresectable liver metastases of colorectal carcinoma (CRLM) at 1 and 3 months after start of treatment. Fifty-five metastases in 34 patients were examined with DWI prior to treatment and 1 month after initial cTACE. Treatment was performed in 4-week intervals. Response was evaluated at 1 and 3 months after start of therapy. Metastases showing a decrease of ≥30% in axial diameter were classified as responding lesions. One month after initial cTACE, seven lesions showed early response. There was no significant difference in absolute pretreatment ADC values between responding and non-responding lesions (p = 0.94). Three months after initial cTACE, 17 metastases showed response. There was a significant difference (p = 0.021) between absolute pretreatment ADC values of lesions showing response (median 1.08 × 10 -3 mm 2 /s) and no response (median 1.30 × 10 -3 mm 2 /s). Pretreatment ADC showed fair diagnostic value to predict response (AUC 0.7). Lesions showing response at 3 months also revealed a significant increase in ADC between measurements before treatment and at one month after initial cTACE (p < 0.001). Applying an increase in ADC of 12.17%, response at 3 months after initial cTACE could be predicted with a sensitivity and specificity of 77 and 74%, respectively (AUC 0.817). Furthermore, there was a strong and significant correlation (r = 0.651, p < 0.001) between percentage change in size after third cTACE and percentage change in ADC. In patients with CRLM, ADC measurements are potential biomarkers for assessing response to cTACE.
Directory of Open Access Journals (Sweden)
Angelo Ruediger Pisani Martini
2016-05-01
Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2016v18n2p155 The aim of the present study was to evaluate the effects of human head hair on performance and thermoregulatory responses during 10-km outdoor running in healthy men. Twelve healthy males (29.5 ± 3.7 years, 174.9 ± 4.3 cm, 72.7 ± 3.2 kg and VO2max 44.6 ± 3.4 ml.kg-1.min-1 participated in two self-paced outdoor 10-km running trials separated by 7 days: 1 HAIR, subjects ran with their natural head hair; 2 NOHAIR, subjects ran after their hair had been totally shaved. Average running velocity was calculated from each 2-km running time. Rectal temperature, heart rate and physiological strain index were measured before and after the 10-km runs and at the end of each 2 km. The rate of heat storage was measured every 2 km. The environmental stress (WBGT was measured every 10 min. The running velocity (10.9 ± 1 and 10.9 ± 1.1 km.h-1, heart rate (183 ± 10 and 180 ± 12 bpm, rectal temperature (38.82 ± 0.29 and 38.81 ± 0.49oC, physiological strain index (9 ± 1 and 9 ± 1, or heat storage rate (71.9 ± 64.1 and 80.7 ± 56.7 W.m-1 did not differ between the HAIR and NOHAIR conditions, respectively (p>0.05. There was no difference in WBGT between the HAIR and NOHAIR conditions (24.0 ± 1.4 and 23.2 ± 1.5ºC, respectively; p=0.10. The results suggest that shaved head hair does not alter running velocity or thermoregulatory responses during 10-km running under the sun.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Flue-cured. 29.1019 Section 29.1019 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... tobacco; or tobacco cured by some other process which accomplishes the same results. [42 FR 21092, Apr. 25...
Basic MR sequence parameters systematically bias automated brain volume estimation
International Nuclear Information System (INIS)
Haller, Sven; Falkovskiy, Pavel; Roche, Alexis; Marechal, Benedicte; Meuli, Reto; Thiran, Jean-Philippe; Krueger, Gunnar; Lovblad, Karl-Olof; Kober, Tobias
2016-01-01
Automated brain MRI morphometry, including hippocampal volumetry for Alzheimer disease, is increasingly recognized as a biomarker. Consequently, a rapidly increasing number of software tools have become available. We tested whether modifications of simple MR protocol parameters typically used in clinical routine systematically bias automated brain MRI segmentation results. The study was approved by the local ethical committee and included 20 consecutive patients (13 females, mean age 75.8 ± 13.8 years) undergoing clinical brain MRI at 1.5 T for workup of cognitive decline. We compared three 3D T1 magnetization prepared rapid gradient echo (MPRAGE) sequences with the following parameter settings: ADNI-2 1.2 mm iso-voxel, no image filtering, LOCAL- 1.0 mm iso-voxel no image filtering, LOCAL+ 1.0 mm iso-voxel with image edge enhancement. Brain segmentation was performed by two different and established analysis tools, FreeSurfer and MorphoBox, using standard parameters. Spatial resolution (1.0 versus 1.2 mm iso-voxel) and modification in contrast resulted in relative estimated volume difference of up to 4.28 % (p < 0.001) in cortical gray matter and 4.16 % (p < 0.01) in hippocampus. Image data filtering resulted in estimated volume difference of up to 5.48 % (p < 0.05) in cortical gray matter. A simple change of MR parameters, notably spatial resolution, contrast, and filtering, may systematically bias results of automated brain MRI morphometry of up to 4-5 %. This is in the same range as early disease-related brain volume alterations, for example, in Alzheimer disease. Automated brain segmentation software packages should therefore require strict MR parameter selection or include compensatory algorithms to avoid MR parameter-related bias of brain morphometry results. (orig.)
Basic MR sequence parameters systematically bias automated brain volume estimation
Energy Technology Data Exchange (ETDEWEB)
Haller, Sven [University of Geneva, Faculty of Medicine, Geneva (Switzerland); Affidea Centre de Diagnostique Radiologique de Carouge CDRC, Geneva (Switzerland); Falkovskiy, Pavel; Roche, Alexis; Marechal, Benedicte [Siemens Healthcare HC CEMEA SUI DI BM PI, Advanced Clinical Imaging Technology, Lausanne (Switzerland); University Hospital (CHUV), Department of Radiology, Lausanne (Switzerland); Meuli, Reto [University Hospital (CHUV), Department of Radiology, Lausanne (Switzerland); Thiran, Jean-Philippe [LTS5, Ecole Polytechnique Federale de Lausanne, Lausanne (Switzerland); Krueger, Gunnar [Siemens Medical Solutions USA, Inc., Boston, MA (United States); Lovblad, Karl-Olof [University of Geneva, Faculty of Medicine, Geneva (Switzerland); University Hospitals of Geneva, Geneva (Switzerland); Kober, Tobias [Siemens Healthcare HC CEMEA SUI DI BM PI, Advanced Clinical Imaging Technology, Lausanne (Switzerland); LTS5, Ecole Polytechnique Federale de Lausanne, Lausanne (Switzerland)
2016-11-15
Automated brain MRI morphometry, including hippocampal volumetry for Alzheimer disease, is increasingly recognized as a biomarker. Consequently, a rapidly increasing number of software tools have become available. We tested whether modifications of simple MR protocol parameters typically used in clinical routine systematically bias automated brain MRI segmentation results. The study was approved by the local ethical committee and included 20 consecutive patients (13 females, mean age 75.8 ± 13.8 years) undergoing clinical brain MRI at 1.5 T for workup of cognitive decline. We compared three 3D T1 magnetization prepared rapid gradient echo (MPRAGE) sequences with the following parameter settings: ADNI-2 1.2 mm iso-voxel, no image filtering, LOCAL- 1.0 mm iso-voxel no image filtering, LOCAL+ 1.0 mm iso-voxel with image edge enhancement. Brain segmentation was performed by two different and established analysis tools, FreeSurfer and MorphoBox, using standard parameters. Spatial resolution (1.0 versus 1.2 mm iso-voxel) and modification in contrast resulted in relative estimated volume difference of up to 4.28 % (p < 0.001) in cortical gray matter and 4.16 % (p < 0.01) in hippocampus. Image data filtering resulted in estimated volume difference of up to 5.48 % (p < 0.05) in cortical gray matter. A simple change of MR parameters, notably spatial resolution, contrast, and filtering, may systematically bias results of automated brain MRI morphometry of up to 4-5 %. This is in the same range as early disease-related brain volume alterations, for example, in Alzheimer disease. Automated brain segmentation software packages should therefore require strict MR parameter selection or include compensatory algorithms to avoid MR parameter-related bias of brain morphometry results. (orig.)
International Nuclear Information System (INIS)
Zhang Qingbo; Feng Xiaoyuan; Liang Zonghui; Chen Shuan
2008-01-01
Objective: To evaluate the feasibility of MR PWI in judging maturity and variability of tumor vasculature in gliomas in rats. Methods: Twenty male SD rats were randomly assigned to tumor group and control group. Four weeks after implantation of C6 glioma cells in the brains of tumor group and injection of saline in the brains of control group, all rats were examined using MR PWI before and after inhalation of a mixture of 10% CO2 and 90% air. PaCO 2 and blood pH values of rats were monitored. Relative cerebral blood volume (rCBV) and relative cerebral blood flow(rCBF) values of tumors and normal brain tissue were measured. Brain sample were examined histologically using HE and immunohistochemical staining for smooth muscle actin(SMA). The histological features of gliomas were observed and SMA positively stained vessels of each tumor were counted manually using a light microscope. Perfusion data and pathological findings were analyzed statistically with SPSS for Windows. Results: PaCO 2 increased significantly [from(4.69±0.62)kPa to (7.62±0.81) kPa in tumor group and from (4.67±0.51) kPa to (7.63±0.78) kPa in control group, P 0.05), while changing rate of rCBV, rCBF in normal brain tissue correlated well with number of positive SMA labeled vessels (r=0.721 and 0.525, P 2 increase in the normal brain and in the tumor. It may be a useful technique to measure maturity of tumor vessels. (authors)
Reproducibility of Quantitative Brain Imaging Using a PET-Only and a Combined PET/MR System
Directory of Open Access Journals (Sweden)
Martin L. Lassen
2017-07-01
Full Text Available The purpose of this study was to test the feasibility of migrating a quantitative brain imaging protocol from a positron emission tomography (PET-only system to an integrated PET/MR system. Potential differences in both absolute radiotracer concentration as well as in the derived kinetic parameters as a function of PET system choice have been investigated. Five healthy volunteers underwent dynamic (R-[11C]verapamil imaging on the same day using a GE-Advance (PET-only and a Siemens Biograph mMR system (PET/MR. PET-emission data were reconstructed using a transmission-based attenuation correction (AC map (PET-only, whereas a standard MR-DIXON as well as a low-dose CT AC map was applied to PET/MR emission data. Kinetic modeling based on arterial blood sampling was performed using a 1-tissue-2-rate constant compartment model, yielding kinetic parameters (K1 and k2 and distribution volume (VT. Differences for parametric values obtained in the PET-only and the PET/MR systems were analyzed using a 2-way Analysis of Variance (ANOVA. Comparison of DIXON-based AC (PET/MR with emission data derived from the PET-only system revealed average inter-system differences of −33 ± 14% (p < 0.05 for the K1 parameter and −19 ± 9% (p < 0.05 for k2. Using a CT-based AC for PET/MR resulted in slightly lower systematic differences of −16 ± 18% for K1 and −9 ± 10% for k2. The average differences in VT were −18 ± 10% (p < 0.05 for DIXON- and −8 ± 13% for CT-based AC. Significant systematic differences were observed for kinetic parameters derived from emission data obtained from PET/MR and PET-only imaging due to different standard AC methods employed. Therefore, a transfer of imaging protocols from PET-only to PET/MR systems is not straightforward without application of proper correction methods.Clinical Trial Registration:www.clinicaltrialsregister.eu, identifier 2013-001724-19
International Nuclear Information System (INIS)
Yu Risheng; Sun Jianzhong; Ding Wenhong; Xu Xiufang; Wang Zhikang
2009-01-01
Objective: To investigate the reproducibility and influencing factors of relative quantification of phosphorus metabolites with two-dimensional chemical shift imaging (2D CSI) in rabbit liver. Methods: Using 2D CSI MRS, 500 ml phosphate (NaH 2 PO 4 ) solution phantom with 0.05 mol/L concentration and one healthy rabbit were scanned 30 times respectively in one day and rescanned 30 times in the next day, and the stability of MR scanner and reproducibility of within-run and between-days in the same individual were analyzed. Each of thirty rabbits was scanned and rescanned one time respectively in different days, and the reproducibility of between-days in one group was analyzed. The data were statistically analyzed with t tests. Results: (1) Phosphate solution phantom had a good reproducibility of within-run with the coefficient variation (CV) of 4.92% and 5.12% respectively in different two days. No significant change of phosphorus metabolites was detected in between-days, which was 16.68±0.82 and 16.56± 0.85 respectively (t=0.665, P>0.05). (2) The CV of metabolites in one healthy rabbit ranged from 8.04% to 34.13%. Among the metabolites, β-ATP had the best reproducibility with the CV less than 10%. PME was 0.88±0.28 and 0.88±0.30, PDE was 4.35±0.66 and 4.35±0.66, Pi was 0.95±0.30 and 0.97±0.28, α-ATP was 5.58±0.60 and 5.61±0.61, β-ATP was 2.70±0.22 and 2.71± 0.22, γ-ATP was 2.20±0.63 and 2.18±0.44 respectively, no significant changes of metabolites were detected in between-days (P>0.05). (3) The CV of metabolites in 30 healthy rabbits ranged from 8.48% to 36.21%. Among the metabolites, β-ATP had the best reproducibility with CV less than 10%. PME was 0.84±0.30 and 0.79±0.28, PDE was 4.29±0.72 and 3.94±0.84, Pi was 0.91±0.28 and 0.92± 0.31, α-ATP was 5.65±0.66 and 5.36±0.60, β-ATP was 2.71±0.23 and 2.66±0.25, γ-ATP was 2.07±0.29 and 1.99±0.37 respectively, no significant changes of metabolites were detected in between-days (P>0
Business Model Canvas & Elevator pitch : 29-10-2013
Eelco Bakker
2013-01-01
Presentatie bij de Workshop Business Model Canvas: de bouwstenen en het gebouw van de onderneming - workshopprogramma ViB050. In het kader van het programma Teach the Teacher. Gehouden op 29-10-2013..
2010-10-29
... and Salary Surveys. Agency form number: FR 29a,b. OMB control number: 7100-0290. Frequency: FR 29a, annually; FR 29b, on occasion. Reporters: Employers considered competitors for Federal Reserve employees... Institutions Reforms, Recovery and Enforcement Act of 1989 (FIRREA) agencies \\1\\ conduct the FR 29a survey...
Sedation of children for MR or CT imaging examination using chloral hydrate
International Nuclear Information System (INIS)
Song, Jong Gi; Kim, Woo Sun; Kim, In One; Yeon, Kyung Mo; Han, Man Chung
1994-01-01
Pediatric sedation is an important factor for obtaining the images of good quality. We performed this study to analyze the efficacy of our sedation protocol using chloral hydrate. We collected prospectively 151 sedation records of children(1 day-15 years old), who were sedated with chloral hydrate for MR(n=112) or CT(n=39) studies. We initially administered 50 mg/Kg orally(n=94) or rectally(n=57) 30 minutes before the scheduled examinations, and then administered additional dose (second dose: 25-35 mg/Kg, third dose: 10-15 mg/Kg) to patients whom initial dose failed to sedate. Satisfactory sedation was achieved by initial administration in 109 patients(72%) without significant difference between oral(per oral; P. O.) and rectal(per rectal: P.R.) administration. Second dose was required in 28% and third dose in 5%. MR and CT examinations required second dose in 36(32%) and 6 patients(15%), respectively. P.O. -patients vomited in 5%. P.R. -patients defecated in 22% after initial administration. There were no other serious complications. Time interval from the drug administration to the start of examinations was 33 minutes in initial-dose-group and 64 minutes in additional-dose-group. Two patients could not complete MR examination due to early arousal. Prolonged sedation, requiring more than 30 minutes for alertness after MR and CT examinations, was encountered in twenty(18%) and two patients(5%) respectively. Our protocol using chloral hydrate(P.O. or P.R.) is thought to be an effective and safe method for pediatric sedation for MR or CT imaging
Automated Price and Demand Response Demonstration for Large Customers in New York City using OpenADR
Energy Technology Data Exchange (ETDEWEB)
Kim, Joyce Jihyun; Yin, Rongxin; Kiliccote, Sila
2013-10-01
Open Automated Demand Response (OpenADR), an XML-based information exchange model, is used to facilitate continuous price-responsive operation and demand response participation for large commercial buildings in New York who are subject to the default day-ahead hourly pricing. We summarize the existing demand response programs in New York and discuss OpenADR communication, prioritization of demand response signals, and control methods. Building energy simulation models are developed and field tests are conducted to evaluate continuous energy management and demand response capabilities of two commercial buildings in New York City. Preliminary results reveal that providing machine-readable prices to commercial buildings can facilitate both demand response participation and continuous energy cost savings. Hence, efforts should be made to develop more sophisticated algorithms for building control systems to minimize customer's utility bill based on price and reliability information from the electricity grid.
Demand-side management and demand response in the Ontario energy sectors
International Nuclear Information System (INIS)
2004-01-01
A directive from the former Minister of Energy was received by the Ontario Energy Board (OEB), directing the Board to consult with stakeholders on options for the delivery of demand-side management (DSM) and demand response (DR) activities within the electricity sector, including the role of local distribution companies in such activities. The implementation costs were to be balanced with the benefits to both consumers and the entire system. The scope of the review was expanded by the Board to include the role of gas distribution companies in DSM. A consultation process was implemented and stakeholders were invited to participate. A series of recommendations was made, including: (1) a hybrid framework utilizing market-based and public-policy approaches should deliver DSM and DR activities in Ontario's energy markets, (2) DSM and DR activities should come under the responsibility of a central agency, (3) DSM and DR activities should be coordinated through cooperation between the Ministry of Energy, the Independent Electricity Market Operator (IMO) and the Ontario Energy Board, (4) regulatory mechanisms to induce gas distributors, electricity transmitters and electricity distributors to reduce distribution system losses should be put in place, (5) all electricity consumers should fund electricity DSM and some retail DR initiatives through a transparent, non-bypassable consumption charge, and (6) the Board should design, develop and deliver information to consumers regarding energy conservation, energy efficiency, load management, and cleaner sources of energy. refs., 4 figs
MR Imaging of Stable Posterior Cruciate Ligament Grafts in 21 Arthroscopically Proven Cases
International Nuclear Information System (INIS)
Yoon, Young Cheol; Chung, Hye Won; Ahn, Jin Hwan
2007-01-01
To describe the magnetic resonance (MR) appearance of intact posterior cruciate ligament (PCL) grafts. Thirty-one postoperative MR examinations were performed in 21 grafts of 20 patients after PCL reconstruction. All 21 grafts were proven to be intact on second-look arthroscopic examination. Two musculoskeletal radiologists retrospectively analyzed the MR findings and reached decisions by consensus. The signal intensity (SI) of the graft on proton density-weighted and T2-weighted images, as well as the shapes, locations, and segments of increased SI were recorded. The graft thickness was also recorded and correlated to elapsed time since reconstructive surgery. The SI of the graft was high (15/31, 48%), intermediate (10/31, 32%), or low (6/31, 19%) on proton density-weighted images, and high (9/31, 29%), intermediate (6/31, 19%), or low (16/31, 52%) on T2-weighted images. The graft SI decreased significantly as postoperative time elapsed. The shape of the increased SI within the grafts was band-like (14/25, 56%) or focal (11/25, 44%). The increased SI was located in the proximal (18/25, 72%), middle (21/25, 82%), and distal (12/25, 48%) segments. In the axial plane, the location of increased SI was intrasubstance (19/25, 76%) or peripheral (10/25, 40%). A 'focal' shape of increased SI was found significantly more in Achilles tendon allografts, while a band-like shape was more frequent in autogenous double-loop hamstring tendon grafts. Graft thickness ranged from 5 15 mm. The difference in graft thickness relative to postoperative time was not statistically significant (p = 0.79). Stable PCL grafts commonly showed an increased SI at any segment or location, even though they were stable. The shape of increased SI differed according to allograft donor sites. However, SI tended to decrease as time elapsed
Beyond the internal dynamics of organizational responses to conflicting institutional demands
Directory of Open Access Journals (Sweden)
Viviana Gutiérrez‐Rincón
2014-10-01
Full Text Available This paper presents some reflections on strategic response models, in particular the models proposed by Pache, Santos and Oliver, and it evaluates their complementarity and differences, especially regarding the interactions between decision making and the possible strategic responses to institutional demands. It is argued that the theoretical contributions of Pache and Santos can be categorized under the dimension of utility, because they can enhance the potential to operationalize and test the model. However, the reflections made in this paper not only highlight the need to take into account other external and internal factors for the study of strategic responses, but also the integration of different linkages of the decision process with strategic responses to institutional demands.
International Nuclear Information System (INIS)
Takahashi, Takahiro; Miki, Yukio; Takahashi, Jun A.; Kanagaki, Mitsunori; Yamamoto, Akira; Fushimi, Yasutaka; Okada, Tsutomu; Haque, Tabassum Laz; Hashimoto, Nobuo; Konishi, Junji; Togashi, Kaori
2005-01-01
Background and purpose: In patients with macroadenoma, posterior pituitary high signal (PPHS) on T1-weighted magnetic resonance (MR) imaging is sometimes observed in an ectopic location. The present study compared incidences of ectopic PPHS before and after macroadenoma surgery using MR imaging, including dynamic MR imaging to ascertain whether this ectopic change is irreversible. Materials and methods: MR imaging was performed preoperatively in 111 cases of macroadenoma, and then repeated more than 1-year postoperatively in 47 patients. Enhancement of PPHS was assessed using dynamic MR imaging. Areas of enhanced hyperintensity were considered true PPHS, and the relationship between presence and location of true PPHS and adenoma volume was analyzed. Moreover, changes in the presence and location of true PPHS were ascertained among the patients who underwent postoperative follow-up MR imaging. Results: Preoperatively, PPHS was seen only in the normal location in 29 patients (Group A: 26.1%). High signal was detected only in an ectopic location in 58 patients, and early enhancement of this ectopic high signal was confirmed by dynamic MR imaging in 56 patients (Group B: 50.5%). No PPHS was observed in 24 patients (Group C: 21.6%). Adenoma volume was significantly greater for Group B than for Group A (p < 0.001). Among the Group B patients who underwent MR imaging postoperatively (n = 31), the location of PPHS was not changed, except for two patients in whom PPHS was absent. Postoperatively, PPHS was not observed in the normal location in any patient in the Group B. Conclusions: Greater volume of adenoma is associated with a higher incidence of ectopic PPHS, and the ectopic change is irreversible
MR imaging of rotator cuff tears
International Nuclear Information System (INIS)
Kumagai, Hideo
1992-01-01
A total of 115 patients with clinical symptoms and signs suggesting rotator cuff tears underwent MR imaging with a 1.5-Tesla system. The body coil was used as the receiver coil in 24 patients and a single 10 cm surface coil in 91. Arthrography or MR imaging with intra-articular Gd-DTPA (MR arthrography) was performed in 95 of the 115. T2-weighted images with the body coil showed high signal intensity lesions in rotator cuffs in only seven of the 10 patients who had tears demonstrated by arthrography or MR arthrography. On the other hand, T2-weighted images with the surface coil demonstrated high signal intensity lesions in cuffs in all 27 patients who were diagnosed to have tears by arthrography or MR arthrography. In 12 patietns, T2-wighted images with the surface coil showed high signal intensity lesions in cuffs, while arthrography and MR arthrography did not show tears. Surgery was performed in four of the 12 patients and partial tears were confirmed. A single 10 cm surface coil, 3 mm slice thickness and 2.5 second repetition time seem to account for the fine visualization of cuff tears by the T2-weighted images. These results suggest that T2-weighted images obtained with the surface coil are superior to arthrography and MR arthrography. (author)
Horn, Felix C; Marshall, Helen; Collier, Guilhem J; Kay, Richard; Siddiqui, Salman; Brightling, Christopher E; Parra-Robles, Juan; Wild, Jim M
2017-09-01
Purpose To assess the magnitude of regional response to respiratory therapeutic agents in the lungs by using treatment response mapping (TRM) with hyperpolarized gas magnetic resonance (MR) imaging. TRM was used to quantify regional physiologic response in adults with asthma who underwent a bronchodilator challenge. Materials and Methods This study was approved by the national research ethics committee and was performed with informed consent. Imaging was performed in 20 adult patients with asthma by using hyperpolarized helium 3 ( 3 He) ventilation MR imaging. Two sets of baseline images were acquired before inhalation of a bronchodilating agent (salbutamol 400 μg), and one set was acquired after. All images were registered for voxelwise comparison. Regional treatment response, ΔR(r), was calculated as the difference in regional gas distribution (R[r] = ratio of inhaled gas to total volume of a voxel when normalized for lung inflation volume) before and after intervention. A voxelwise activation threshold from the variability of the baseline images was applied to ΔR(r) maps. The summed global treatment response map (ΔR net ) was then used as a global lung index for comparison with metrics of bronchodilator response measured by using spirometry and the global imaging metric percentage ventilated volume (%VV). Results ΔR net showed significant correlation (P treatment effect was detected with all metrics; however, ΔR net showed a lower intersubject coefficient of variation (64%) than all of the other tests (coefficient of variation, ≥99%). Conclusion TRM provides regional quantitative information on changes in inhaled gas ventilation in response to therapy. This method could be used as a sensitive regional outcome metric for novel respiratory interventions. © RSNA, 2017 Online supplemental material is available for this article.
Design of capacity incentive and energy compensation for demand response programs
Liu, Zhoubin; Cui, Wenqi; Shen, Ran; Hu, Yishuang; Wu, Hui; Ye, Chengjin
2018-02-01
Variability and Uncertainties caused by renewable energy sources have called for large amount of balancing services. Demand side resources (DSRs) can be a good alternative of traditional generating units to provide balancing service. In the areas where the electricity market has not been fully established, e.g., China, DSRs can help balance the power system with incentive-based demand response programs. However, there is a lack of information about the interruption cost of consumers in these areas, making it hard to determine the rational amount of capacity incentive and energy compensation for the participants of demand response programs. This paper proposes an algorithm to calculate the amount of capacity incentive and energy compensation for demand response programs when there lacks the information about interruption cost. Available statistical information of interruption cost in referenced areas is selected as the referenced data. Interruption cost of the targeted area is converted from the referenced area by product per electricity consumption. On this basis, capacity incentive and energy compensation are obtained to minimize the payment to consumers. Moreover, the loss of consumers is guaranteed to be covered by the revenue they earned from load serving entities.
MR imaging of metabolic white matter diseases: Therapeutic response
International Nuclear Information System (INIS)
Gebarski, S.S.; Allen, R.
1987-01-01
In metabolic diseases affecting the brain, MR imaging abnormalities include white-matter signal aberrations suggesting myelination delay, dysmyelination and demyelination, pathologic iron storage, and finally, loss of substance usually in a nonspecific pattern. The authors suggest that MR imaging may have therapeutic implications: (1) classic galactosemia - white-matter signal aberration became normal after dietary therapy; (2) phenylketonuria - age- and sex-matched treated and nontreated adolescents showed marked differences in brain volume, with the treated patient's volume nearly normal; (3) maple syrup urine disease - gross white-matter signal aberration became nearly normal after dietary therapy; and (4) hyperglycinemia - relentless progression of white-matter signal aberration and loss of brain substance despite therapy. These data suggest that brain MR imaging may provide a therapeutic index in certain metabolic diseases
International Nuclear Information System (INIS)
Regier, Marc; Ries, T.; Arndt, C.; Cramer, M.C.; Adam, G.; Habermann, C.R.; Graessner, J.; Reitmeier, F.; Jaehne, M.
2009-01-01
To investigate the value of diffusion-weighted echo-planar imaging (DW-EPI) for quantifying functional changes of the parotid gland in Sjoegren's disease and to evaluate whether ADC mapping allows for early diagnosis based on MR sialography grading. Using a DW-EPI sequence at 1.5T (b-factors: 0, 500 and 1000 sec/mm 2 ), the parotid glands of 52 healthy volunteers and 13 patients with histologically verified affection of Sjoegren's disease were examined. All scans were performed prior to and following gustatory stimulation with 5 ml of lemon juice. ADC maps were evaluated by placing an inordinate region-of-interest (ROI) enclosing the entire parotid gland. Sjoegren's disease was graded based on MR sialography findings using a 4-point grading-scale. Statistics included student t-test and kappa-analysis. In healthy volunteers mean ADCs of 1.14 x 10 -3 mm 2 /sec before and 1.2 x 10 -3 mm 2 /sec after stimulation were observed. Higher ADCs were determined for early-stage Sjoegren's disease, averaging 1.22 x 10 -3 mm 2 /sec before and 1.29 x 10 -3 mm 2 /sec after stimulation. Advanced disease revealed significantly lower ADCs (0.97 x 10 -3 mm 2 /sec (p = 0.002) before and 1.01 x 10 -3 mm 2 /sec (p < 0.001) after stimulation). (orig.)
International Nuclear Information System (INIS)
Gupta, V.; Goyal, M.; Mishra, N.; Gaikwad, S.; Sharma, A.
1997-01-01
Purpose: To evaluate the role of MR imaging in the localisation of cerebrospinal fluid (CSF) fistulae. Material and Methods: A total of 36 consecutive unselected patients with either clincally proven CSF leakage (n=26) or suspected CSF fistula (n=10) were prospectively evaluated by MR. All MR examinations included fast spin-echo T2-weighted images in the 3 orthogonal planes. Thin-section CT was performed following equivocal or negative MR examination. MR and CT findings were correlated with surgical results in 33 patients. Results: CSF fistula was visualised as a dural-bone defect with hyperintense fluid signal continuous with that in the basal cisterns on T2-weighted images. MR was positive in 26 cases, in 24 of which the fistula was confirmed surgically. In 2 patients the CSF leakage was directly demonstrated on MR. MR sensitivity of 80% compared favourably with the reported 46-81% of CT cisternography (CTC). No significant difference in MR sensitivity in detecting CSF fistula was found between active and inactive leaks. (orig.)
Assessment of Industrial Load for Demand Response across U.S. Regions of the Western Interconnect
Energy Technology Data Exchange (ETDEWEB)
Starke, Michael [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Alkadi, Nasr [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ma, Ookie [USDOE Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)
2013-09-01
Demand response has the ability to both increase power grid reliability and potentially reduce operating system costs. Understanding the role of demand response in grid modeling has been difficult due to complex nature of the load characteristics compared to the modeled generation and the variation in load types. This is particularly true of industrial loads, where hundreds of different industries exist with varying availability for demand response. We present a framework considering industrial loads for the development of availability profiles for demand response that can provide more regional understanding and can be inserted into analysis software for further study.
International Nuclear Information System (INIS)
Anzai, Y.; Lufkin, R.B.; Castro, D.J.; Farahani, K.; Chen, H.W.; Hirchowiz, S.
1991-01-01
Interstitial laser phototherapy for deep-seated tumors may become an attractive therapeutic modality when a noninvasive, accurate monitoring system is developed. In this paper, to devaluate the ability of MR imaging to differentiate reversible and irreversible thermal injuries induced by laser therapy, the precise correlation of MR and histopathologic findings are investigated in the in vivo model. Nd:YAG lasers were applied to normal musculature of rabbits, and MR examinations were performed immediately after laser exposure and followed up for up to 10 weeks. The sequential MR images were correlated with histopathologic findings. T2-weighted MR imaging clearly showed laser-induced thermal injuries on any postoperative day. MR imaging of acute thermal injuries showed a central cavity, low-signal zone of coagulative necrosis and a peripheral high-signal layer of interstitial edema. The infiltration of neutrophils followed by fibrovascular response was identified on the marginal edema layer after 6 postoperative days
Evaluation of in vivo quantification accuracy of the Ingenuity-TF PET/MR.
Maus, Jens; Schramm, Georg; Hofheinz, Frank; Oehme, Liane; Lougovski, Alexandr; Petr, Jan; Platzek, Ivan; Beuthien-Baumann, Bettina; Steinbach, Jörg; Kotzerke, Jörg; van den Hoff, Jörg
2015-10-01
The quantitative accuracy of standardized uptake values (SUVs) and tracer kinetic uptake parameters in patient investigations strongly depends on accurate determination of regional activity concentrations in positron emission tomography (PET) data. This determination rests on the assumption that the given scanner calibration is valid in vivo. In a previous study, we introduced a method to test this assumption. This method allows to identify discrepancies in quantitative accuracy in vivo by comparison of activity concentrations of urine samples measured in a well-counter with activity concentrations extracted from PET images of the bladder. In the present study, we have applied this method to the Philips Ingenuity-TF PET/MR since at the present stage, absolute quantitative accuracy of combined PET/MR systems is still under investigation. Twenty one clinical whole-body F18-FDG scans were included in this study. The bladder region was imaged as the last bed position and urine samples were collected afterward. PET images were reconstructed including MR-based attenuation correction with and without truncation compensation and 3D regions-of-interest (ROIs) of the bladder were delineated by three observers. To exclude partial volume effects, ROIs were concentrically shrunk by 8-10 mm. Then, activity concentrations were determined in the PET images for the bladder and for the urine by measuring the samples in a calibrated well-counter. In addition, linearity measurements of SUV vs singles rate and measurements of the stability of the coincidence rate of "true" events of the PET/MR system were performed over a period of 4 months. The measured in vivo activity concentrations were significantly lower in PET/MR than in the well-counter with a ratio of the former to the latter of 0.756 ± 0.060 (mean ± std. dev.), a range of 0.604-0.858, and a P value of 3.9 ⋅ 10(-14). While the stability measurements of the coincidence rate of "true" events showed no relevant deviation over
Evaluation of in vivo quantification accuracy of the Ingenuity-TF PET/MR
Energy Technology Data Exchange (ETDEWEB)
Maus, Jens, E-mail: j.maus@hzdr.de; Schramm, Georg; Hofheinz, Frank; Lougovski, Alexandr; Petr, Jan; Steinbach, Jörg [PET Center, Institute of Radiopharmaceutical Cancer Research, Helmholtz-Zentrum Dresden-Rossendorf, P.O. Box 510119, 01314 Dresden (Germany); Oehme, Liane; Beuthien-Baumann, Bettina; Kotzerke, Jörg [Department of Nuclear Medicine, University Hospital Carl Gustav Carus, Technische Universität Dresden, Fetscherstrasse 74, 01307 Dresden (Germany); Platzek, Ivan [Department of Radiology, University Hospital Carl Gustav Carus, Technische Universität Dresden, Fetscherstrasse 74, 01307 Dresden (Germany); Hoff, Jörg van den [PET Center, Institute of Radiopharmaceutical Cancer Research, Helmholtz-Zentrum Dresden-Rossendorf, P.O. Box 510119, 01314 Dresden, Germany and Department of Nuclear Medicine, University Hospital Carl Gustav Carus, Technische Universität Dresden, Fetscherstrasse 74, 01307 Dresden (Germany)
2015-10-15
Purpose: The quantitative accuracy of standardized uptake values (SUVs) and tracer kinetic uptake parameters in patient investigations strongly depends on accurate determination of regional activity concentrations in positron emission tomography (PET) data. This determination rests on the assumption that the given scanner calibration is valid in vivo. In a previous study, we introduced a method to test this assumption. This method allows to identify discrepancies in quantitative accuracy in vivo by comparison of activity concentrations of urine samples measured in a well-counter with activity concentrations extracted from PET images of the bladder. In the present study, we have applied this method to the Philips Ingenuity-TF PET/MR since at the present stage, absolute quantitative accuracy of combined PET/MR systems is still under investigation. Methods: Twenty one clinical whole-body F18-FDG scans were included in this study. The bladder region was imaged as the last bed position and urine samples were collected afterward. PET images were reconstructed including MR-based attenuation correction with and without truncation compensation and 3D regions-of-interest (ROIs) of the bladder were delineated by three observers. To exclude partial volume effects, ROIs were concentrically shrunk by 8–10 mm. Then, activity concentrations were determined in the PET images for the bladder and for the urine by measuring the samples in a calibrated well-counter. In addition, linearity measurements of SUV vs singles rate and measurements of the stability of the coincidence rate of “true” events of the PET/MR system were performed over a period of 4 months. Results: The measured in vivo activity concentrations were significantly lower in PET/MR than in the well-counter with a ratio of the former to the latter of 0.756 ± 0.060 (mean ± std. dev.), a range of 0.604–0.858, and a P value of 3.9 ⋅ 10{sup −14}. While the stability measurements of the coincidence rate of
Energy Technology Data Exchange (ETDEWEB)
Alstone, Peter; Potter, Jennifer; Piette, Mary Ann; Schwartz, Peter; Berger, Michael A.; Dunn, Laurel N.; Smith, Sarah J.; Sohn, Michael D.; Aghajanzadeh, Arian; Stensson, Sofia; Szinai, Julia
2016-04-01
Demand response (DR) is an important resource for keeping the electricity grid stable and efficient; deferring upgrades to generation, transmission, and distribution systems; and providing other customer economic benefits. This study estimates the potential size and cost of the available DR resource for California’s three investor-owned utilities (IOUs), as the California Public Utilities Commission (CPUC) evaluates how to enhance the role of DR in meeting California’s resource planning needs and operational requirements. As the state forges a clean energy future, the contributions of wind and solar electricity from centralized and distributed generation will fundamentally change the power grid’s operational dynamics. This transition requires careful planning to ensure sufficient capacity is available with the right characteristics – flexibility and fast response – to meet reliability needs. Illustrated is a snapshot of how net load (the difference between demand and intermittent renewables) is expected to shift. Increasing contributions from renewable generation introduces steeper ramps and a shift, into the evening, of the hours that drive capacity needs. These hours of peak capacity need are indicated by the black dots on the plots. Ultimately this study quantifies the ability and the cost of using DR resources to help meet the capacity need at these forecasted critical hours in the state.
Mannose Receptor Mediates the Immune Response to Ganoderma atrum Polysaccharides in Macrophages.
Li, Wen-Juan; Tang, Xiao-Fang; Shuai, Xiao-Xue; Jiang, Cheng-Jia; Liu, Xiang; Wang, Le-Feng; Yao, Yu-Fei; Nie, Shao-Ping; Xie, Ming-Yong
2017-01-18
The ability of mannose receptor (MR) to recognize the carbohydrate structures is well-established. Here, we reported that MR was crucial for the immune response to a Ganoderma atrum polysaccharide (PSG-1), as evidenced by elevation of MR in association with increase of phagocytosis and concentrations of interleukin-1β (IL-1β) and tumor necrosis factor-α (TNF-α) in normal macrophages. Elevation of MR triggered by PSG-1 also led to control lipopolysaccharide (LPS)-triggered inflammatory response via the increase of interleukin-10 (IL-10) and inhibition of phagocytosis and IL-1β. Anti-MR antibody partly attenuated PSG-1-mediated anti-inflammatory responses, while it could not affect TNF-α secretion, suggesting that another receptor was involved in PSG-1-triggered immunomodulatory effects. MR and toll-like receptor (TLR)4 coordinated the influences on the TLR4-mediated signaling cascade by the nuclear factor-κB (NF-κB) pathway in LPS-stimulated macrophages subjected to PSG-1. Collectively, immune response to PSG-1 required recognition by MR in macrophages. The NF-κB pathway served as a central role for the coordination of MR and TLR4 to elicit immune response to PSG-1.
Energy Technology Data Exchange (ETDEWEB)
Goshima, Satoshi [Department of Radiology, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1194 (Japan)], E-mail: gossy@par.odn.ne.jp; Kanematsu, Masayuki [Department of Radiology, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1194 (Japan); Department of Radiology Services, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1194 (Japan); Kondo, Hiroshi [Department of Radiology, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1194 (Japan); Yokoyama, Ryujiro; Kajita, Kimihiro [Department of Radiology Services, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1194 (Japan); Tsuge, Yusuke [Department of Radiology, Gifu University Hospital, 1-1 Yanagido, Gifu 501-1194 (Japan); Shiratori, Yoshimune [Department of Medical Informatics, Gifu University School of Medicine, Gifu (Japan); Onozuka, Minoru [Department of Physiology and Neuroscience, Kanagawa Dental College, Yokosuka (Japan); Moriyama, Noriyuki [Research Center for Cancer Prevention and Screening, National Cancer Center Hospital, Tsukiji (Japan)
2009-05-15
Purpose: To correlate hepatic hemangioma enhancement types in gadolinium-enhanced magnetic resonance (MR) images with diffusion-weighted MR findings and apparent diffusion coefficients (ADCs). Materials and methods: Respiratory-triggered diffusion-weighted MR images (TR/TE, 2422/46 ms; parallel imaging factor, 2; b factor, 500 s/mm{sup 2}; number of averaging, 6) obtained in 35 patients with 44 hepatic hemangiomas diagnosed by gadolinium-enhanced MR and by follow-up imaging were retrospectively evaluated. Hemangiomas were classified into three enhancement types based on gadolinium-enhanced MR imaging findings: type I, early-enhancement type; type II, peripheral nodular enhancement type; type III, delayed enhancement type. Two blinded readers qualitatively assessed lesion sizes and signal intensities on T2-weighted turbo spin-echo and diffusion-weighted images. The ADCs of hemangiomas were also measured. Results: No significant difference was observed between the three enhancement types in terms of signal intensities on T2-weighted images. Signal intensities on diffusion-weighted images were lower in the order type I to III (P < .01), and mean ADCs were 2.18 x 10{sup -3}, 1.86 x 10{sup -3}, and 1.71 x 10{sup -3} mm{sup 2}/s for types I, II, and III, respectively (P < .01). No correlation was found between lesion sizes and ADCs. Conclusion: Hepatic hemangiomas were found to have enhancement type dependent signal intensities and ADCs on diffusion-weighted MR images. Further studies will have to substantiate that these diffusion patterns might reflect intratumoral blood flow or perfusion.
Non-invasive quantification of hepatic fat fraction by fast 1.0, 1.5 and 3.0 T MR imaging
International Nuclear Information System (INIS)
Schuchmann, Sebastian; Weigel, Christiane; Albrecht, Lothar; Kirsch, Michael; Lemke, Arne; Lorenz, Gerd; Warzok, Rolf; Hosten, Norbert
2007-01-01
Introduction: Even mild hepatic steatosis in a split liver donor may cause general liver failure and death in the donor. So far, CT density measurements or percutaneous biopsy is used to determine the presence of hepatic steatosis. Magnetic resonance imaging (MRI) may be an elegant method of non-invasive and non-radiation quantification of hepatic fat content. Methods: Fast gradient echo (GRE) technique was used to discriminate between fat and water spins. Echo time (TE) was adjusted for field strength dependent in-phase and out-of-phase states at 1.0, 1.5 and 3.0 T. Continuous MR signal transition from 100% water to 100% fat was investigated using a wedge water-oil phantom, which was positioned in such a way, that no spatial resolution occurred, thereby combining water and fat in one slice. Results: Using the phantom, a significant difference for a 5% difference in fat content was demonstrated in the range from 20 to 80% fat content (p 2 = 0.93 for TE 6 ms and r 2 = 0.91 for TE 10 ms). Conclusion: The described method can be used to determine the presence of hepatic steatosis of >10% with p < 0.05
Automatic demand response referred to electricity spot price. Demo description
International Nuclear Information System (INIS)
Grande, Ove S.; Livik, Klaus; Hals, Arne
2006-05-01
This report presents background, technical solution and results from a test project (Demo I) developed in the DRR Norway) project. Software and technology from two different vendors, APAS and Powel ASA, are used to demonstrate a scheme for Automatic Demand Response (ADR) referred to spot price level and a system for documentation of demand response and cost savings. Periods with shortage of energy supply and hardly any investments in new production capacity have turned focus towards the need for increased price elasticity on the demand side in the Nordic power market. The new technology for Automatic Meter Reading (AMR) and Remote Load Control (RLC) provides an opportunity to improve the direct market participation from the demand side by introducing automatic schemes that reduce the need for customer attention to hourly market prices. The low prioritized appliances, and not the total load, are in this report defined as the Demand Response Objects, based on the assumption that there is a limit for what the customers are willing to pay for different uses of electricity. Only disconnection of residential water heaters is included in the demo, due to practical limitations. The test was performed for a group of single family houses over a period of 2 months. All the houses were equipped with a radio controlled 'Ebox' unit attached to the water heater socket. The settlement and invoicing were based on hourly metered values (kWh/h), which means that the customer benefit is equivalent to the accumulated changes in the electricity cost per hour. The actual load reduction is documented by comparison between the real meter values for the period and a reference curve. The curves show significant response to the activated control in the morning hours. In the afternoon it is more difficult to register the response, probably due to 'disturbing' activities like cooking etc. Demo I shows that load reduction referred to spot price level can be done in a smooth way. The experiences
Energy Technology Data Exchange (ETDEWEB)
Rounaghi, Gholamhossein, E-mail: ghrounagh@yahoo.com [Department of Chemistry, Faculty of Sciences, Ferdowsi University of Mashhad, Mashhad (Iran, Islamic Republic of); Zadeh Kakhki, Roya Mohammad; Sadeghian, Hamid [Department of Chemistry, Faculty of Sciences, Ferdowsi University of Mashhad, Mashhad (Iran, Islamic Republic of)
2011-11-30
Highlights: > An ISE based on a new ionophore is used successfully to determine cerium (III) cation over the concentration range 1.0 x 10{sup -1}-2.1 x 10{sup -9} mol l{sup -1}. > It has a fast response time of 10 s. > It has comparatively good selectivities with respect to metal cations. > It can be used in a pH range of 5.0-8.0. > It also was used as an indicator electrode in potentiometric determination of F{sup -} ion in some real sample preparations. - Abstract: In the present study, a novel electrode based on 2,9-dihydroxy-1,10-diphenoxy-4,7-dithiadecane (DHDPDTD) that is selective to cerium (III) cations was evaluated electrochemically, and a Nerenstian slope (19.3 {+-} 1 mV decade{sup -1}) over a concentration range of 1.0 x 10{sup -8}-1.0 x 10{sup -1} M and a detection limit of 2.1 x 10{sup -9} M were observed. The proposed electrochemical sensor displayed a rapid response time of 10 s, improved selectivity towards Ce (III) cations in the presence of alkali, alkaline earth, transition and heavy metal cations, and could be used in a pH range of 5.0-8.0. Additionally, the proposed sensor was used as an indicator in the potentiometric titration of fluoride and the determination of F{sup -} ions in real samples.
Energy Technology Data Exchange (ETDEWEB)
Abd Ellah, Mohamed, E-mail: dr_m_hamdy2006@hotmail.co [Innsbruck Medical University, Radiology Dept., Anich St. 35, 6020 Innsbruck (Austria); Kremser, Christian, E-mail: christian.kremser@i-med.ac.a [Innsbruck Medical University, Radiology Dept., Anich St. 35, 6020 Innsbruck (Austria); Pallwein, Leo, E-mail: leo.pallwein-prettner@uki.a [Innsbruck Medical University, Radiology Dept., Anich St. 35, 6020 Innsbruck (Austria); Aigner, Friedrich, E-mail: friedrich.Aigner@uki.a [Innsbruck Medical University, Radiology Dept., Anich St. 35, 6020 Innsbruck (Austria); Schocke, Michael, E-mail: michael.schocke@i-med.ac.a [Innsbruck Medical University, Radiology Dept., Anich St. 35, 6020 Innsbruck (Austria); Peschel, Reinhard, E-mail: reinhard.peschel@uki.a [Innsbruck Medical University, Urology Dept., Anich St. 35, 6020 Innsbruck (Austria); Pedross, Florian, E-mail: florian.pedross@i-med.ac.a [Innsbruck Medical University, Medical Statistics Dept., Anich St. 35, 6020 Innsbruck (Austria); Pinggera, Germar-Michael, E-mail: germar.pinggera@uki.a [Innsbruck Medical University, Urology Dept., Anich St. 35, 6020 Innsbruck (Austria); Wolf, Christian, E-mail: christian.wolf@bkh-reutte.a [Innsbruck Medical University, Radiology Dept., Anich St. 35, 6020 Innsbruck (Austria); Alsharkawy, Mostafa A.M., E-mail: drmostafamri@yahoo.co [Assiut University, Radiology Dept., Assiut (Egypt); Jaschke, Werner, E-mail: werner.jaschke@i-med.ac.a [Innsbruck Medical University, Radiology Dept., Anich St. 35, 6020 Innsbruck (Austria); Frauscher, Ferdinand, E-mail: ferdinand.frauscher@uki.a [Innsbruck Medical University, Radiology Dept., Anich St. 35, 6020 Innsbruck (Austria)
2010-10-15
The annual incidence of stone formation is increased in the industrialised world. Extracorporeal shockwave lithotripsy is a non-invasive effective treatment of upper urinary tract stones. This study is aimed to evaluate changes of renal blood flow in patients undergoing extracorporeal shock wave lithotripsy (ESWL) by arterial spin labeling (ASL) MR imaging, contrast enhanced dynamic MR imaging, and renal resistive index (RI). Thirteen patients with nephrolithiasis were examined using MR imaging and Doppler ultrasound 12 h before and 12 h after ESWL. ASL sequence was done for both kidneys and followed by contrast enhanced MR imaging. In addition RI Doppler ultrasound measurements were performed. A significant increase in RI (p < 0.001) was found in both treated and untreated kidneys. ASL MR imaging also showed significant changes in both kidneys (p < 0.001). Contrast enhanced dynamic MR imaging did not show significant changes in the kidneys. ESWL causes changes in RI and ASL MR imaging, which seem to reflect changes in renal blood flow.
2013-11-22
... offenses under 10 U.S.C. 920 (article 120 of the Uniform Code of Military Justice), for the purpose of....-9:30 a.m. Presentation by Mr. Russell Strand-- Overview of the Problem of Sexual Assault in the Military and Civilian Society 9:30 a.m.-10:30 a.m. Special Victim Capability Overview 10:30 a.m.-12:30 p.m...
Field Testing of Telemetry for Demand Response Control of Small Loads
Energy Technology Data Exchange (ETDEWEB)
Lanzisera, Steven [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Weber, Adam [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Liao, Anna [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Schetrit, Oren [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Kiliccote, Sila [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Piette, Mary Ann [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2018-01-30
The electricity system in California, from generation through loads, must be prepared for high renewable penetration and increased electrification of end uses while providing increased resilience and lower operating cost. California has an aggressive renewable portfolio standard that is complemented by world-leading greenhouse gas goals. The goal of this project was to evaluate methods of enabling fast demand response (DR) signaling to small loads for low-cost site enablement. We used OpenADR 2.0 to meet telemetry requirements for providing ancillary services, and we used a variety of low-cost devices coupled with open-source software to enable an end-to-end fast DR. The devices, architecture, implementation, and testing of the system is discussed in this report. We demonstrate that the emerging Internet of Things (IoT) and Smart Home movements provide an opportunity for diverse small loads to provide fast, low-cost demand response. We used Internet-connected lights, thermostats, load interruption devices, and water heaters to demonstrate an ecosystem of controllable devices. The system demonstrated is capable of providing fast load shed for between 20 dollars and $300 per kilowatt (kW) of available load. The wide range results from some loads may have very low cost but also very little shed capability (a 10 watt [W] LED light can only shed a maximum of 10 W) while some loads (e.g., water heaters or air conditioners) can shed several kilowatts but have a higher initial cost. These costs, however, compare well with other fast demand response costs, with typically are over $100/kilowatt of shed. We contend these loads are even more attractive than their price suggests because many of them will be installed for energy efficiency or non-energy benefits (e.g., improved lighting quality or controllability), and the ability to use them for fast DR is a secondary benefit. Therefore the cost of enabling them for DR may approach zero if a software-only solution can be
Retail Demand Response in Southwest Power Pool
Energy Technology Data Exchange (ETDEWEB)
Bharvirkar, Ranjit; Heffner, Grayson; Goldman, Charles
2009-01-30
In 2007, the Southwest Power Pool (SPP) formed the Customer Response Task Force (CRTF) to identify barriers to deploying demand response (DR) resources in wholesale markets and develop policies to overcome these barriers. One of the initiatives of this Task Force was to develop more detailed information on existing retail DR programs and dynamic pricing tariffs, program rules, and utility operating practices. This report describes the results of a comprehensive survey conducted by LBNL in support of the Customer Response Task Force and discusses policy implications for integrating legacy retail DR programs and dynamic pricing tariffs into wholesale markets in the SPP region. LBNL conducted a detailed survey of existing DR programs and dynamic pricing tariffs administered by SPP's member utilities. Survey respondents were asked to provide information on advance notice requirements to customers, operational triggers used to call events (e.g. system emergencies, market conditions, local emergencies), use of these DR resources to meet planning reserves requirements, DR resource availability (e.g. seasonal, annual), participant incentive structures, and monitoring and verification (M&V) protocols. Nearly all of the 30 load-serving entities in SPP responded to the survey. Of this group, fourteen SPP member utilities administer 36 DR programs, five dynamic pricing tariffs, and six voluntary customer response initiatives. These existing DR programs and dynamic pricing tariffs have a peak demand reduction potential of 1,552 MW. Other major findings of this study are: o About 81percent of available DR is from interruptible rate tariffs offered to large commercial and industrial customers, while direct load control (DLC) programs account for ~;;14percent. o Arkansas accounts for ~;;50percent of the DR resources in the SPP footprint; these DR resources are primarily managed by cooperatives. o Publicly-owned cooperatives accounted for 54percent of the existing DR resources
77 FR 14571 - Sunshine Act; Board of Directors Meeting, March 29, 2012
2012-03-12
...: (Closed to the Public 10:15 a.m.): 1. Finance Project--India. 2. Finance Project--Global. 3. Finance..., 2012. Connie M. Downs, Corporate Secretary, Overseas Private Investment Corporation. [FR Doc. 2012-6043...
International Nuclear Information System (INIS)
Zhang, Ning; Hu, Zhaoguang; Springer, Cecilia; Li, Yanning; Shen, Bo
2016-01-01
Highlights: • We put forward a novel bi-level integrated power system planning model. • Generation expansion planning and transmission expansion planning are combined. • The effects of two sorts of demand response in reducing peak load are considered. • Operation simulation is conducted to reflect the actual effects of demand response. • The interactions between the two levels can guarantee a reasonably optimal result. - Abstract: If all the resources in power supply side, transmission part, and power demand side are considered together, the optimal expansion scheme from the perspective of the whole system can be achieved. In this paper, generation expansion planning and transmission expansion planning are combined into one model. Moreover, the effects of demand response in reducing peak load are taken into account in the planning model, which can cut back the generation expansion capacity and transmission expansion capacity. Existing approaches to considering demand response for planning tend to overestimate the impacts of demand response on peak load reduction. These approaches usually focus on power reduction at the moment of peak load without considering the situations in which load demand at another moment may unexpectedly become the new peak load due to demand response. These situations are analyzed in this paper. Accordingly, a novel approach to incorporating demand response in a planning model is proposed. A modified unit commitment model with demand response is utilized. The planning model is thereby a bi-level model with interactions between generation-transmission expansion planning and operation simulation to reflect the actual effects of demand response and find the reasonably optimal planning result.
7 CFR 29.3040 - Mixed color (M).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Mixed color (M). 29.3040 Section 29.3040 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Mixed color (M). Distinctly different colors of the type mingled together. (See Rule 16.) [24 FR 8771...
2010-03-31
... McMillan and Ms. Christine Smith; Notice of Termination of License by Implied Surrender and Soliciting... surrender b. Project No.: P-9907-018 c. Licensees: Mr. Jerry McMillan and Ms. Christine Smith d. Name of... ] 62,282). The project was transferred to Mr. Jerry McMillan and Ms. Christine Smith by order on...
Bioactivation and Regioselectivity of Pig Cytochrome P450 3A29 towards Aflatoxin B1
Directory of Open Access Journals (Sweden)
Jun Wu
2016-09-01
Full Text Available Due to unavoidable contaminations in feedstuff, pigs are easily exposed to aflatoxin B1 (AFB1 and suffer from poisoning, thus the poisoned products potentially affect human health. Heretofore, the metabolic process of AFB1 in pigs remains to be clarified, especially the principal cytochrome P450 oxidases responsible for its activation. In this study, we cloned CYP3A29 from pig liver and expressed it in Escherichia coli, and its activity has been confirmed with the typical P450 CO-reduced spectral characteristic and nifedipine-oxidizing activity. The reconstituted membrane incubation proved that the recombinant CYP3A29 was able to oxidize AFB1 to form AFB1-exo-8,9-epoxide in vitro. The structural basis for the regioselective epoxidation of AFB1 by CYP3A29 was further addressed. The T309A mutation significantly decreased the production of AFBO, whereas F304A exhibited an enhanced activation towards AFB1. In agreement with the mutagenesis study, the molecular docking simulation suggested that Thr309 played a significant role in stabilization of AFB1 binding in the active center through a hydrogen bond. In addition, the bulk phenyl group of Phe304 potentially imposed steric hindrance on the binding of AFB1. Our study demonstrates the bioactivation of pig CYP3A29 towards AFB1 in vitro, and provides the insight for understanding regioselectivity of CYP3A29 to AFB1.
Cao, Xinhua; Qi, Yueling; Xu, Chen; Yang, Yuyi; Wang, Jun
2017-04-01
Shewanella oneidensis MR-1 degrades various azo dyes under microaerophilic and anaerobic conditions, but this process is inhibited under aerobic conditions. The mechanisms underlying azo dye biodegradation and inhibition remain unknown. Therefore, we investigated metabolic and transcriptional changes in strain MR-1, which was cultured under different conditions, to elucidate these mechanisms. At the transcriptional level, genes involved in certain metabolic processes, particularly the tricarboxylic acid (TCA) cycle, amino acid biodegradation, and the electron transfer system, were significantly altered (M ≧ 2, p > 0.8 ) in the presence of methyl orange (MO). Moreover, a high concentration of dissolved oxygen heavily impacted the expression levels of genes involved in fatty acid biodegradation. Metabolome analysis revealed significant alteration (p < 0.05) in the concentrations of nine metabolites when strain MR-1 was cultured under aerobic conditions; the majority of these metabolites were closely associated with amino acid metabolism and DNA replication. Accordingly, we propose a possible pathway for MO biodegradation and discuss the most likely causes of biodegradation inhibition due to dissolved oxygen.
Response of pressurized water reactor (PWR) to network power generation demands
International Nuclear Information System (INIS)
Schreiner, L.A.
1991-01-01
The flexibility of the PWR type reactor in terms of response to the variations of the network power demands, is demonstrated. The factors that affect the transitory flexibility and some design prospects that allow the reactor fits the requirements of the network power demands, are also discussed. (M.J.A.)
31P MR spectroscopic measurement of intracellular pH in normal human hearts
International Nuclear Information System (INIS)
Kwon, Jae Hyun; Lee, Hui Joong; Jang, Yong Min
2002-01-01
To assess the usefulness of intracellular pH (pHi), calculated by determining the shift of a high-energy metabolite such as inorganic phosphate (Pi) of γ-ATP after performing MRS with ECG-gated two-dimensional 31 P CSI (chemical shift imaging), as a parameter for the overall state of the intracellular milieu. Proto decoupled 31 P CSI was performed on a 1.5-T scanner using a 1 H 31 P dual-tuned surface coil. Cardiac MRS data were obtained from eight normal volunteers aged 24-32 years with no history of heart disease. From the spectra obtained from several regions of the heart, peack position and peak area were estimated. The metabolic ratios of α-, β-, γ-ATP, PCr, Pi, phosphodiester and diphosphoglycerate were calculated, and pHi was estimated from the chemical shift of Pi and γ-ATP resonance. We then compared the data for the anterior myocardium with those previously published. The major phosphorous metabolites identified in these human hearts were as follows: PCr, at -0.1 to +0.1 ppm; three phosphate peaks from ATP, with a chemical shift centered at about -2.7 ppm (γ-ATP), -7.8 ppm (α-ATP), and -16.3 ppm (β-ATP); and phosphodiester (PDE) at 2-3 ppm, inorganic phosphate (Pi) at 4.5-5.4 ppm, and diphosphoglycerate (DPG) at 5.4-6.3 ppm. The PCr/β-ATP ratio was 2.20±0.17 and the PDE/β-ATP ratio, 1.04±0.09 pHi readings were 7.31±0.23 (calculated by the shift of Pi) and 6.81±0.20 (calculated by the shift of γ-ATP). Pi/PCR was 0.539, a ratio higher than that mentioned in previously published reports. The measurement of intracellular metabolism was affected by various kinds of factors. We believe, however, that pHi readings indicate the overall state of the cardiac intracellular milieu. An unexpected pHi readings, seen at MRS, may reflect errors in the MR procedure itself and, or in the analytical method
Managing electrical demand through difficult periods: California's experience with demand response
International Nuclear Information System (INIS)
Wikler, G.; Ghosh, D.Ph.D.
2010-01-01
This paper provides a brief overview of California's electricity situation and the relevance of Demand Response (DR) in addressing some of the challenges faced by the State's electricity system. It then discusses California's experience with DR, market rules that influence what role DR plays and attempts to integrate wholesale-retail level program offerings in the State, and some of the key drivers that are likely to enhance the role of DR. Lastly, the paper identifies some of the key challenges facing implementers of DR programs and discusses how many of those challenges could potentially be overcome. (authors)
Mitchell, John A; Pumpa, Kate L; Pyne, David B
2017-03-01
Mitchell, JA, Pumpa, KL, and Pyne, DB. Responses of lowerbody power and match running demands after long-haul travel in international rugby sevens players. J Strength Cond Res 31(3): 686-695, 2017-This study determined the effect of long-haul (>5 hours) travel on lower-body power and match running demands in international rugby sevens players. Lower-body power was assessed in 22 male international rugby sevens players (age 21.7 ± 2.7 years, mass 89.0 ± 6.7 kg, stature 180.5 ± 6.2 cm; mean ± SD) monitored over 17 rugby sevens tournaments. A countermovement jump was used to monitor lower-body power (peak and mean power) over repeated three week travel and competition periods (pretravel, posttravel, and posttournament). Small decreases were evident in peak power after both short and long-haul travel (-4.0%, ±3.2%; mean, ±90% confidence limits) with further reductions in peak and mean power posttournament (-4.5%, ±2.3% and -3.8%, ±1.5%) culminating in a moderate decrease in peak power overall (-7.4%, ±4.0%). A subset of 12 players (completing a minimum of 8 tournaments) had the effects of match running demands assessed with lower-body power. In this subset, long-haul travel elicited a large decrease in lower-body peak (-9.4%, ±3.5%) and mean power (-5.6%, ±2.9%) over the monitoring period, with a small decrease (-4.3%, ±3.0% and -2.2%, ±1.7%) posttravel and moderate decrease (-5.4%, ±2.5% and -3.5%, ±1.9%) posttournament, respectively. Match running demands were monitored through global positioning system. In long-haul tournaments, the 12 players covered ∼13%, ±13% greater total distance (meter) and ∼11%, ±10% higher average game meters >5 m·s when compared with short-haul (rugby sevens tournaments after long-haul travel.
International Nuclear Information System (INIS)
Roche, Robin
2012-01-01
also evaluated. With other demand-side management techniques, demand response enables reducing load during a given duration, for example in case of a congestion on the transmission system. A demand response system is proposed and relies on the use of the assets of residential customers to curtail and shift local loads (hybrid electric vehicles, air conditioning, and water heaters) so that the total system load remains under a given threshold. Aggregators act as interfaces between grid operators and a demand response market. A simulator is also developed to evaluate the performance of the proposed system. Results show that the system manages to maintain the total load under a threshold by using available resources, without compromising the steady-state stability of the distribution system. (author) [fr
International Nuclear Information System (INIS)
Leibfarth, Sara; Moennich, David; Thorwarth, Daniela; Welz, Stefan; Siegel, Christine; Zips, Daniel; Schwenzer, Nina; Holger Schmidt, Holger
2013-01-01
Background: Combined positron emission tomography (PET)/magnetic resonance imaging (MRI) is highly promising for biologically individualized radiotherapy (RT). Hence, the purpose of this work was to develop an accurate and robust registration strategy to integrate combined PET/MR data into RT treatment planning. Material and methods: Eight patient datasets consisting of an FDG PET/computed tomography (CT) and a subsequently acquired PET/MR of the head and neck (HN) region were available. Registration strategies were developed based on CT and MR data only, whereas the PET components were fused with the resulting deformation field. Following a rigid registration, deformable registration was performed with a transform parametrized by B-splines. Three different optimization metrics were investigated: global mutual information (GMI), GMI combined with a bending energy penalty (BEP) for regularization (GMI + BEP) and localized mutual information with BEP (LMI + BEP). Different quantitative registration quality measures were developed, including volumetric overlap and mean distance measures for structures segmented on CT and MR as well as anatomical landmark distances. Moreover, the local registration quality in the tumor region was assessed by the normalized cross correlation (NCC) of the two PET datasets. Results: LMI + BEP yielded the most robust and accurate registration results. For GMI, GMI + BEP and LMI + BEP, mean landmark distances (standard deviations) were 23.9 mm (15.5 mm), 4.8 mm (4.0 mm) and 3.0 mm (1.0 mm), and mean NCC values (standard deviations) were 0.29 (0.29), 0.84 (0.14) and 0.88 (0.06), respectively. Conclusion: Accurate and robust multimodal deformable image registration of CT and MR in the HN region can be performed using a B-spline parametrized transform and LMI + BEP as optimization metric. With this strategy, biologically individualized RT based on combined PET/MRI in terms of dose painting is possible
The significance of MR cisternography in the evaluation of cerebrospinal rhinorrhea
International Nuclear Information System (INIS)
Xian Junfang; Wang Zhenchang; Liang Xihong; Tong Yajian; Zhao Bo; Zhou Bing; Ge Wentong; Zhang Tianming
2005-01-01
Objective: To assess the ability of MR cisternography (MRC) in the diagnosis of cerebrospinal rhinorrhea, and compare the advantages and disadvantages of MRC, CT cisternography (CTC) and high-resolution CT (HRCT). Methods: HRCT and MRC were performed in 18 cases with clinically suspected cerebrospinal rhinorrhea. Ten cases also underwent CTC successfully. Compared with surgical findings, the accuracy of the three methods was analysed. Results: Operative findings demonstrated 29 fistulae in all 18 cases with clinically suspected cerebrospinal rhinorrhea. Twenty-five fistulae were showed on preoperative HRCT in all 18 cases, of which 18 fistulae were consistent with operative findings, with an accuracy of 18/29. Twenty-four fistulae were displayed on preoperative MRC in all 18 cases, of which 21 fistulae were consistent with operative findings, with an accuracy of 21/29. In the ten cases undergone preoperative CTC, surgical findings showed 18 fistulae. CTC of 10 cases demonstrated 12 fistulae, of which 11 fistulae were consistent with operative findings, with an accuracy of 11/18. By way of statistical analysis, there was no significant difference between three methods in the diagnosis of cerebrospinal rhinorrhea (P>0.05). Conclusion: HRCT and MRC appeared to be a noninvasively feasible examination method. The combination of HRCT and MRC was highly accurate in the evaluation of suspected cerebrospinal rhinorrhea and in the location of the site of cerebrospinal rhinorrhea that should be considered as a viable alternative to invasively time-consuming CTC. (authors)
4D flow MR imaging of the portal venous system: a feasibility study in children
International Nuclear Information System (INIS)
Parekh, Keyur; Rose, Michael; Popescu, Andrada; Rigsby, Cynthia K.; Markl, Michael; Schnell, Susanne
2017-01-01
To determine the feasibility of 4D flow MRI for visualization and quantification of the portal venous haemodynamics in children and young adults. 4D flow was performed in 28 paediatric patients (median age, 8.5 years; interquartile range, 5.2-16.5), 15 with non-operated native portal system and 13 with surgically created portal shunt. Image quality assessment for 3D flow visualization and flow pattern analyses was performed. Regional 4D flow peak velocity and net flow were compared with 2D-cine phase contrast MRI (2D-PC MR) in the post-surgical patients. Mean 3D flow visualization quality score was excellent (mean ± SD, 4.2 ± 0.9) with good inter-rater agreement (κ,0.67). Image quality in children aged >10 years was better than children ≤10 years (p < 0.05). Flow pattern was defined for portal, superior mesenteric, splenic veins and splenic artery in all patients. 4D flow and 2D-PC MR peak velocity and net flow were similar with good correlation (peak velocity: 4D flow 22.2 ± 9.1 cm/s and 2D-PC MR 25.2 ± 11.2 cm/s, p = 0.46; r = 0.92, p < 0.0001; net flow: 4D flow 9.5 ± 7.4 ml/s and 2D-PC MR 10.1 ± 7.3 ml/s, p = 0.65; r = 0.81, p = 0.0007). 4D flow MRI is feasible and holds promise for the comprehensive 3D visualization and quantification of portal venous flow dynamics in children and young adults. (orig.)
4D flow MR imaging of the portal venous system: a feasibility study in children
Energy Technology Data Exchange (ETDEWEB)
Parekh, Keyur; Rose, Michael; Popescu, Andrada; Rigsby, Cynthia K. [Ann and Robert H. Lurie Children' s Hospital of Chicago, Department of Medical Imaging, Chicago, IL (United States); Northwestern University, Department of Radiology, Feinberg School of Medicine, Chicago, IL (United States); Markl, Michael [Northwestern University, Department of Radiology, Feinberg School of Medicine, Chicago, IL (United States); McCormick School of Engineering, Northwestern University, Department of Biomedical Engineering, Chicago, IL (United States); Schnell, Susanne [Northwestern University, Department of Radiology, Feinberg School of Medicine, Chicago, IL (United States)
2017-02-15
To determine the feasibility of 4D flow MRI for visualization and quantification of the portal venous haemodynamics in children and young adults. 4D flow was performed in 28 paediatric patients (median age, 8.5 years; interquartile range, 5.2-16.5), 15 with non-operated native portal system and 13 with surgically created portal shunt. Image quality assessment for 3D flow visualization and flow pattern analyses was performed. Regional 4D flow peak velocity and net flow were compared with 2D-cine phase contrast MRI (2D-PC MR) in the post-surgical patients. Mean 3D flow visualization quality score was excellent (mean ± SD, 4.2 ± 0.9) with good inter-rater agreement (κ,0.67). Image quality in children aged >10 years was better than children ≤10 years (p < 0.05). Flow pattern was defined for portal, superior mesenteric, splenic veins and splenic artery in all patients. 4D flow and 2D-PC MR peak velocity and net flow were similar with good correlation (peak velocity: 4D flow 22.2 ± 9.1 cm/s and 2D-PC MR 25.2 ± 11.2 cm/s, p = 0.46; r = 0.92, p < 0.0001; net flow: 4D flow 9.5 ± 7.4 ml/s and 2D-PC MR 10.1 ± 7.3 ml/s, p = 0.65; r = 0.81, p = 0.0007). 4D flow MRI is feasible and holds promise for the comprehensive 3D visualization and quantification of portal venous flow dynamics in children and young adults. (orig.)
Whole-body MR imaging including angiography: Predicting recurrent events in diabetics
Energy Technology Data Exchange (ETDEWEB)
Bertheau, Robert C.; Kauczor, Hans-Ulrich; Weckbach, Sabine; Schlett, Christopher L. [University Hospital Heidelberg, Department of Diagnostic and Interventional Radiology, Heidelberg (Germany); Bamberg, Fabian [Ludwig Maximilians University, Klinikum Grosshadern, Department of Clinical Radiology, Munich (Germany); University Hospital Tuebingen, Department of Diagnostic and Interventional Radiology, Tuebingen (Germany); Lochner, Elena [Ludwig Maximilians University, Klinikum Grosshadern, Department of Clinical Radiology, Munich (Germany); Findeisen, Hannes M. [University Hospital Muenster, Department of Cardiology and Angiology, Muenster (Germany); Parhofer, Klaus G. [Ludwig Maximilians University, Klinikum Grosshadern, Department of Internal Medicine II, Munich (Germany); Schoenberg, Stefan O. [University Medical Center Mannheim, Department of Clinical Radiology and Nuclear Medicine, Mannheim (Germany)
2016-05-15
Whether whole-body MRI can predict occurrence of recurrent events in patients with diabetes mellitus. Whole-body MRI was prospectively applied to 61 diabetics and assessed for arteriosclerosis and ischemic cerebral/myocardial changes. Occurrence of cardiocerebral events and diabetic comorbidites was determined. Patients were stratified whether no, a single or recurrent events arose. As a secondary endpoint, events were stratified into organ system-specific groups. During a median follow-up of 70 months, 26 diabetics developed a total of 39 events; 18 (30 %) developed one, 8 (13 %) recurrent events. Between diabetics with no, a single and recurrent events, a stepwise higher burden was observed for presence of left ventricular (LV) hypo-/akinesia (3/28/75 %, p < 0.0001), myocardial delayed-contrast-enhancement (17/33/63 %, p = 0.001), carotid artery stenosis (11/17/63 %, p = 0.005), peripheral artery stenosis (26/56/88 %, p = 0.0006) and vessel score (1.00/1.30/1.76, p < 0.0001). After adjusting for clinical characteristics, LV hypo-/akinesia (hazard rate ratio = 6.57, p < 0.0001) and vessel score (hazard rate ratio = 12.29, p < 0.0001) remained independently associated. Assessing organ system risk, cardiac and cerebral MR findings predicted more strongly events in their respective organ system. Vessel-score predicted both cardiac and cerebral, but not non-cardiocerebral, events. Whole-body MR findings predict occurrence of recurrent events in diabetics independent of clinical characteristics, and may concurrently provide organ system-specific risk. (orig.)
Whole-body MR imaging including angiography: Predicting recurrent events in diabetics
International Nuclear Information System (INIS)
Bertheau, Robert C.; Kauczor, Hans-Ulrich; Weckbach, Sabine; Schlett, Christopher L.; Bamberg, Fabian; Lochner, Elena; Findeisen, Hannes M.; Parhofer, Klaus G.; Schoenberg, Stefan O.
2016-01-01
Whether whole-body MRI can predict occurrence of recurrent events in patients with diabetes mellitus. Whole-body MRI was prospectively applied to 61 diabetics and assessed for arteriosclerosis and ischemic cerebral/myocardial changes. Occurrence of cardiocerebral events and diabetic comorbidites was determined. Patients were stratified whether no, a single or recurrent events arose. As a secondary endpoint, events were stratified into organ system-specific groups. During a median follow-up of 70 months, 26 diabetics developed a total of 39 events; 18 (30 %) developed one, 8 (13 %) recurrent events. Between diabetics with no, a single and recurrent events, a stepwise higher burden was observed for presence of left ventricular (LV) hypo-/akinesia (3/28/75 %, p < 0.0001), myocardial delayed-contrast-enhancement (17/33/63 %, p = 0.001), carotid artery stenosis (11/17/63 %, p = 0.005), peripheral artery stenosis (26/56/88 %, p = 0.0006) and vessel score (1.00/1.30/1.76, p < 0.0001). After adjusting for clinical characteristics, LV hypo-/akinesia (hazard rate ratio = 6.57, p < 0.0001) and vessel score (hazard rate ratio = 12.29, p < 0.0001) remained independently associated. Assessing organ system risk, cardiac and cerebral MR findings predicted more strongly events in their respective organ system. Vessel-score predicted both cardiac and cerebral, but not non-cardiocerebral, events. Whole-body MR findings predict occurrence of recurrent events in diabetics independent of clinical characteristics, and may concurrently provide organ system-specific risk. (orig.)
Approaches for Accommodating Demand Response in Operational Problems and Assessing its Value
DEFF Research Database (Denmark)
O'Connell, Niamh
. However, before the necessary investments can be made to establish and operate this novel resource, its value must be determined. As with all current power system resources, if distributed demand response is deployed on a large scale it will be required to interface with the power system and market...... investments will be made to establish and operate the resource. A positive commercial assessment will signal to investors that the resource can offer a return on their investment, and that it can thrive in a competitive environment. We consider both the social welfare and commercial value of demand response......This thesis deals with the development of operational models of demand response and the evaluation of this novel resource within existing frameworks for power system dispatch and market clearing. Increasing shares of power generation from variable renewable sources, and climate change policies...
75 FR 50763 - Proposed Agency Information Collection Activities; Comment Request
2010-08-17
... competitors of the Federal Reserve Board. The data from the surveys primarily are used to determine the... and Salary Surveys. Agency form number: FR 29a,b. OMB control number: 7100-0290. Frequency: FR 29a, annually; FR 29b, on occasion. Reporters: Employers considered competitors for Federal Reserve employees...
2010-08-04
... Decree (``proposed Decree'') in United States of America v. Ray Crosby, Civil Action No. 2:10-cv-00715... portion of EPA's past response costs at the Site. Mr. Crosby owned the Site at the time of the release or.... Department of Justice, Washington D.C. 20044-7611, and should refer to United States of America v. Ray Crosby...
Deller, Timothy W; Khalighi, Mohammad Mehdi; Jansen, Floris P; Glover, Gary H
2018-01-01
rate was 224 kcps at an effective activity concentration of 18.6 kBq/mL, and the count rate curves and scatter fraction curve were consistent for the alternating MR pulsing states. A final test demonstrated quantitative stability during a spiral functional MRI sequence. Conclusion: PET stability metrics demonstrated that PET quantitation was not affected during simultaneous aggressive MRI. This stability enables demanding applications such as kinetic modeling. © 2018 by the Society of Nuclear Medicine and Molecular Imaging.
77 FR 2342 - Fifth Meeting: RTCA, Next Gen Advisory Committee
2012-01-17
... approval of September 29, 2011 meeting summary/ NACSC TORs Revisions Chairman's Report--Chairman Barger..., Federal Aviation Administration. [FR Doc. 2012-540 Filed 1-13-12; 8:45 am] BILLING CODE 4910-13-P ...
29 CFR 32.7 - Designation of responsible employee.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Designation of responsible employee. 32.7 Section 32.7 Labor Office of the Secretary of Labor NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 32.7 Designation of responsible employee. A...
Effects of Demand Response on Retail and Wholesale Power Markets
Energy Technology Data Exchange (ETDEWEB)
Chassin, David P.; Kalsi, Karanjit
2012-07-26
Demand response has grown to be a part of the repertoire of resources used by utilities to manage the balance between generation and load. In recent years, advances in communications and control technology have enabled utilities to consider continuously controlling demand response to meet generation, rather than the other way around. This paper discusses the economic applications of a general method for load resource analysis that parallels the approach used to analyze generation resources and uses the method to examine the results of the US Department of Energy’s Olympic Peninsula Demonstration Testbed. A market-based closed-loop system of controllable assets is discussed with necessary and sufficient conditions on system controllability, observability and stability derived.
The value of online information for demand response in Walrasian electricity markets
F.N. Claessen (Felix); B.J. Liefers (Bart); M. Kaisers (Michael); J.A. La Poutré (Han)
2015-01-01
textabstractSmart energy systems integrate renewables and demand response. Most European electricity markets coordinate the resulting time-varying flexibility in demand and supply by organising day-ahead trade with Walrasian mechanisms, using simultaneous call auctions and sealed bids. These
Responsive demand to mitigate slow recovery voltage sags
DEFF Research Database (Denmark)
Garcia-Valle, Rodrigo; da Silva, Luiz Carlos Pereira; Xu, Zhao
2012-01-01
, and reactive power reserve for peak load management through price responsive methods and also as energy providers through embedded generation technologies. This article introduces a new technology, called demand as voltagecontrolled reserve, which can help mitigation of momentary voltage sags. The technology...... faults. This article presents detailed models, discussion, and simulation tests to demonstrate the technical viability and effectiveness of the demand as voltage-controlled reserve technology for mitigating voltage sags....... can be provided by thermostatically controlled loads as well as other types of load. This technology has proven to be effective in distribution systems with a large composition of induction motors, when voltage sags present slow recovery characteristics because of the deceleration of the motors during...
Kim, Jae G; Zhao, Dawen; Song, Yulin; Constantinescu, Anca; Mason, Ralph P; Liu, Hanli
2003-01-01
This study investigates the correlation of tumor blood oxygenation and tumor pO(2) with respect to carbogen inhalation. After having refined and validated the algorithms for calculating hemoglobin concentrations, we used near-infrared spectroscopy (NIRS) to measure changes of oxygenated hemoglobin concentration (delta[HbO(2)]) and used an oxygen needle electrode and (19)F MRI for pO(2) measurements in tumors. The measurements were taken from Dunning prostate R3327 tumors implanted in rats, while the anesthetized rats breathed air or carbogen. The NIRS results from tumor measurements showed significant changes in tumor vascular oxygenation in response to carbogen inhalation, while the pO(2) electrode results showed an apparent heterogeneity for tumor pO(2) response to carbogen inhalation, which was also confirmed by (19)F MR pO(2) mapping. Furthermore, we developed algorithms to estimate hemoglobin oxygen saturation, sO(2), during gas intervention based on the measured values of delta[HbO(2)] and pO(2). The algorithms have been validated through a tissue-simulating phantom and used to estimate the values of sO(2) in the animal tumor measurement based on the NIRS and global mean pO(2) values. This study demonstrates that the NIRS technology can provide an efficient, real-time, noninvasive approach to monitoring tumor physiology and is complementary to other techniques, while it also demonstrates the need for an NIR imaging technique to study spatial heterogeneity of tumor vasculature under therapeutic interventions. Copyright 2003 Society of Photo-Optical Instrumentation Engineers
Identifying Demand Responses to Illegal Drug Supply Interdictions.
Cunningham, Scott; Finlay, Keith
2016-10-01
Successful supply-side interdictions into illegal drug markets are predicated on the responsiveness of drug prices to enforcement and the price elasticity of demand for addictive drugs. We present causal estimates that targeted interventions aimed at methamphetamine input markets ('precursor control') can temporarily increase retail street prices, but methamphetamine consumption is weakly responsive to higher drug prices. After the supply interventions, purity-adjusted prices increased then quickly returned to pre-treatment levels within 6-12 months, demonstrating the short-term effects of precursor control. The price elasticity of methamphetamine demand is -0.13 to -0.21 for self-admitted drug treatment admissions and between -0.24 and -0.28 for hospital inpatient admissions. We find some evidence of a positive cross-price effect for cocaine, but we do not find robust evidence that increases in methamphetamine prices increased heroin, alcohol, or marijuana drug use. This study can inform policy discussions regarding other synthesized drugs, including illicit use of pharmaceuticals. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.
Autonomic Nervous System Responses to Hearing-Related Demand and Evaluative Threat.
Mackersie, Carol L; Kearney, Lucia
2017-10-12
This paper consists of 2 parts. The purpose of Part 1 was to review the potential influence of internal (person-related) factors on listening effort. The purpose of Part 2 was to present, in support of Part 1, preliminary data illustrating the interactive effects of an external factor (task demand) and an internal factor (evaluative threat) on autonomic nervous system measures. For Part 1, we provided a brief narrative review of motivation and stress as modulators of listening effort. For Part 2, we described preliminary data from a study using a repeated-measures (2 × 2) design involving manipulations of task demand (high, low) and evaluative threat (high, low). The low-demand task consisted of repetition of sentences from a narrative. The high-demand task consisted of answering questions about the narrative, requiring both comprehension and recall. During the high evaluative threat condition, participants were filmed and told that their video recordings would be evaluated by a panel of experts. During the low evaluative threat condition, no filming occurred; participants were instructed to "do your best." Skin conductance (sympathetic nervous system activity) and heart rate variability (HRV, parasympathetic activity) were measured during the listening tasks. The HRV measure was the root mean square of successive differences of adjacent interbeat intervals. Twelve adults with hearing loss participated. Skin conductance increased and HRV decreased relative to baseline (no task) for all listening conditions. Skin conductance increased significantly with an increase in evaluative threat, but only for the more demanding task. There was no significant change in HRV in response to increasing evaluative threat or task demand. Listening effort may be influenced by factors other than task difficulty, as reviewed in Part 1. This idea is supported by the preliminary data indicating that the sympathetic nervous system response to task demand is modulated by social evaluative
Market-based Demand Response via Residential Plug-in Electric Vehicles in Smart Grids
Rassaei, Farshad; Soh, Wee-Seng; Chua, Kee-Chaing
2015-01-01
Flexibility in power demand, diverse usage patterns and storage capability of plug-in electric vehicles (PEVs) grow the elasticity of residential electricity demand remarkably. This elasticity can be utilized to form the daily aggregated demand profile and/or alter instantaneous demand of a system wherein a large number of residential PEVs share one electricity retailer or an aggregator. In this paper, we propose a demand response (DR) technique to manage vehicle-to-grid (V2G) enabled PEVs' e...
Demand response in Germany: Technical potential, benefits and regulatory challenges
Stede, Jan
2016-01-01
An increased flexibility of the electricity demand side through demand response (DR) is an opportunity to support the integration of renewable energies. By optimising the use of the generation, transmission and distribution infrastructure, DR reduces the need for costly investments and contributes to system security. There is a significant technical DR potential for load reduction from industrial production processes in Germany, as well as from cross-cutting technologies in industry and the t...
International Nuclear Information System (INIS)
Choi, Dong Sik; Ryu, Kyung Nam; Kim, Ihn Sub; Rhee, Yong Girl
1998-01-01
To evaluate the diagnostic value of MRI of the shoulder. Between January and June 1997, shoulder MRI and arthroscopy were performed in a total of 48 patients with shoulder pain (n=3D30) or shoulder instability (n=3D18). Forty-five were males and three were females; their ages ranged from 16 to 67 (mean 32.5) years. The period between shoulder MRI and arthroscopy was between one and 390 (mean, 42.2) days. Twenty-six patents underwent MR arthrography (AMR), and 22 conventional MRI(CMR). Each image was analyzed for rotator cuff injury, glenoid labral injury, SLAP lesion, and biceps tendon injury. On arthroscopy, one disease was found in 34 patients, two were found in six, three diseases were found in seven, and one patient had four diseases. Arthroscopic diagnosis was as follows:rotator cuff injury, 29;SLAP lesion, 12;glenoid labral injury, 10;biceps tendon injury, 4;subacromial bursitis, 2;chronic synovitis, 1;adhesive capsulitis, 1;superior glenohumeral ligament injury, 1;normal, 1. For rotator cuff injury, the sensitivity of MRI was 65.5% and specificity was 93.0% (AMR:66.7%, 95.8%, CMR:65.2%, 86.4%). For SLAP lesion, sensitivity was 58.3% and specificity was 97.2% (AMR:66.7%, 100%, CMR:50%, 93.8%);for glenoid labral injury, sensitivity was 80.0% and specificity was 89.5% (AMR:85.7%, 84.2%, CMR:66.7%, 94.7%), and for biceps tendon injury, the false negative rate was 100%. In cases involving glenoid labral injury, the diagnostic accuracy of shoulder MRI was relatively high;in rotator cuff injury and SLAP lesion, however, diagnosis was limited, and in biceps tendon injury was difficult. We suggest, however, that MR arthrography has certain diagnostic advantages over conventional MRI.=20
Energy Technology Data Exchange (ETDEWEB)
Choi, Dong Sik; Ryu, Kyung Nam; Kim, Ihn Sub; Rhee, Yong Girl [Kyunghee Univ., College of Medicine, Seoul (Korea, Republic of)
1998-09-01
To evaluate the diagnostic value of MRI of the shoulder. Between January and June 1997, shoulder MRI and arthroscopy were performed in a total of 48 patients with shoulder pain (n=3D30) or shoulder instability (n=3D18). Forty-five were males and three were females; their ages ranged from 16 to 67 (mean 32.5) years. The period between shoulder MRI and arthroscopy was between one and 390 (mean, 42.2) days. Twenty-six patents underwent MR arthrography (AMR), and 22 conventional MRI(CMR). Each image was analyzed for rotator cuff injury, glenoid labral injury, SLAP lesion, and biceps tendon injury. On arthroscopy, one disease was found in 34 patients, two were found in six, three diseases were found in seven, and one patient had four diseases. Arthroscopic diagnosis was as follows:rotator cuff injury, 29;SLAP lesion, 12;glenoid labral injury, 10;biceps tendon injury, 4;subacromial bursitis, 2;chronic synovitis, 1;adhesive capsulitis, 1;superior glenohumeral ligament injury, 1;normal, 1. For rotator cuff injury, the sensitivity of MRI was 65.5% and specificity was 93.0% (AMR:66.7%, 95.8%, CMR:65.2%, 86.4%). For SLAP lesion, sensitivity was 58.3% and specificity was 97.2% (AMR:66.7%, 100%, CMR:50%, 93.8%);for glenoid labral injury, sensitivity was 80.0% and specificity was 89.5% (AMR:85.7%, 84.2%, CMR:66.7%, 94.7%), and for biceps tendon injury, the false negative rate was 100%. In cases involving glenoid labral injury, the diagnostic accuracy of shoulder MRI was relatively high;in rotator cuff injury and SLAP lesion, however, diagnosis was limited, and in biceps tendon injury was difficult. We suggest, however, that MR arthrography has certain diagnostic advantages over conventional MRI.=20.
Demand response modeling considering Interruptible/Curtailable loads and capacity market programs
International Nuclear Information System (INIS)
Aalami, H.A.; Moghaddam, M. Parsa; Yousefi, G.R.
2010-01-01
Recently, a massive focus has been made on demand response (DR) programs, aimed to electricity price reduction, transmission lines congestion resolving, security enhancement and improvement of market liquidity. Basically, demand response programs are divided into two main categories namely, incentive-based programs and time-based programs. The focus of this paper is on Interruptible/Curtailable service (I/C) and capacity market programs (CAP), which are incentive-based demand response programs including penalties for customers in case of no responding to load reduction. First, by using the concept of price elasticity of demand and customer benefit function, economic model of above mentioned programs is developed. The proposed model helps the independent system operator (ISO) to identify and employ relevant DR program which both improves the characteristics of the load curve and also be welcome by customers. To evaluate the performance of the model, simulation study has been conducted using the load curve of the peak day of the Iranian power system grid in 2007. In the numerical study section, the impact of these programs on load shape and load level, and benefit of customers as well as reduction of energy consumption are shown. In addition, by using strategy success indices the results of simulation studies for different scenarios are analyzed and investigated for determination of the scenarios priority. (author)
Fuel switching? Demand destruction? Gas market responses to price spikes
International Nuclear Information System (INIS)
Lippe, D.
2004-01-01
This presentation defined fuel switching and addressed the issue regarding which consumers have the capability to switch fuels. In response to short term price aberrations, consumers with fuel switching capabilities reduce their use of one fuel and increase consumption of an alternative fuel. For example, natural gas consumption by some consumers declines in response to price spikes relative to prices of alternative fuels. This presentation also addressed the issue of differentiating between fuel switching and demand destruction. It also demonstrated how to compare gas prices versus alternative fuel prices and how to determine when consumers will likely switch fuels. Price spikes have implications for long term trends in natural gas demand, supply/demand balances and prices. The power generating sector represents a particular class of gas consumers that reduce operating rates of gas fired plants and increase operating rates of other plants. Some gas consumers even shut down plants until gas prices declines and relative economies improve. Some practical considerations for fuel switching include storage tank capacity, domestic refinery production, winter heating season, and decline in working gas storage. tabs., figs
LOCUS MR: Localization of unaffected spins in MR tomography and MR spectroscopy
International Nuclear Information System (INIS)
Matthael, D.; Haase, A.
1986-01-01
Different pulse sequences have been proposed for localized in vivo MR spectroscopy. For localized MR tomography and MR spectroscopy, a method is proposed, dubbed LOCUS (LOCalization of Unaffected Spins) MR. The method uses the initial saturation of regions surrounding the region of interest (ROI) in the presence of gradients. This is followed by a conventional MR study of the unaffected ROI. In animals, human extremities, and phantoms, proton MR studies demonstrated that the method provides an optimal signal-to-noise ratio, an easily variable ROI, and ROI shim. The method can be combined with two- and three-dimensional imaging, and it allows localized measurement of MR parameters. The multinuclear capability is discussed
2010-08-16
.... Frequency of Response: Once, except for the SAE Reviewer Worksheet. Affected Public: Includes the Federal...). Board Members CIRB SAE Reviewer Worksheet 10 15 30/60 (.5 hour) 75 (Attachment 6K). Total 2221 Request..., National Institutes of Health. [FR Doc. 2010-20167 Filed 8-13-10; 8:45 am] BILLING CODE 4140-01-P ...
k-t SENSE-accelerated Myocardial Perfusion MR Imaging at 3.0 Tesla - comparison with 1.5 Tesla
Plein, Sven; Schwitter, Juerg; Suerder, Daniel; Greenwood, John P.; Boesiger, Peter; Kozerke, Sebastian
2008-01-01
Purpose To determine the feasibility and diagnostic accuracy of high spatial resolution myocardial perfusion MR at 3.0 Tesla using k-space and time domain undersampling with sensitivity encoding (k-t SENSE). Materials and Methods The study was reviewed and approved by the local ethic review board. k-t SENSE perfusion MR was performed at 1.5 Tesla and 3.0 Tesla (saturation recovery gradient echo pulse sequence, repetition time/echo time 3.0ms/1.0ms, flip angle 15°, 5x k-t SENSE acceleration, spatial resolution 1.3×1.3×10mm3). Fourteen volunteers were studied at rest and 37 patients during adenosine stress. In volunteers, comparison was also made with standard-resolution (2.5×2.5×10mm3) 2x SENSE perfusion MR at 3.0 Tesla. Image quality, artifact scores, signal-to-noise ratios (SNR) and contrast-enhancement ratios (CER) were derived. In patients, diagnostic accuracy of visual analysis to detect >50% diameter stenosis on quantitative coronary angiography was determined by receiver-operator-characteristics (ROC). Results In volunteers, image quality and artifact scores were similar for 3.0 Tesla and 1.5 Tesla, while SNR was higher (11.6 vs. 5.6) and CER lower (1.1 vs. 1.5, p=0.012) at 3.0 Tesla. Compared with standard-resolution perfusion MR, image quality was higher for k-t SENSE (3.6 vs. 3.1, p=0.04), endocardial dark rim artifacts were reduced (artifact thickness 1.6mm vs. 2.4mm, pTesla and 1.5 Tesla, respectively. Conclusions k-t SENSE accelerated high-resolution perfusion MR at 3.0 Tesla is feasible with similar artifacts and diagnostic accuracy as at 1.5 Tesla. Compared with standard-resolution perfusion MR, image quality is improved and artifacts are reduced. PMID:18936311
An Economic Customer-Oriented Demand Response Model in Electricity Markets
DEFF Research Database (Denmark)
Sharifi, Reza; Anvari-Moghaddam, Amjad; Fathi, S. Hamid
2018-01-01
Consumer choice theory is a branch of microeconomics. This theory relates to adjusting consumption expenditures and consumer demand curve. Consumer choice science is trying to realize the buyer's decision-making process. This science studies customer characteristics, such as behavioral criteria......, to understand the consumer’s need. The concept of price elasticity of demand (PED) has also been derived from this theory. In fact, the PED is the percentage of changes in the amount of demand relative to the price changes. In consumer choice theory, for each consumer according to behavioral criteria, a unique...... demand response (DR) models have been developed based on this concept, this will also be deemed as a disadvantage for them. In this paper, we propose an economic DR model based on economic theories and mathematical methods. In addition to abate the defects of price-elasticity based DR models...
International Nuclear Information System (INIS)
Lahrsow, Maximilian; Albrecht, Moritz H.; Bickford, Matthew W.; Vogl, Thomas J.
2017-01-01
PurposeTo use absolute pretreatment apparent diffusion coefficients (ADC) derived from diffusion-weighted MR imaging (DWI) to predict response to repetitive cTACE for unresectable liver metastases of colorectal carcinoma (CRLM) at 1 and 3 months after start of treatment.Materials and MethodsFifty-five metastases in 34 patients were examined with DWI prior to treatment and 1 month after initial cTACE. Treatment was performed in 4-week intervals. Response was evaluated at 1 and 3 months after start of therapy. Metastases showing a decrease of ≥30% in axial diameter were classified as responding lesions.ResultsOne month after initial cTACE, seven lesions showed early response. There was no significant difference in absolute pretreatment ADC values between responding and non-responding lesions (p = 0.94). Three months after initial cTACE, 17 metastases showed response. There was a significant difference (p = 0.021) between absolute pretreatment ADC values of lesions showing response (median 1.08 × 10 −3 mm 2 /s) and no response (median 1.30 × 10 −3 mm 2 /s). Pretreatment ADC showed fair diagnostic value to predict response (AUC 0.7). Lesions showing response at 3 months also revealed a significant increase in ADC between measurements before treatment and at one month after initial cTACE (p < 0.001). Applying an increase in ADC of 12.17%, response at 3 months after initial cTACE could be predicted with a sensitivity and specificity of 77 and 74%, respectively (AUC 0.817). Furthermore, there was a strong and significant correlation (r = 0.651, p < 0.001) between percentage change in size after third cTACE and percentage change in ADC.ConclusionIn patients with CRLM, ADC measurements are potential biomarkers for assessing response to cTACE.
Energy Technology Data Exchange (ETDEWEB)
Lahrsow, Maximilian, E-mail: mlahrsow@gmail.com; Albrecht, Moritz H. [University Hospital Frankfurt, Department of Diagnostic and Interventional Radiology (Germany); Bickford, Matthew W. [Medical University of South Carolina, Department of Radiology and Radiological Science (United States); Vogl, Thomas J. [University Hospital Frankfurt, Department of Diagnostic and Interventional Radiology (Germany)
2017-06-15
PurposeTo use absolute pretreatment apparent diffusion coefficients (ADC) derived from diffusion-weighted MR imaging (DWI) to predict response to repetitive cTACE for unresectable liver metastases of colorectal carcinoma (CRLM) at 1 and 3 months after start of treatment.Materials and MethodsFifty-five metastases in 34 patients were examined with DWI prior to treatment and 1 month after initial cTACE. Treatment was performed in 4-week intervals. Response was evaluated at 1 and 3 months after start of therapy. Metastases showing a decrease of ≥30% in axial diameter were classified as responding lesions.ResultsOne month after initial cTACE, seven lesions showed early response. There was no significant difference in absolute pretreatment ADC values between responding and non-responding lesions (p = 0.94). Three months after initial cTACE, 17 metastases showed response. There was a significant difference (p = 0.021) between absolute pretreatment ADC values of lesions showing response (median 1.08 × 10{sup −3} mm{sup 2}/s) and no response (median 1.30 × 10{sup −3} mm{sup 2}/s). Pretreatment ADC showed fair diagnostic value to predict response (AUC 0.7). Lesions showing response at 3 months also revealed a significant increase in ADC between measurements before treatment and at one month after initial cTACE (p < 0.001). Applying an increase in ADC of 12.17%, response at 3 months after initial cTACE could be predicted with a sensitivity and specificity of 77 and 74%, respectively (AUC 0.817). Furthermore, there was a strong and significant correlation (r = 0.651, p < 0.001) between percentage change in size after third cTACE and percentage change in ADC.ConclusionIn patients with CRLM, ADC measurements are potential biomarkers for assessing response to cTACE.
MR-guided vacuum-assisted breast biopsy of MRI-only lesions: a single center experience
Energy Technology Data Exchange (ETDEWEB)
Spick, Claudio; Schernthaner, Melanie; Pinker, Katja; Kapetas, Panagiotis; Bernathova, Maria; Polanec, Stephan H.; Bickel, Hubert; Wengert, Georg J.; Helbich, Thomas H.; Baltzer, Pascal A. [Medical University of Vienna (AKH), Department of Biomedical Imaging and Image-guided Therapy, Division of Molecular and Gender Imaging, Wien (Austria); Rudas, Margaretha [Medical University of Vienna (AKH), Clinical Institute of Pathology, Wien (Austria)
2016-11-15
The purpose of this study was to compare three different biopsy devices on false-negative and underestimation rates in MR-guided, vacuum-assisted breast biopsy (VABB) of MRI-only lesions. This retrospective, single-center study was IRB-approved. Informed consent was waived. 467 consecutive patients underwent 487 MR-guided VABB using three different 8-10-gauge-VABB devices (Atec-9-gauge,A; Mammotome-8-gauge,M; Vacora-10-gauge,V). VABB data (lesion-type, size, biopsy device, histopathology) were compared to final diagnosis (surgery, n = 210 and follow-up, n = 277). Chi-square, and Kruskal-Wallis tests were applied. P values < 0.05 were considered significant. Final diagnosis was malignant in 104 (21.4 %), high risk in 64 (13.1 %) and benign in 319 (65.5 %) cases. Eleven of 328 (3.4 %) benign-rated lesions were false-negative (1/95, 1.1 %, A; 2/73, 2.7 %, M; 8/160 5.0 % V; P = 0.095). Eleven high-risk (11/77, 14.3 %) lesions proved to be malignant (3/26, 11.5 % A; 4/12, 33.3 % M; 4/39, 10.3 % V; P = 0.228). Five of 34 (14.7 %) DCIS were upgraded to invasive cancer (2/15, 13.3 %, A; 1/6, 16.6 % M; 2/13, 15.3 %, V; P = 0.977). Lesion size (P = 0.05) and type (mass vs. non-mass, P = 0.107) did not differ significantly. MR-guided VABB is an accurate method for diagnosis of MRI-only lesions. No significant differences on false-negative and underestimation rates were observed between three different biopsy devices. (orig.)
Demand Response Opportunities in Industrial Refrigerated Warehouses in California
Energy Technology Data Exchange (ETDEWEB)
Goli, Sasank; McKane, Aimee; Olsen, Daniel
2011-06-14
Industrial refrigerated warehouses that implemented energy efficiency measures and have centralized control systems can be excellent candidates for Automated Demand Response (Auto-DR) due to equipment synergies, and receptivity of facility managers to strategies that control energy costs without disrupting facility operations. Auto-DR utilizes OpenADR protocol for continuous and open communication signals over internet, allowing facilities to automate their Demand Response (DR). Refrigerated warehouses were selected for research because: They have significant power demand especially during utility peak periods; most processes are not sensitive to short-term (2-4 hours) lower power and DR activities are often not disruptive to facility operations; the number of processes is limited and well understood; and past experience with some DR strategies successful in commercial buildings may apply to refrigerated warehouses. This paper presents an overview of the potential for load sheds and shifts from baseline electricity use in response to DR events, along with physical configurations and operating characteristics of refrigerated warehouses. Analysis of data from two case studies and nine facilities in Pacific Gas and Electric territory, confirmed the DR abilities inherent to refrigerated warehouses but showed significant variation across facilities. Further, while load from California's refrigerated warehouses in 2008 was 360 MW with estimated DR potential of 45-90 MW, actual achieved was much less due to low participation. Efforts to overcome barriers to increased participation may include, improved marketing and recruitment of potential DR sites, better alignment and emphasis on financial benefits of participation, and use of Auto-DR to increase consistency of participation.
Demand Response Load Following of Source and Load Systems
DEFF Research Database (Denmark)
Hu, Jianqiang; Cao, Jinde; Yong, Taiyou
2017-01-01
This paper presents a demand response load following strategy for an interconnected source and load system, in which we utilize traditional units and population of cooling thermostatically controlled loads (TCLs) to follow the mismatched power caused by the load activities and the renewable power...... injection in real time. In the demand side of power systems, these TCLs are often affiliated to a bus load agent and can be aggregated to multiple TCL aggregators. Firstly, aggregate evaluation of the TCL aggregator is carried out based on a bilinear aggregate model so as to derive the available regulation...
Movement Demands of Elite Under-20s and Senior International Rugby Union Players.
Directory of Open Access Journals (Sweden)
Daniel J Cunningham
Full Text Available This study compared the movement demands of elite international Under-20 age grade (U20s and senior international rugby union players during competitive tournament match play. Forty elite professional players from an U20 and 27 elite professional senior players from international performance squads were monitored using 10Hz global positioning systems (GPS during 15 (U20s and 8 (senior international tournament matches during the 2014 and 2015 seasons. Data on distances, velocities, accelerations, decelerations, high metabolic load (HML distance and efforts, and number of sprints were derived. Data files from players who played over 60 min (n = 258 were separated firstly into Forwards and Backs, and more specifically into six positional groups; FR-Front Row (prop & hooker, SR-Second Row, BR-Back Row (Flankers & No.8, HB-Half Backs (scrum half & outside half, MF-Midfield (centres, B3 -Back Three (wings & full back for match analysis. Linear mixed models revealed significant differences between U20 and senior teams in both the forwards and backs. In the forwards the seniors covered greater HML distance (736.4 ± 280.3 vs 701.3 ± 198.7m, p = 0.01 and severe decelerations (2.38 ± 2.2 vs 2.28 ± 1.65, p = 0.05 compared to the U20s, but performed less relative HSR (3.1 ± 1.6 vs 3.2 ± 1.5, p < 0.01, moderate (19.4 ± 10.5 vs 23.6 ± 10.5, p = 0.01 and high accelerations (2.2 ± 1.9 vs 4.3 ± 2.7, p < 0.01 and sprint•min-1 (0.11 ± 0.06 vs 0.11 ± 0.05, p < 0.01. Senior backs covered a greater relative distance (73.3 ± 8.1 vs 69.1 ± 7.6 m•min-1, p < 0.01, greater High Metabolic Load (HML distance (1138.0 ± 233.5 vs 1060.4 ± 218.1m, p < 0.01, HML efforts (112.7 ± 22.2 vs 98.8 ± 21.7, p < 0.01 and heavy decelerations (9.9 ± 4.3 vs 9.5 ± 4.4, p = 0.04 than the U20s backs. However, the U20s backs performed more relative HSR (7.3 ± 2.1 vs 7.2 ± 2.1, p <0.01 and sprint•min-1 (0.26 ± 0.07 vs 0.25 ± 0.07, p < 0.01. Further investigation
MR imaging at 0.5 Tesla with FLAIR sequence in the diagnosis of acute subarachnoid hemorrhage
International Nuclear Information System (INIS)
Kopsa, W.; Leitner, H.; Tscholakoff, D.; Perneczky, G.
1998-01-01
Purpose: Evaluation of MR imaging in patients with acute subarachnoid hemorrhage (SAH) at 0.5 Tesla using the FLAIR (Fluid Attenuated Inversion Recovery) sequenze. Additionally, the value of MR angiographie (MRA) in the diagnosis of intracranial aneurysms was assessed. Materials and Methods: 19 patients with suspected acute SAH were included in this study. MR imaging was performed using an axial FLAIR sequence and axial T 1 , T 2 and PD weighted sequences. In 16 patients an additional MRA (3D-TOF) was performed. 10 patients without SAH were examined as a control group. At the end of the study the 29 MR examinations were randomised and the images were read by two experienced radiologists; subsequently a consensus interpretation was made. Results: In 16 patients an acute SAH was verified with the FLAIR sequence, in 13 cases the origin of hemorrhage was found during surgery. In the consensus interpretation of the MR images all cases were diagnosed properly. 12 of the 16 MRA studies were of diagnostic quality, but only 6 cases were interpreted correctly. Conclusion: The FLAIR sequence at 0.5 Tesla proved effective in the diagnosis of acute SAH. MRA at 0.5 Tesla failed in the detection of intracranial aneurysms. (orig.) [de
Hepatic iron overload: Quantitative MR imaging
International Nuclear Information System (INIS)
Gomori, J.M.; Horev, G.; Tamary, H.; Zandback, J.; Kornreich, L.; Zaizov, R.; Freud, E.; Krief, O.; Ben-Meir, J.; Rotem, H.
1991-01-01
Iron deposits demonstrate characteristically shortened T2 relaxation times. Several previously published studies reported poor correlation between the in vivo hepatic 1/T2 measurements made by means of midfield magnetic resonance (MR) units and the hepatic iron content of iron-overloaded patients. In this study, the authors assessed the use of in vivo 1/T2 measurements obtained by means of MR imaging at 0.5 T using short echo times (13.4 and 30 msec) and single-echo-sequences as well as computed tomographic (CT) attenuation as a measure of liver iron concentration in 10 severely iron-overloaded patients with beta-thalassemia major. The iron concentrations in surgical wedge biopsy samples of the liver, which varied between 3 and 9 mg/g of wet weight (normal, less than or equal to 0.5 mg/g), correlated well (r = .93, P less than or equal to .0001) with the preoperative in vivo hepatic 1/T2 measurements. The CT attenuation did not correlate with liver iron concentration. Quantitative MR imaging is a readily available noninvasive method for the assessment of hepatic iron concentration in iron-overloaded patients, reducing the need for needle biopsies of the liver
International Nuclear Information System (INIS)
2003-01-01
The Ontario Energy Board was directed in June 2003 to consult with stakeholders to identify and review options for the delivery of demand-side management (DSM) and demand response (DR) activities within the electricity sector, including the role of local distribution companies (distributors) in such activities. A total of 118 stakeholders participated in the consultation process, and 31 representatives from all sectors were then invited to take part in an advisory working group to develop options to be considered by the Board when preparing the recommendations to the Minister. This report presents a consolidation of the Group's working documents and the results of deliberations both as a unit and in small groups. The best way to present the many newly developed models was as a single Central Agency model demonstrating variations in the role of the Central Agency and other players in the electricity market. The paper was divided into the following six sections: introduction; market issues; demand response framework option; central agency framework-alternative models; Ontario Energy Board-wires companies DSM framework; and, general issues
Blockchain Based Decentralized Management of Demand Response Programs in Smart Energy Grids
Pop, Claudia; Cioara, Tudor; Antal, Marcel; Anghel, Ionut; Salomie, Ioan; Bertoncini, Massimo
2018-01-01
In this paper, we investigate the use of decentralized blockchain mechanisms for delivering transparent, secure, reliable, and timely energy flexibility, under the form of adaptation of energy demand profiles of Distributed Energy Prosumers, to all the stakeholders involved in the flexibility markets (Distribution System Operators primarily, retailers, aggregators, etc.). In our approach, a blockchain based distributed ledger stores in a tamper proof manner the energy prosumption information collected from Internet of Things smart metering devices, while self-enforcing smart contracts programmatically define the expected energy flexibility at the level of each prosumer, the associated rewards or penalties, and the rules for balancing the energy demand with the energy production at grid level. Consensus based validation will be used for demand response programs validation and to activate the appropriate financial settlement for the flexibility providers. The approach was validated using a prototype implemented in an Ethereum platform using energy consumption and production traces of several buildings from literature data sets. The results show that our blockchain based distributed demand side management can be used for matching energy demand and production at smart grid level, the demand response signal being followed with high accuracy, while the amount of energy flexibility needed for convergence is reduced. PMID:29315250
Blockchain Based Decentralized Management of Demand Response Programs in Smart Energy Grids.
Pop, Claudia; Cioara, Tudor; Antal, Marcel; Anghel, Ionut; Salomie, Ioan; Bertoncini, Massimo
2018-01-09
In this paper, we investigate the use of decentralized blockchain mechanisms for delivering transparent, secure, reliable, and timely energy flexibility, under the form of adaptation of energy demand profiles of Distributed Energy Prosumers, to all the stakeholders involved in the flexibility markets (Distribution System Operators primarily, retailers, aggregators, etc.). In our approach, a blockchain based distributed ledger stores in a tamper proof manner the energy prosumption information collected from Internet of Things smart metering devices, while self-enforcing smart contracts programmatically define the expected energy flexibility at the level of each prosumer, the associated rewards or penalties, and the rules for balancing the energy demand with the energy production at grid level. Consensus based validation will be used for demand response programs validation and to activate the appropriate financial settlement for the flexibility providers. The approach was validated using a prototype implemented in an Ethereum platform using energy consumption and production traces of several buildings from literature data sets. The results show that our blockchain based distributed demand side management can be used for matching energy demand and production at smart grid level, the demand response signal being followed with high accuracy, while the amount of energy flexibility needed for convergence is reduced.
Blockchain Based Decentralized Management of Demand Response Programs in Smart Energy Grids
Directory of Open Access Journals (Sweden)
Claudia Pop
2018-01-01
Full Text Available In this paper, we investigate the use of decentralized blockchain mechanisms for delivering transparent, secure, reliable, and timely energy flexibility, under the form of adaptation of energy demand profiles of Distributed Energy Prosumers, to all the stakeholders involved in the flexibility markets (Distribution System Operators primarily, retailers, aggregators, etc.. In our approach, a blockchain based distributed ledger stores in a tamper proof manner the energy prosumption information collected from Internet of Things smart metering devices, while self-enforcing smart contracts programmatically define the expected energy flexibility at the level of each prosumer, the associated rewards or penalties, and the rules for balancing the energy demand with the energy production at grid level. Consensus based validation will be used for demand response programs validation and to activate the appropriate financial settlement for the flexibility providers. The approach was validated using a prototype implemented in an Ethereum platform using energy consumption and production traces of several buildings from literature data sets. The results show that our blockchain based distributed demand side management can be used for matching energy demand and production at smart grid level, the demand response signal being followed with high accuracy, while the amount of energy flexibility needed for convergence is reduced.
International Nuclear Information System (INIS)
Feuerriegel, Stefan; Neumann, Dirk
2016-01-01
Demand Response allows for the management of demand side resources in real-time; i.e. shifting electricity demand according to fluctuating supply. When integrated into electricity markets, Demand Response can be used for load shifting and as a replacement for both control reserve and balancing energy. These three usage scenarios are compared based on historic German data from 2011 to determine that load shifting provides the highest benefit: its annual financial savings accumulate to €3.110 M for both households and the service sector. This equals to relative savings of 2.83% compared to a scenario without load shifting. To improve Demand Response integration, the proposed model suggests policy implications: reducing bid sizes, delivery periods and the time-lag between market transactions and delivery dates in electricity markets. - Highlights: •Comparison of 3 scenarios to integrate Demand Response into electricity markets. •These are: optimize procurement, offer as control reserve, avoid balancing energy. •Ex post simulation to quantify financial impact and policy implications. •Highest savings from load shifting with a cost reduction of 3%. •Model suggests reducing bid sizes, delivery periods and time lags as policy issues.
Deep Learning MR Imaging-based Attenuation Correction for PET/MR Imaging.
Liu, Fang; Jang, Hyungseok; Kijowski, Richard; Bradshaw, Tyler; McMillan, Alan B
2018-02-01
Purpose To develop and evaluate the feasibility of deep learning approaches for magnetic resonance (MR) imaging-based attenuation correction (AC) (termed deep MRAC) in brain positron emission tomography (PET)/MR imaging. Materials and Methods A PET/MR imaging AC pipeline was built by using a deep learning approach to generate pseudo computed tomographic (CT) scans from MR images. A deep convolutional auto-encoder network was trained to identify air, bone, and soft tissue in volumetric head MR images coregistered to CT data for training. A set of 30 retrospective three-dimensional T1-weighted head images was used to train the model, which was then evaluated in 10 patients by comparing the generated pseudo CT scan to an acquired CT scan. A prospective study was carried out for utilizing simultaneous PET/MR imaging for five subjects by using the proposed approach. Analysis of covariance and paired-sample t tests were used for statistical analysis to compare PET reconstruction error with deep MRAC and two existing MR imaging-based AC approaches with CT-based AC. Results Deep MRAC provides an accurate pseudo CT scan with a mean Dice coefficient of 0.971 ± 0.005 for air, 0.936 ± 0.011 for soft tissue, and 0.803 ± 0.021 for bone. Furthermore, deep MRAC provides good PET results, with average errors of less than 1% in most brain regions. Significantly lower PET reconstruction errors were realized with deep MRAC (-0.7% ± 1.1) compared with Dixon-based soft-tissue and air segmentation (-5.8% ± 3.1) and anatomic CT-based template registration (-4.8% ± 2.2). Conclusion The authors developed an automated approach that allows generation of discrete-valued pseudo CT scans (soft tissue, bone, and air) from a single high-spatial-resolution diagnostic-quality three-dimensional MR image and evaluated it in brain PET/MR imaging. This deep learning approach for MR imaging-based AC provided reduced PET reconstruction error relative to a CT-based standard within the brain compared
Energy Technology Data Exchange (ETDEWEB)
Lee, Jeong Min; Kang, Sung Gwon; Byun, Joo Nam; Kim, Young Cheol; Choi, Jeong Yeol; Kim, Dong Hyun [College of Medicine, Chosun Univ., Kwangju (Korea, Republic of)
2002-07-01
To compare the three-dimensional gadolinium-enhanced MR angiography with digital subtraction angiography (DSA) for evaluation of the pedal artery. In 12 extremities of 11 patients, both digital subtraction angiography (DSA) and contrast-enhanced MR angiography (CE-MR angiography) were performed during the same week. Among ten of the 11 patients, the following conditions were present: atherosclerosis (n=4), diabetic foot (n=3), Buerger's disease (n=1), calciphylactic arteriopathy (n=1) and arteriovenous malformation of the foot (n=1). The remaining patient underwent angiography prior to flap surgery. For MR angiography, a 1.5T system using an extremity or head coil was used. A three-dimensional FISP (fast imaging with steady state precession) sequence was obtained before enhancement, followed by four sequential acquisitions (scan time, 20 secs, scan interval time, 10 secs) 10 seconds after intravenous bolus injection of normal saline (total 10 cc), following intravenous administration of gadolinium (0.02 mmol/kg, 3 ml/sec). Arterial segments of the ankle and foot were classified as the anterior or posterior tibial artery, the distal peroneal artery, the medial or lateral plantar artery, the pedal arch, and the dorsalis pedis artery. Two radiologists independently analysed visualization of each arteraial segment and the mean of visible arterial segments in one extreminty using CE-MR angiography and DSA. Among 84 arterial segments, 16 were invisible at both CE-MR angiography and DSA, while 39 were demonstrated by both modalities. Twenty-six segments were visible only at CE-MR angiography and three only at DSA. CE-MR angiography displayed a higher number of arterial segments than DSA (mean, 5.42 vs. mean 3.50, respectively), a difference which was statistically significant (p<0.000). The difference between each arterial segment was not statistically significant, except for the dorsalis pedis artery (t test, p<0.000). In that it provides additional information for
Energy Technology Data Exchange (ETDEWEB)
Santoro, C.; Filho, J.A [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Energia Nuclear; Santos, M.A.P.; Filho, L.C.G., E-mail: chsantoro@gmail.com, E-mail: masantos@cnen.gov.br, E-mail: l.filho@cnen.gov.br, E-mail: jaf@ufpe.br [Centro Regional de Ciencias Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil)
2013-10-15
Characteristics of a phantom designed to evaluate the personal dose equivalent, H{sub P}(10), and appropriate for photographic dosimetry are presented. It is called HP(10) phantom due to cavities constructed to insert dosimetric films at a depth of 10 mm. The H{sub P}(10) phantom is irradiated with ionizing radiation energy, E, from 45 to 1250 keV, with doses ranging from 0.2 to 50 mSv. It is positioned in the direction α = 0 °, and the radiation field focusing perpendicular to its front surface. So, are established calibration curves of dosimeters in the position conventionally true and quantities H{sub P}(10). It made a comparison between the responses obtained with the H{sub P}(10) phantom and responses obtained when using the calibration procedure recommended by ISO dosimeters. The ISO recommends getting the air kerma, Ka, for photons at test point of the radiation field by an ionization chamber. And through conversion coefficients, h{sub pK} (10; E, α), becomes the air kerma for H{sub P}(10). The ISO 4037-3 recommendation has been studied by researchers to ensure that the low energy spectral differences occur in radiation fields which are generated by various X-ray equipment, and induce changes in the percentages of conversion coefficients on the order of 10% to 90% . On the basis of the recommendations ISO, this article develops phantom able to assess the dose to the influence of scattering and absorption of radiation, its implications with respect to dosimetry, providing improvement in the assessment of doses. (author)
Effect of seven different additives on the properties of MR fluids
Energy Technology Data Exchange (ETDEWEB)
Zhang, J Q; Zhang, J; Jing, Q [Department of Technical Support Engineering, Academy of Armored Force Engineering, Beijing 100072 (China)], E-mail: zhangjq63@yahoo.com.cn
2009-02-01
Magnetorheological (MR) fluids have been developed for application in semi-active magnetorheological fluid dampers and other magnetorheological fluid devices. In order to prepare special MR fluids to satisfy the demands of tracked vehicle, two different carrier fluids were chose to prepare MR fluids. Preparation of MR fluids, which are based on carriers such as special shock absorption fluid and 45 transformer oil, was finished. And characteristics of these samples were tested and analyzed. Results indicate, Tween-80 and Span-80 can improve sedimentary stability. Using 45 transformer oil instead of special shock absorption fluid as a carrier, the shear yield stress remains nearly invariable but the viscosity and the sedimentary stability are reduced. MR fluids with diameter of 2.73{mu}m show better sedimentary stability than that of the MR fluids with diameter of 2.3{mu}m, or 4.02{mu}m. Stearic acid obviously improves sedimentary stability and off-state viscosity, but don't perform an obvious function on shear yield stress. In magnetic field of 237KA/m, the shear yield stress of MR fluid based on special shock absorption fluid and 45 transformer oil is 18.34KPa, 14.26KPa, respectively.
Energy Technology Data Exchange (ETDEWEB)
Hale, Elaine
2015-07-30
Demand response may be a valuable flexible resource for low-carbon electric power grids. However, there are as many types of possible demand response as there are ways to use electricity, making demand response difficult to study at scale in realistic settings. This talk reviews our state of knowledge regarding the potential value of demand response in several example systems as a function of increasing levels of wind and solar power, sometimes drawing on the analogy between demand response and storage. Overall, we find demand response to be promising, but its potential value is very system dependent. Furthermore, demand response, like storage, can easily saturate ancillary service markets.
76 FR 2618 - Minnesota: Final Authorization of State Hazardous Waste Management Program Revision
2011-01-14
... Contaminated Cadmium-, Mercury-, and Silver-Containing Batteries Checklist 201. Hazardous Waste Management June... Restrictions May 26, 1998, 63 MR 7045.1390; Phase IV; Hazardous Soils FR 28556. Effective June 22, Treatment...); Effective February 14, 2005. Hazardous Remediation Waste November 30, MR 7001.0060; Management Requirements...
2012-11-16
.... Neff submitted a synthetic urine sample as specimen Y22362385, and documented in writing on the... Mr. Neff had deliberately submitted a synthetic urine sample as a specimen for a FFD drug test and... on electronic storage media. Participants may not submit paper copies of their filings unless they...
29 CFR 1922.4 - Responsibilities of the Board; voting.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Responsibilities of the Board; voting. 1922.4 Section 1922.4 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION... WORKERS' COMPENSATION ACT § 1922.4 Responsibilities of the Board; voting. (a) Determinations and...
{sup 31}P MR spectroscopic measurement of intracellular pH in normal human hearts
Energy Technology Data Exchange (ETDEWEB)
Kwon, Jae Hyun; Lee, Hui Joong; Jang, Yong Min [Kyungpook National Univ., Taegu (Korea, Republic of)] [and others
2002-05-01
To assess the usefulness of intracellular pH (pHi), calculated by determining the shift of a high-energy metabolite such as inorganic phosphate (Pi) of {gamma}-ATP after performing MRS with ECG-gated two-dimensional {sup 31}P CSI (chemical shift imaging), as a parameter for the overall state of the intracellular milieu. Proto decoupled {sup 31}P CSI was performed on a 1.5-T scanner using a {sup 1}H{sup 31}P dual-tuned surface coil. Cardiac MRS data were obtained from eight normal volunteers aged 24-32 years with no history of heart disease. From the spectra obtained from several regions of the heart, peack position and peak area were estimated. The metabolic ratios of {alpha}-, {beta}-, {gamma}-ATP, PCr, Pi, phosphodiester and diphosphoglycerate were calculated, and pHi was estimated from the chemical shift of Pi and {gamma}-ATP resonance. We then compared the data for the anterior myocardium with those previously published. The major phosphorous metabolites identified in these human hearts were as follows: PCr, at -0.1 to +0.1 ppm; three phosphate peaks from ATP, with a chemical shift centered at about -2.7 ppm ({gamma}-ATP), -7.8 ppm ({alpha}-ATP), and -16.3 ppm ({beta}-ATP); and phosphodiester (PDE) at 2-3 ppm, inorganic phosphate (Pi) at 4.5-5.4 ppm, and diphosphoglycerate (DPG) at 5.4-6.3 ppm. The PCr/{beta}-ATP ratio was 2.20{+-}0.17 and the PDE/{beta}-ATP ratio, 1.04{+-}0.09 pHi readings were 7.31{+-}0.23 (calculated by the shift of Pi) and 6.81{+-}0.20 (calculated by the shift of {gamma}-ATP). Pi/PCR was 0.539, a ratio higher than that mentioned in previously published reports. The measurement of intracellular metabolism was affected by various kinds of factors. We believe, however, that pHi readings indicate the overall state of the cardiac intracellular milieu. An unexpected pHi readings, seen at MRS, may reflect errors in the MR procedure itself and, or in the analytical method.
Evaluation of automated residential demand response with flat and dynamic pricing
International Nuclear Information System (INIS)
Swisher, Joel; Wang, Kitty; Stewart, Stewart
2005-01-01
This paper reviews the performance of two recent automated load management programs for residential customers of electric utilities in two American states. Both pilot programs have been run with about 200 participant houses each, and both programs have control populations of similar customers without the technology or program treatment. In both cases, the technology used in the pilot is GoodWatts, an advanced, two-way, real-time, comprehensive home energy management system. The purpose of each pilot is to determine the household kW reduction in coincident peak electric load from the energy management technology. Nevada Power has conducted a pilot program for Air-Conditioning Load Management (ACLM), in which customers are sent an electronic curtailment signal for three-hour intervals during times of maximum peak demand. The participating customers receive an annual incentive payment, but otherwise they are on a conventional utility tariff. In California, three major utilities are jointly conducting a pilot demonstration of an Automated Demand Response System (ADRS). Customers are on a time-of-use (ToU) tariff, which includes a critical peak pricing (CPP) element. During times of maximum peak demand, customers are sent an electronic price signal that is three times higher than the normal on-peak price. Houses with the automated GoodWatts technology reduced their demand in both the ACLM and the ADRS programs by about 50% consistently across the summer curtailment or super peak events, relative to homes without the technology or any load management program or tariff in place. The absolute savings were greater in the ACLM program, due to the higher baseline air conditioning loads in the hotter Las Vegas climate. The results suggest that either automated technology or dynamic pricing can deliver significant demand response in low-consumption houses. However, for high-consumption houses, automated technology can reduce load by a greater absolute kWh difference. Targeting
Quantitative MR evaluation of body composition in patients with Duchenne muscular dystrophy
Energy Technology Data Exchange (ETDEWEB)
Pichiecchio, Anna; Uggetti, Carla; Egitto, Maria Grazia [Department of Neuroradiology, Istituto Neurologico ' ' Fondazione C.Mondino' ' I.R.C.C.S, Via Palestro, 3, 27100 Pavia (Italy); Berardinelli, Angela; Orcesi, Simona; Gorni, Ksenija Olga Tatiana [Department of Neuropsychiatry, Istituto Neurologico ' ' Fondazione C.Mondino' ' I.R.C.C.S, Via Palestro, 3, 27100 Pavia (Italy); Zanardi, Cristina; Tagliabue, Anna [Department of Human Nutrition, Cascina Cravino, Via Bassi, 23, 27100 Pavia (Italy)
2002-11-01
The aim of this study was to propose a quantitative MR protocol with very short acquisition time and good reliability in volume construction, for the evaluation of body composition in patients affected by Duchenne muscular dystrophy (DMD). This MR protocol was compared with common anthropometric evaluations of the same patients. Nine boys affected by DMD, ranging in age from 6 to 12 years, were selected to undergo MR examination. Transversal T1-weighted spin-echo sequences (0.5T; TR 300 ms, TE 10 ms, slice thickness 10 mm, slice gap 1 mm) were used for all acquisitions, each consisting of 8 slices and lasting just 54 s. Whole-body examination needed an average of nine acquisitions. Afterwards, images were downloaded to an independent workstation and, through their electronic segmentation with a reference filter, total volume and adipose tissue volumes were calculated manually. This process took up to 2 h for each patient. The MR data were compared with anthropometric evaluations. Affected children have a marked increase in adipose tissue and a decrease in lean tissue compared with reference healthy controls. Mean fat mass calculated by MR is significantly higher than mean fat mass obtained using anthropometric measurements (p<0.001). Our MR study proved to be accurate and easy to apply, although it was time-consuming. We recommend it in monitoring the progression of the disease and planning DMD patients' diet. (orig.)
Quantitative MR evaluation of body composition in patients with Duchenne muscular dystrophy
International Nuclear Information System (INIS)
Pichiecchio, Anna; Uggetti, Carla; Egitto, Maria Grazia; Berardinelli, Angela; Orcesi, Simona; Gorni, Ksenija Olga Tatiana; Zanardi, Cristina; Tagliabue, Anna
2002-01-01
The aim of this study was to propose a quantitative MR protocol with very short acquisition time and good reliability in volume construction, for the evaluation of body composition in patients affected by Duchenne muscular dystrophy (DMD). This MR protocol was compared with common anthropometric evaluations of the same patients. Nine boys affected by DMD, ranging in age from 6 to 12 years, were selected to undergo MR examination. Transversal T1-weighted spin-echo sequences (0.5T; TR 300 ms, TE 10 ms, slice thickness 10 mm, slice gap 1 mm) were used for all acquisitions, each consisting of 8 slices and lasting just 54 s. Whole-body examination needed an average of nine acquisitions. Afterwards, images were downloaded to an independent workstation and, through their electronic segmentation with a reference filter, total volume and adipose tissue volumes were calculated manually. This process took up to 2 h for each patient. The MR data were compared with anthropometric evaluations. Affected children have a marked increase in adipose tissue and a decrease in lean tissue compared with reference healthy controls. Mean fat mass calculated by MR is significantly higher than mean fat mass obtained using anthropometric measurements (p<0.001). Our MR study proved to be accurate and easy to apply, although it was time-consuming. We recommend it in monitoring the progression of the disease and planning DMD patients' diet. (orig.)
Huang, Y.; Liu, B. Z.; Wang, K. Y.; Ai, X.
2017-12-01
In response to the new requirements of the operation mode of wind-storage combined system and demand side response for transmission network planning, this paper presents a joint planning of energy storage and transmission considering wind-storage combined system and demand side response. Firstly, the charge-discharge strategy of energy storage system equipped at the outlet of wind farm and demand side response strategy are analysed to achieve the best comprehensive benefits through the coordination of the two. Secondly, in the general transmission network planning model with wind power, both energy storage cost and demand side response cost are added to the objective function. Not only energy storage operation constraints and but also demand side response constraints are introduced into the constraint condition. Based on the classical formulation of TEP, a new formulation is developed considering the simultaneous addition of the charge-discharge strategy of energy storage system equipped at the outlet of the wind farm and demand side response strategy, which belongs to a typical mixed integer linear programming model that can be solved by mature optimization software. The case study based on the Garver-6 bus system shows that the validity of the proposed model is verified by comparison with general transmission network planning model. Furthermore, the results demonstrate that the joint planning model can gain more economic benefits through setting up different cases.
International Nuclear Information System (INIS)
Barkhof, F.; Kouwenhoven, M.; Scheltens, P.; Sprenger, M.; Algra, P.; Valk, J.
1994-01-01
Cine phase-contrast MR imaging was used to study pulsatile CSF flow in the aqueduct in 11 young controls (mean age 30 years) and 9 old controls (mean age 69 years). A high-resolution gradient echo technique and an oblique imaging plane, perpendicular to the aqueduct, was used to avoid volume averaging. Phantom studies confirmed that the technique was accurate. Aqueductal velocity and flux in old controls was higher than in young controls, but the differences were not significant. For all controls together, the averaged peak velocity was 4.2 ± 1.5 cm/s in rostral and -7.8 ± 4.9 cm/s in caudal direction; for the flux it was 0.16 ± 0.10 cm 3 /s in rostral and -0.29 ± 0.19 cm 3 /s in caudal direction. Phase-contrast measurements were significantly related to flow-void on modulus MR images, but not with ventricular size or cortical atrophy. The present technique avoids underestimation of aqueductal flow, and therefore reveals higher aqueductal velocity and flux values than previous studies. Factors other than age or atrophy seem to determine aqueductal CSF flow. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Kim, Jung Sik; Woo, Young Hoon; Joo, Yang Goo; Lee, Sung Moon; Zeon, Seok Kil; Suh, Soo Jhi; Kang, Chang Soo [School of Medicine, Keimyung University, Taegu (Korea, Republic of)
1992-03-15
To explore the ability of magnetic resonance imaging(MRI) in the diagnosis of avascular necrosis(AVN) of the femoral head, we compared appearances on MRI of 85 proven AVN lesions with those on radiographs(n=79) and radionuclide scans(n=75). Clinical symptoms(n=85) were also correlated. All MR studies included coronal and axial T1WI and coronal T2WI. All lesions involved the anterosuperterior aspect of the femoral head and were surrounded by a low signal intensity rim on both T1 and T2WI. The signal intensity of the lesions was variable depending on the disease course, and the lesions were divided into four classes according to the classification suggested by Mitchell. Radiographs were normal in 16%(13/79) of the lesions which were in MR class A(10), B(1), C(2). The radionuclide scans showed normal in 16%(12/75) of the lesions which were in MR class A(8). B(1), C(2), D(1). On the other hand, 93% of the lesions with MR class A(27/29) showed stage 1 and 2 lesions on radiographs. Clinical symptoms were absent in 25%(21/85) of the lesions, and among these,81%(17/21) were MR class A. Conclusively, MR is superior to the radiography and radionuclide scan in the early detection of AVN, and can also show the exact location, extent and signal characteristic of the lesion. Therefore, Mr is essential in diagnosis and management of AVN.
International Nuclear Information System (INIS)
Kim, Jung Sik; Woo, Young Hoon; Joo, Yang Goo; Lee, Sung Moon; Zeon, Seok Kil; Suh, Soo Jhi; Kang, Chang Soo
1992-01-01
To explore the ability of magnetic resonance imaging(MRI) in the diagnosis of avascular necrosis(AVN) of the femoral head, we compared appearances on MRI of 85 proven AVN lesions with those on radiographs(n=79) and radionuclide scans(n=75). Clinical symptoms(n=85) were also correlated. All MR studies included coronal and axial T1WI and coronal T2WI. All lesions involved the anterosuperterior aspect of the femoral head and were surrounded by a low signal intensity rim on both T1 and T2WI. The signal intensity of the lesions was variable depending on the disease course, and the lesions were divided into four classes according to the classification suggested by Mitchell. Radiographs were normal in 16%(13/79) of the lesions which were in MR class A(10), B(1), C(2). The radionuclide scans showed normal in 16%(12/75) of the lesions which were in MR class A(8). B(1), C(2), D(1). On the other hand, 93% of the lesions with MR class A(27/29) showed stage 1 and 2 lesions on radiographs. Clinical symptoms were absent in 25%(21/85) of the lesions, and among these,81%(17/21) were MR class A. Conclusively, MR is superior to the radiography and radionuclide scan in the early detection of AVN, and can also show the exact location, extent and signal characteristic of the lesion. Therefore, Mr is essential in diagnosis and management of AVN
Province gets serious about demand management
International Nuclear Information System (INIS)
Anon
2003-01-01
Directives from the Minister to the Ontario Energy Board to review options for demand-side management and demand reduction activities, and discussion papers describing the policy framework needed to implement demand management, are indications of renewed interest by the provincial government in demand-side management of Ontario's electric power supply. This renewed interest comes on the hills of a 5.5 per cent increase in electricity use, a 33 per cent increase in imports, and consumption records broken in 10 of the last 12 months. A 117-page study was released in April by Navigant Consulting, entitled 'Demand response blueprint for Ontario' which estimates that if the Ontario market had 250 MW of additional demand response, customers providing the demand response would have saved $20 million by reducing their demand when HOEP was greater than $120/MWh, while other customers would have saved $170 million due to lower HOEP, and would have enjoyed greater reliability as a result of the increase in reserve margins. Other than price signals to induce customers to save, the Navigant report suggest paying customers not to consume during peak periods. The report estimates that such a policy could generate a total demand response of 350 MW and a $235 million reduction in revenue to generators. The Navigan report also includes a large number of detailed analysis and recommendations. One among them is for the extensive use of interval meters for customers with loads over 200 kW. The report tends to be critical of the recent price freeze ordered by the Ontario government, claiming that the freeze could increase consumption, making prices more volatile and increasing the cost to the government even more. Successful demand response programs from California, New York and the New England states are cited as examples for Ontario to emulate
Directory of Open Access Journals (Sweden)
McVeigh Elliot R
2009-08-01
Full Text Available Abstract Background Catheter visualization and tracking remains a challenge in interventional MR. Active guidewires can be made conspicuous in "profile" along their whole shaft exploiting metallic core wire and hypotube components that are intrinsic to their mechanical performance. Polymer-based catheters, on the other hand, offer no conductive medium to carry radio frequency waves. We developed a new "active" catheter design for interventional MR with mechanical performance resembling braided X-ray devices. Our 75 cm long hybrid catheter shaft incorporates a wire lattice in a polymer matrix, and contains three distal loop coils in a flexible and torquable 7Fr device. We explored the impact of braid material designs on radiofrequency and mechanical performance. Results The incorporation of copper wire into in a superelastic nitinol braided loopless antenna allowed good visualization of the whole shaft (70 cm in vitro and in vivo in swine during real-time MR with 1.5 T scanner. Additional distal tip coils enhanced tip visibility. Increasing the copper:nitinol ratio in braiding configurations improved flexibility at the expense of torquability. We found a 16-wire braid of 1:1 copper:nitinol to have the optimum balance of mechanical (trackability, flexibility, torquability and antenna (signal attenuation properties. With this configuration, the temperature increase remained less than 2°C during real-time MR within 10 cm horizontal from the isocenter. The design was conspicuous in vitro and in vivo. Conclusion We have engineered a new loopless antenna configuration that imparts interventional MR catheters with satisfactory mechanical and imaging characteristics. This compact loopless antenna design can be generalized to visualize the whole shaft of any general-purpose polymer catheter to perform safe interventional procedures.
Feasibility of MR urography in patients with urinary diversion
International Nuclear Information System (INIS)
Battal, Bilal; Kocaoglu, Murat; Ilica, Turan; Akgun, Veysel; Aydur, Emin; Dayanc, Murat
2011-01-01
The aims of this study were to determine the diagnostic value of MR urography and to compare the T2- and T1-weighted MR urography techniques in patients with urinary diversion. We retrospectively reviewed 19 MR urograms in 14 patients (13 male and one female, 8–77 years old, mean age: 54.2) with urinary diversion. Magnetic resonance urography examinations were performed with 1.5-T MR scanners. In addition to T2- and T1-weighted MR urography techniques, conventional T1- and T2-weighted axial and coronal sequences were also obtained. Collecting systems were evaluated in five segments (right proximal and distal collecting system, left proximal and distal collecting system and conduit or reservoir). Imaging features of the urinary collecting systems were evaluated with T2- and T1-weighted MR urography images. The clinical, laboratory data and follow-up imaging findings were regarded as standard. A cross table was formed to determine sensitivity, specificity and accuracy of MR urography techniques. T2-weighted MR urography, T1-weighted MR urography and combination of these two techniques could demonstrate 89.01, 87.65 and 93.83% of all collecting system segments, respectively. For the detection of the pathologic urinary segments, sensitivity, specificity and accuracy were 100, 95.29 and 95.6% in T2-weighted MR urography and 100, 93.42 and 93.82% in T1-weighted MR urography, respectively. Sensitivity, specificity and accuracy were 100% in combined T2- and T1-weighted MR urography technique. Magnetic resonance urography is an effective imaging method for the evaluation of the urinary system in patients with urinary diversion. T2-weighted MR urography alone has high sensitivity, specificity and accuracy, does not require intravenous contrast medium and can be obtained in 3–5 min. However, T1-weighted MR urography may provide additional information in some cases.
MR angiography in diagnosing and following up the treatment result: arteria lusoria
International Nuclear Information System (INIS)
Vogl, T.J.; Juergens, M.; Harms, J.; Pegios, W.; Zimmermann, A.; Hetzer, R.; Felix, R.
1994-01-01
Diagnostic and therapeutic procedures are presented in a 29-year-old female patient who suffered from severe dysphagia and rapid loss in weight. In the conventional X-ray examination and barium swallow an aberrant right subclavian artery was suspected. MR imaging (MRI) and MR angiography (MRA) were done to plan the surgical correction. Post-operative MRA documented exactly the complex topography after surgical correction and the flow pattern in the implanted Gore-Tex stretch graft prosthesis. Non-invasive MR angiography renders possible the concrete planning of complex corrections of thoracic vessels replacing invasive catheter angiography. (orig.) [de
International Nuclear Information System (INIS)
Lou Xin; Cai Youquan; Ma Lin; Cai Jianming
2007-01-01
Objective: To assess the value of MR diffusion tensor imaging (DTI) in the differentiation between the patients with cerebral ischemia disease and multiple sclerosis. Methods: MR diffusion tensor imaging was performed in thirty-two patients with internal carotid artery stenosis ≥70% and eighteen patients with clinical diagnosed multiple sclerosis. Fractional anisotropy (FA) value of the germ, splenium, body of the corpus callosum, and the white matter of the frontal and occipital lobe were measured respectively, and independent-sample t-test statistical analysis was performed. Results: The FA value was decreased obviously in the anterior and posterior body and splenium of the corpus callosumin the MS patients compared with the ICA severe stenosis patients (0.67 ± 0.12 vs. 0.75 ± 0.05, t=3.443, P 0.05; 0.34 ± 0.08 vs. 0.34 ± 0.05, t=0.137, P> 0.05; 0.29 ± 0.06 vs. 0.40 ± 0.06, t=5.449, P>0.05). Conclusion: DTI can noninvasive detect the potential disorder of corpus callosum in vivo, thus providing useful information to differentiate the cerebral ischemia disease from multiple sclerosis. (authors)
10 CFR 611.111 - Default, demand, payment, and collateral liquidation.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Default, demand, payment, and collateral liquidation. 611... collateral liquidation. (a) In the event that the Borrower has defaulted in the making of required payments.... Attorney General, may seek to foreclose on the collateral assets and/or take such other legal action as...
Cho, Mi Hyeon; Choi, Eun-Seok; Kim, Sehee; Goh, Sung-Ho; Choi, Yongdoo
2017-12-01
In this study, we synthesized manganese dioxide nanoparticles (MnO2 NPs) stabilized with biocompatible polymers (polyvinylpyrrolidone and polyacrylic acid) and analyzed their effect on non-small cell lung cancer (NSCLC) cells with or without gefitinib resistance in vitro. MnO2 NPs showed glutathione (GSH)-responsive dissolution and subsequent enhancement in magnetic resonance (MR) imaging. Of note, treatment with MnO2 NPs induced significant cytotoxic effects on NSCLC cells, and additional dose-dependent therapeutic effects were obtained upon X-ray irradiation. Normal cells treated with MnO2 NPs were viable at the tested concentrations. In addition, increased therapeutic efficacy could be achieved when the cells were treated with MnO2 NPs in hypoxic conditions. Therefore, we conclude that the use of MnO2 NPs in MR imaging and combination radiotherapy may be an efficient strategy for the imaging and therapy of NSCLC.
Optimal real time cost-benefit based demand response with intermittent resources
International Nuclear Information System (INIS)
Zareen, N.; Mustafa, M.W.; Sultana, U.; Nadia, R.; Khattak, M.A.
2015-01-01
Ever-increasing price of conventional energy resources and related environmental concern enforced to explore alternative energy sources. Inherent uncertainty of power generation and demand being strongly influenced by the electricity market has posed severe challenges for DRPs (Demand Response Programs). Definitely, the success of such uncertain energy systems under new market structures is critically decided by the advancement of innovative technical and financial tools. Recent exponential growth of DG (distributed generations) demanded both the grid reliability and financial cost–benefits analysis for deregulated electricity market stakeholders. Based on the SGT (signaling game theory), the paper presents a novel user-aware demand-management approach where the price are colligated with grid condition uncertainties to manage the peak residential loads. The degree of information disturbances are considered as a key factor for evaluating electricity bidding mechanisms in the presence of independent multi-generation resources and price-elastic demand. A correlation between the cost–benefit price and variable reliability of grid is established under uncertain generation and demand conditions. Impacts of the strategies on load shape, benefit of customers and the reduction of energy consumption are inspected and compared with Time-of-Used based DRPs. Simulation results show that the proposed DRP can significantly reduce or even eliminate peak-hour energy consumption, leading to a substantial raise of revenues with 18% increase in the load reduction and a considerable improvement in system reliability is evidenced. - Highlights: • Proposed an optimal real time cost-benefit based demand response model. • Used signaling game theory for the information disturbances in deregulated market. • Introduced a correlation between the cost–benefit price and variable grid reliability. • Derive robust bidding strategies for utility/customers successful participation.
Directory of Open Access Journals (Sweden)
Yongli Wang
2018-03-01
Full Text Available With the application of distributed generation and the development of smart grid technology, micro-grid, an economic and stable power grid, tends to play an important role in the demand side management. Because micro-grid technology and demand response have been widely applied, what Demand Response actions can realize the economic operation of micro-grid has become an important issue for utilities. In this proposed work, operation optimization modeling for micro-grid is done considering distributed generation, environmental factors and demand response. The main contribution of this model is to optimize the cost in the context of considering demand response and system operation. The presented optimization model can reduce the operation cost of micro-grid without bringing discomfort to the users, thus increasing the consumption of clean energy effectively. Then, to solve this operational optimization problem, genetic algorithm is used to implement objective function and DR scheduling strategy. In addition, to validate the proposed model, it is employed on a smart micro-grid from Tianjin. The obtained numerical results clearly indicate the impact of demand response on economic operation of micro-grid and development of distributed generation. Besides, a sensitivity analysis on the natural gas price is implemented according to the situation of China, and the result shows that the natural gas price has a great influence on the operation cost of the micro-grid and effect of demand response.
Energy Technology Data Exchange (ETDEWEB)
Olsen, Daniel [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Goli, Sasank [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Faulkner, David [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); McKane, Aimee [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2012-12-20
This report details a study into the demand response potential of a large wastewater treatment facility in San Francisco. Previous research had identified wastewater treatment facilities as good candidates for demand response and automated demand response, and this study was conducted to investigate facility attributes that are conducive to demand response or which hinder its implementation. One years' worth of operational data were collected from the facility's control system, submetered process equipment, utility electricity demand records, and governmental weather stations. These data were analyzed to determine factors which affected facility power demand and demand response capabilities The average baseline demand at the Southeast facility was approximately 4 MW. During the rainy season (October-March) the facility treated 40% more wastewater than the dry season, but demand only increased by 4%. Submetering of the facility's lift pumps and centrifuges predicted load shifts capabilities of 154 kW and 86 kW, respectively, with large lift pump shifts in the rainy season. Analysis of demand data during maintenance events confirmed the magnitude of these possible load shifts, and indicated other areas of the facility with demand response potential. Load sheds were seen to be possible by shutting down a portion of the facility's aeration trains (average shed of 132 kW). Load shifts were seen to be possible by shifting operation of centrifuges, the gravity belt thickener, lift pumps, and external pump stations These load shifts were made possible by the storage capabilities of the facility and of the city's sewer system. Large load reductions (an average of 2,065 kW) were seen from operating the cogeneration unit, but normal practice is continuous operation, precluding its use for demand response. The study also identified potential demand response opportunities that warrant further study: modulating variable-demand aeration loads, shifting
International Nuclear Information System (INIS)
Davis, W.L.; Blatter, D.D.; Parker, D.L.; Robison, R.O.; Harnsberger, H.R.
1991-01-01
This paper compares the more traditional three-dimensional (3D) time-of-flight MR angiography with a novel new technique, MOTSA, in the evaluation of both normal and abnormal intracranial anatomy. The authors performed sequential, location-matched 3D TOF and MOTSA MR angiography in 10 subjects with normal and 25 with abnormal intracranial anatomy. Images were evaluated for visualization of specific vessels and depiction of pathologic anatomy. All images were subjected to an objective scoring system. Digital angiography was available in 15 of 25 abnormal cases. In the normal cases, large- and small-vessel visualization was improved. Significant improvement in visualization of venous anatomy was also observed. In the abnormal cases, pathologic anatomy was better visualized, providing important diagnostic information. Multiple overlapping thin-slab-acquisition MR angiography demonstrates vessel visualization that is increased over that of 3D TOF MR angiography in both normal and abnormal cases. Because of the decrease in saturation effects and phase dispersion, MOTSA is especially useful in the evaluation of complex intracranial vascular abnormalities
Energy Technology Data Exchange (ETDEWEB)
Seo, Mirinae; Cho, Nariya; Bea, Min Sun; Koo, Hye Ryoung; Kim, Won Hwa; Lee, Su Hyun; Chu, A Jung [Dept. of Radiology, Seoul National University Hospital, Seoul (Korea, Republic of)
2016-02-15
To retrospectively evaluate the features of undiagnosed breast cancers on prior screening breast magnetic resonance (MR) images in patients who were subsequently diagnosed with breast cancer, as well as the potential utility of MR-computer-aided evaluation (CAE). Between March 2004 and May 2013, of the 72 consecutive pairs of prior negative MR images and subsequent MR images with diagnosed cancers (median interval, 32.8 months; range, 5.4-104.6 months), 36 (50%) had visible findings (mean size, 1.0 cm; range, 0.3-5.2 cm). The visible findings were divided into either actionable or under threshold groups by the blinded review by 5 radiologists. MR imaging features, reasons for missed cancer, and MR-CAE features according to actionability were evaluated. Of the 36 visible findings on prior MR images, 33.3% (12 of 36) of the lesions were determined to be actionable and 66.7% (24 of 36) were underthreshold; 85.7% (6 of 7) of masses and 31.6% (6 of 19) of non-mass enhancements were classified as actionable lesions. Mimicking physiologic enhancements (27.8%, 10 of 36) and small lesion size (27.8%, 10 of 36) were the most common reasons for missed cancer. Actionable findings tended to show more washout or plateau kinetic patterns on MR-CAE than underthreshold findings, as the 100% of actionable findings and 46.7% of underthreshold findings showed washout or plateau (p = 0.008). MR-CAE has the potential for reducing the number of undiagnosed breast cancers on screening breast MR images, the majority of which are caused by mimicking physiologic enhancements or small lesion size.
Supply-side and demand-side policies for biosimilars: an overview in 10 European member states.
Rémuzat, Cécile; Kapuśniak, Anna; Caban, Aleksandra; Ionescu, Dan; Radière, Guerric; Mendoza, Cyril; Toumi, Mondher
2017-01-01
This study aimed to provide an overview of biosimilar policies in 10 EU MSs. Methods : Ten EU MS pharmaceutical markets (Belgium, France, Germany, Greece, Hungary, Italy, Poland, Spain, Sweden, and the UK) were selected. A comprehensive literature review was performed to identify supply-side and demand-side policies in place in the selected countries. Results : Supply-side policies for biosimilars commonly include price linkage, price re-evaluation, and tendering; the use of internal or external reference pricing varies between countries; health technology assessment is conducted in six countries. Regarding demand-side policies, pharmaceutical prescription budgets or quotas and monitoring of prescriptions (with potential financial incentives or penalties) are in place in eight and in seven countries respectively. Switching is generally allowed, but is solely the physician's responsibility. Automatic substitution is not recommended, or even forbidden, in most EU MSs. Prescription conditions or guidelines that apply to biosimilars are established in nearly all surveyed EU MSs. Conclusions : Important heterogeneity in policies on biosimilars was seen between (and even within) selected countries, which may partly explain variations in biosimilar uptake. Supply-side policies targeting price have been reported to limit biosimilar penetration in the long term, despite short-term savings, while demand-side policies are considered to positively impact uptake.
2012-12-12
...) Emergency Response Organization Augmentation at Alternate Facility--capability for staging emergency... significant effect on the quality of the human environment (77 FR 71198; November 29, 2012). This exemption is...
Energy Technology Data Exchange (ETDEWEB)
Regier, Marc; Ries, T.; Arndt, C.; Cramer, M.C.; Adam, G.; Habermann, C.R. [Universitaetsklinikum Hamburg-Eppendorf (Germany). Klinik und Poliklinik fuer Diagnostische und Interventionelle Radiologie; Graessner, J. [Siemens AG, Hamburg (Germany). Medical Solutions; Reitmeier, F.; Jaehne, M. [Universitaetsklinikum Hamburg-Eppendorf (Germany). Klinik und Poliklinik fuer Hals-, Nasen- und Ohrenheilkunde
2009-03-15
To investigate the value of diffusion-weighted echo-planar imaging (DW-EPI) for quantifying functional changes of the parotid gland in Sjoegren's disease and to evaluate whether ADC mapping allows for early diagnosis based on MR sialography grading. Using a DW-EPI sequence at 1.5T (b-factors: 0, 500 and 1000 sec/mm{sup 2}), the parotid glands of 52 healthy volunteers and 13 patients with histologically verified affection of Sjoegren's disease were examined. All scans were performed prior to and following gustatory stimulation with 5 ml of lemon juice. ADC maps were evaluated by placing an inordinate region-of-interest (ROI) enclosing the entire parotid gland. Sjoegren's disease was graded based on MR sialography findings using a 4-point grading-scale. Statistics included student t-test and kappa-analysis. In healthy volunteers mean ADCs of 1.14 x 10{sup -3} mm{sup 2} /sec before and 1.2 x 10{sup -3} mm{sup 2} /sec after stimulation were observed. Higher ADCs were determined for early-stage Sjoegren's disease, averaging 1.22 x 10{sup -3} mm{sup 2} /sec before and 1.29 x 10{sup -3} mm{sup 2} /sec after stimulation. Advanced disease revealed significantly lower ADCs (0.97 x 10{sup -3} mm{sup 2} /sec (p = 0.002) before and 1.01 x 10{sup -3} mm{sup 2} /sec (p < 0.001) after stimulation). (orig.)
MR imaging-guided percutaneous cryotherapy for lung tumors: initial experience.
Liu, Shangang; Ren, Ruimei; Liu, Ming; Lv, Yubo; Li, Bin; Li, Chengli
2014-09-01
To evaluate prospectively the initial clinical experience of magnetic resonance (MR) imaging-guided percutaneous cryotherapy of lung tumors. MR imaging-guided percutaneous cryotherapy was performed in 21 patients with biopsy-proven lung tumors (12 men, 9 women; age range, 39-79 y). Follow-up consisted of contrast-enhanced chest computed tomography (CT) scan performed at 3-month intervals to assess tumor control; CT scanning was carried out for 12 months or until death. Cryotherapy procedures were successfully completed in all 21 patients. Pneumothorax occurred in 7 (33.3%) of 21 patients. Chest tube placement was required in one (4.8%) case. Hemoptysis was exhibited by 11 (52.4%) patients, and pleural effusion occurred in 6 (28.6%) patients. Other complications were observed in 14 (66.7%) patients. The mean follow-up period was 10.5 months (range, 9-12 mo) in patients who died. At month 12 of follow-up, 7 (33.3%) patients had a complete response to therapy, and 10 (47.6%) patients showed a partial response. In addition, two patients had stable disease, and two patients developed progressive disease; one patient developed a tumor in the liver, and the other developed a tumor in the brain. The 1-year local control rate was 81%, and 1-year survival rate was 90.5%. MR imaging-guided percutaneous cryotherapy appears feasible, effective, and minimally invasive for lung tumors. Copyright © 2014 SIR. Published by Elsevier Inc. All rights reserved.
Loads as a Resource: Frequency Responsive Demand
Energy Technology Data Exchange (ETDEWEB)
Kalsi, Karanjit [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Williams, Tess L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Marinovici, Laurentiu D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Elizondo, Marcelo A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lian, Jianming [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2015-11-30
Demand-side frequency control can complement traditional generator controls to maintain the stability of large electric systems in the face of rising uncertainty and variability associated with renewable energy resources. This report presents a hierarchical frequency-based load control strategy that uses a supervisor to flexibly adjust control gains that a population of end-use loads respond to in a decentralized manner to help meet the NERC BAL-003-1 frequency response standard at both the area level and interconnection level. The load model is calibrated and used to model populations of frequency-responsive water heaters in a PowerWorld simulation of the U.S. Western Interconnection (WECC). The proposed design is implemented and demonstrated on physical water heaters in a laboratory setting. A significant fraction of the required frequency response in the WECC could be supplied by electric water heaters alone at penetration levels of less than 15%, while contributing to NERC requirements at the interconnection and area levels.
Congenital cytomegalovirus infection: contribution and best timing of prenatal MR imaging
Energy Technology Data Exchange (ETDEWEB)
Cannie, Mieke M. [University Hospital Brugmann, Universite Libre de Bruxelles, Department of Radiology, Brussels (Belgium); UZ Brussel, Vrije Universiteit Brussel, Department of Radiology, Brussel (Belgium); Devlieger, Roland; Catte, Luc de; Valk, Elise van der [University Hospitals Leuven, Department of Obstetrics and Gynecology, Leuven (Belgium); Leyder, Mina; Foulon, Walter [UZ Brussel, Vrije Universiteit Brussel, Department of Obstetrics, Brussel (Belgium); Claus, Filip [University Hospitals Leuven, Department of Radiology, Leuven (Belgium); Onze-Lieve-Vrouw Hospital, Department of Radiology, Aalst (Belgium); Leus, Astrid [UZ Brussel, Vrije Universiteit Brussel, Department of Radiology, Brussel (Belgium); Cossey, Veerle [University Hospitals Leuven, Neonatal Intensive Care Unit, Leuven (Belgium); Foulon, Ina [UZ Brussel, Vrije Universiteit Brussel, Department of Otolaryngology - Head and Neck Surgery, Brussel (Belgium); Cos, Teresa; Jani, Jacques C. [University Hospital Brugmann, Universite Libre de Bruxelles, Department of Obstetrics and Gynecology, Brussels (Belgium); Bernaert, Anja [Sint-Augustinus Hospital, Department of Radiology, Antwerp (Belgium); Oyen, Raymond [University Hospitals Leuven, Department of Radiology, Leuven (Belgium)
2016-10-15
To predict sensorineural hearing loss (SNHL) and neurological impairment in congenital cytomegalovirus (cCMV) infection using MR imaging and define the best timing in pregnancy for prenatal assessment. In 121 patients with confirmed cCMV infection, brain features at MR imaging were respectively graded from 1 to 5: normal; isolated frontal/parieto-occipital hyperintensity; temporal periventricular hyperintensity; temporal/occipital cysts and/or intraventricular septa; migration disorders. Grading was correlated with postnatal SNHL and neurological impairment using regression analysis. In 51 fetuses with MR examinations at 26.9 and 33.0 weeks, the predictive value of SNHL and neurological impairment was compared using ROC curves. Postnatal follow-up showed SNHL in 18 infants and neurological impairment in 10. MR grading was predictive of SNHL and of neurological impairment (P < 0.001). In grade 1 or 2, none had SNHL and 1/74 had neurological impairment. The areas under ROC curves for prediction of postnatal SNHL and of neurological impairment from first and second MR examination were comparable. Our data suggest that in cCMV infection, prediction of SNHL and neurological impairment is feasible by fetal MR imaging with a high negative predictive value and can equally be done at 27 or 33 weeks of gestation. (orig.)
Congenital cytomegalovirus infection: contribution and best timing of prenatal MR imaging
International Nuclear Information System (INIS)
Cannie, Mieke M.; Devlieger, Roland; Catte, Luc de; Valk, Elise van der; Leyder, Mina; Foulon, Walter; Claus, Filip; Leus, Astrid; Cossey, Veerle; Foulon, Ina; Cos, Teresa; Jani, Jacques C.; Bernaert, Anja; Oyen, Raymond
2016-01-01
To predict sensorineural hearing loss (SNHL) and neurological impairment in congenital cytomegalovirus (cCMV) infection using MR imaging and define the best timing in pregnancy for prenatal assessment. In 121 patients with confirmed cCMV infection, brain features at MR imaging were respectively graded from 1 to 5: normal; isolated frontal/parieto-occipital hyperintensity; temporal periventricular hyperintensity; temporal/occipital cysts and/or intraventricular septa; migration disorders. Grading was correlated with postnatal SNHL and neurological impairment using regression analysis. In 51 fetuses with MR examinations at 26.9 and 33.0 weeks, the predictive value of SNHL and neurological impairment was compared using ROC curves. Postnatal follow-up showed SNHL in 18 infants and neurological impairment in 10. MR grading was predictive of SNHL and of neurological impairment (P < 0.001). In grade 1 or 2, none had SNHL and 1/74 had neurological impairment. The areas under ROC curves for prediction of postnatal SNHL and of neurological impairment from first and second MR examination were comparable. Our data suggest that in cCMV infection, prediction of SNHL and neurological impairment is feasible by fetal MR imaging with a high negative predictive value and can equally be done at 27 or 33 weeks of gestation. (orig.)
Left and right ventricle assessment with Cardiac CT: validation study vs. Cardiac MR
Energy Technology Data Exchange (ETDEWEB)
Maffei, Erica; Seitun, Sara [Giovanni XXIII Hospital, Cardiovascular Radiology Unit, Monastier di Treviso (Italy); Messalli, Giancarlo; Catalano, Onofrio [SDN Foundation - IRCCS, Naples (Italy); Martini, Chiara; Cademartiri, Filippo [Giovanni XXIII Hospital, Cardiovascular Radiology Unit, Monastier di Treviso (Italy); Erasmus Medical Center, Department of Radiology and Cardiology, Rotterdam (Netherlands); Nieman, Koen; Rossi, Alexia; Mollet, Nico R. [Erasmus Medical Center, Department of Radiology and Cardiology, Rotterdam (Netherlands); Guaricci, Andrea I. [Azienda Ospedaliero-Universitaria di Foggia, Department of Cardiology, Foggia (Italy); Tedeschi, Carlo [Ospedale San Gennaro, Department of Cardiology, Naples (Italy)
2012-05-15
To compare Magnetic Resonance (MR) and Computed Tomography (CT) for the assessment of left (LV) and right (RV) ventricular functional parameters. Seventy nine patients underwent both Cardiac CT and Cardiac MR. Images were acquired using short axis (SAX) reconstructions for CT and 2D cine b-SSFP (balanced-steady state free precession) SAX sequence for MR, and evaluated using dedicated software. CT and MR images showed good agreement: LV EF (Ejection Fraction) (52 {+-} 14% for CT vs. 52 {+-} 14% for MR; r = 0.73; p > 0.05); RV EF (47 {+-} 12% for CT vs. 47 {+-} 12% for MR; r = 0.74; p > 0.05); LV EDV (End Diastolic Volume) (74 {+-} 21 ml/m{sup 2} for CT vs. 76 {+-} 25 ml/m{sup 2} for MR; r = 0.59; p > 0.05); RV EDV (84 {+-} 25 ml/m{sup 2} for CT vs. 80 {+-} 23 ml/m{sup 2} for MR; r = 0.58; p > 0.05); LV ESV (End Systolic Volume)(37 {+-} 19 ml/m{sup 2} for CT vs. 38 {+-} 23 ml/m{sup 2} for MR; r = 0.76; p > 0.05); RV ESV (46 {+-} 21 ml/m{sup 2} for CT vs. 43 {+-} 18 ml/m{sup 2} for MR; r = 0.70; p > 0.05). Intra- and inter-observer variability were good, and the performance of CT was maintained for different EF subgroups. Cardiac CT provides accurate and reproducible LV and RV volume parameters compared with MR, and can be considered as a reliable alternative for patients who are not suitable to undergo MR. circle Cardiac-CT is able to provide Left and Right Ventricular function. circle Cardiac-CT is accurate as MR for LV and RV volume assessment. (orig.)
Examining demand response, renewable energy and efficiencies to meet growing electricity needs
International Nuclear Information System (INIS)
Elliot, N.; Eldridge, M.; Shipley, A.M.; Laitner, J.S.; Nadel, S.; Silverstein, A.; Hedman, B.; Sloan, M.
2007-01-01
While Texas has already taken steps to improve its renewable energy portfolio (RPS), and its energy efficiency improvement program (EEIP), the level of savings that utilities can achieve through the EEIP can be greatly increased. This report estimated the size of energy efficiency and renewable energy resources in Texas, and suggested a range of policy options that might be adopted to further extend EEIP. Current forecasts suggest that peak demand in Texas will increase by 2.3 per cent annually from 2007-2012, a level of growth which is threatening the state's ability to maintain grid reliability at reasonable cost. Almost 70 per cent of installed generating capacity is fuelled by natural gas in Texas. Recent polling has suggested that over 70 per cent of Texans are willing support increased spending on energy efficiency. Demand response measures that may be implemented in the state include incentive-based programs that pay users to reduce their electricity consumption during specific times and pricing programs, where customers are given a price signal and are expected to moderate their electricity usage. By 2023, the widespread availability of time-varying retail electric rates and complementary communications and control methods will permanently change the nature of electricity demand in the state. At present, the integrated utilities in Texas offer a variety of direct load control and time-of-use, curtailable, and interruptible rates. However, with the advent of retail competition now available as a result of the structural unbundling of investor-owned utilities, there is less demand response available in Texas. It was concluded that energy efficiency, demand response, and renewable energy resources can meet the increasing demand for electricity in Texas over the next 15 years. 4 figs
Energy Technology Data Exchange (ETDEWEB)
Tian, Chun-Yan [Department of Radiology, Peking University Third Hospital, 49 North Garden Road, Haidian District, Beijing 100191 (China); Wang, Jian-Quan [Department of Sports Medicine, Peking University Third Hospital, 49 North Garden Road, Haidian District, Beijing 100191,PR China (China); Zheng, Zhuo-Zhao, E-mail: zzhuozhao@aliyun.com [Department of Radiology, Peking University Third Hospital, 49 North Garden Road, Haidian District, Beijing 100191 (China); Ren, A.-Hong [Department of Radiology, Beijing Daxing Hospital, 26 West Huangcun Road, Daxing District, Beijing 102600 (China)
2014-10-15
Highlights: • MR is the preferred imaging modality for diagnosing acetabular labral tears. • The diagnostic performance of MR arthrography are superior than conventional hip MR. • The hip MR arthrography is recommended for diagnosing acetabular labral lesions. - Abstract: Objective: To evaluate the value of hip MR for diagnosing acetabular labrum tears, and to further compare the diagnostic performances of conventional MR with MR arthrography in acetabular labrum tears. Methods: 90 patients undergoing both hip MR examination and subsequent hip arthroscopy were retrospectively evaluated. Of these patients, 34 accepted both conventional MR and MR arthrography; while the other 56 only underwent conventional MR examination. All hip MR images were independently reviewed by two radiologists, and further compared with the results of hip arthroscopy. Results: 59 of 90 patients were confirmed with acetabular labral tears by hip arthroscopy and 31 without tears. The sensitivity, specificity, positive predictive value (PPV) and negative predictive value (NPV) of conventional MR for evaluating the acetabular labral tears were 61.0%, 77.4%, 83.7% and 51.1% (radiologist A), and 66.1%, 74.2%, 82.9% and 53.4% (radiologist B), respectively, with good consistency between the two observers (K = 0.645). The sensitivity, specificity, PPV and NPV of MR arthrography for assessing the acetabular labral tears were 90.5%, 84.6%, 90.5% and 84.6% (radiologist A), and 95.2%, 84.6%, 90.9% and 91.7% (radiologist B), respectively, with excellent good consistency between the two observers (K = 0.810). The sensitivity and NPV of MR arthrography for diagnosing the acetabular labral tears were significantly higher than those of conventional MR (both P < 0.05). Conclusion: Hip MR arthrography is a reliable evaluation modality for diagnosing the acetabular labral tears, and its diagnostic performance is superior to that of conventional MR at 3.0 T.
Weck, M. H J; van Hooff, J.; van Sark, W. G J H M
2017-01-01
Demand response, defined as the shifting of electricity demand, is generally believed to have value both for the grid and for the market: by matching demand more closely to supply, consumers could profit from lower prices, while in a smart grid environment, more renewable electricity can be used and less grid capacity may be needed. However, the introduction of residential demand response programmes to support the development of smart grids that includes renewable generation is hampered by a ...
MR imaging diagnosis of posterior cruciate ligament injury: importance of ancillary findings
International Nuclear Information System (INIS)
Hwang, Kang Ik; Lee, Jong Hwa; Kim, Young Sun; Lee, Jung Hwoi; Ki, Tae Sung; Park, Jong Oag
1997-01-01
To evaluate the importance of two ancillary findings of anterior tibial plateau bruise/fracture and popliteus muscle strain on MR diagnosis of posterior cruicate ligament injury. We retrospectively evaluated 48 patients with confirmed posterior cruciate ligament tear. We studied the incidence of anterior tibial plateau injury and popliteus muscle strain, and the specificity of popliteus muscle strain with or without bony injury. A complete tear of the posterior cruciate ligament was noted in 37 cases, a partial tear in 11. Anterior tibial plateau lesion was found in 21 of 48 cases (44%); This total was made up of 17/37 PCL complete tears (46%) and 4/11 partial tears (36%). The difference in the incidence of complete and partial tears is not statistically significant. Popliteus muscle injury was found in 20 of 48 cases (42%), the total consisted of 19/37 PCL complete tears (51%) and 1/11 partial tears (10%). The incidence of 42% is relatively high, approximating that of bony injury. The difference in the incidence of complete and partial tears is statistically significant (p < 0.006). Specificity for posterior cruciate ligament tear is 69%(20/29), and when concomitant with anterior tibial plateau injury is 94%(16/17). As in the case of anterior cruciate ligament injury, these documented ancillary findings of anterior tibial plateau and popliteus muscle injuries are very helpful when MR diagnosis of posterior cruciate ligament injury itself and differentiation of partial and complete rupture are doubtful