Prices, taxes and automotive fuel cross-border shopping

International Nuclear Information System (INIS)

Leal, Andres; Lopez-Laborda, Julio; Rodrigo, Fernando

2009-01-01

The aim of the present paper is to determine whether differences in automotive fuel prices among neighboring Autonomous Communities (i.e. Spanish political-administrative regions) affect the decisions taken by individuals regarding the region in which to purchase fuel. In particular, the intention is to discover if price increases in certain Autonomous Communities, as a result of the application of the regional tranche of the Hydrocarbon Retail Sales Tax (HRST) has affected fuel purchases in neighboring Communities. In order to achieve the above-mentioned objectives, the monthly purchases of automotive diesel in Aragon between January 2001 and March 2007 is estimated from the fuel price in Aragon, the relation between prices in each of the bordering Communities and Aragon, weighted by density of traffic, the number of vehicles registered in that Community, and three dummy variables representative of the implementation of the regional tranche of the HRST in Madrid, Catalonia, and Valencia. The paper finds empirical evidence to demonstrate a positive effect of the relative prices in the neighboring Communities and vehicle registrations, and also a negative effect of prices in Aragon, upon the acquisition of diesel in this region. In the case of Catalonia, some evidence suggests that the price effect may have been strengthened following the introduction of the regional tranche of the HRST in August 2004. (author)

Automotive Thermoelectric Waste Heat Recovery

Science.gov (United States)

Meisner, Gregory P.

2015-03-01

Considerable fuel energy, as much as 70%, is not converted to useful work by internal combustion engines but is instead rejected as waste heat, and more than half of the waste heat, nearly 40% of fuel energy, is contained in vehicle exhaust gas. This provides an opportunity to recover some of the wasted fuel energy and convert it from heat into useful work, subject to the laws of thermodynamics, and thereby improve vehicle energy efficiency. Thermoelectric (TE) materials have been extensively researched and TE devices are now being developed for operation at high temperatures corresponding to automotive exhaust gases for direct solid-state conversion of heat into electricity. This has stimulated substantial progress in the development of practical TE generator (TEG) systems for large-scale commercialization. A significant enabler of this progress has been the US Department of Energy's Vehicle Technologies Program through funding for low cost solutions for automotive TE waste heat recovery to improve fuel economy. Our current project at General Motors has culminated in the identification of the potential supply chain for all components and assembly of an automotive TEG. A significant focus has been to develop integrated and iterative modeling tools for a fully optimized TEG design that includes all components and subsystems (TE modules, heat exchangers, thermal interfaces, electrical interconnects, power conditioning, and vehicle integration for maximal use of TEG power). We have built and tested a new, low-cost Initial TEG prototype based on state-of-the-art production-scale skutterudite TE modules, novel heat exchanger designs, and practical solutions to the many technical challenges for optimum TEG performance. We will use the results for our Initial TEG prototype to refine our modeling and design tools for a Final automotive TEG system prototype. Our recent results will be presented. Thanks to: J.R. Salvador, E.R. Gundlach, D. Thompson, N.K. Bucknor, M

How "Green" Is Your Fuel? Creation and Comparison of Automotive Biofuels

Science.gov (United States)

Wagner, Eugene P.; Koehle, Maura A.; Moyle, Todd M.; Lambert, Patrick D.

2010-01-01

In recent years, biofuel development and use has risen significantly. This undergraduate laboratory experiment educates students on the various alternative fuels that are being developed for automotive applications and the advantages and disadvantages of each. Students replicate commercially available alternative fuels, E85 and biodiesel, as well…

Temperature control of an automotive engine cooling system utilizing a magneto-rheological fan clutch

International Nuclear Information System (INIS)

Kim, Eun-Seok; Choi, Seung-Bok; Park, Young-Gee; Lee, Soojin

2010-01-01

In this note, the temperature control of an automotive engine cooling system is undertaken using a magneto-rheological (MR) fluid-based fan clutch (MR fan clutch in short). In order to achieve this goal, an appropriate size of controllable fan clutch using an MR fluid is firstly devised by considering the design parameters of a conventional fan clutch to reflect the practical application. Then, the principal design parameters of the MR fan clutch such as the length of the disc are optimally determined through finite element analysis. The drum-type MR fan clutch is manufactured and its time response to input current is experimentally evaluated. A robust sliding mode controller is then formulated by treating the time constant of the fan clutch system as an uncertain parameter. After identifying the relationship between angular velocity of the MR fan clutch and the temperature of the cooling system, the sliding mode controller is experimentally realized for the cooling system. It has been clearly demonstrated that the proposed sliding mode controller follows well the desired temperature with a small regulating error. It is expected from this feasibility work that the proposed control system associated with an MR fan clutch can be effectively utilized for the automotive cooling system to improve the fuel efficiency. (technical note)

The future for fuel cells in the automotive industry

International Nuclear Information System (INIS)

Wells, P.E.

2004-01-01

'Full text:' This paper presents the view that the automotive industry, seen as a vital potential market for hydrogen fuel cell applications, is one that will be characterised in the future by an unprecedented combination of technological and economic diversity. This highly volatile and uncertain future has profound implications for those involved in government policy related to energy use and transportation, as well as those involved in the fuel cell industry. Most significantly, it is argued that the industry that applies hydrogen fuel cells twenty to thirty years from now will have a quite different structure and economic logic to that which currently prevails. Suppliers of hydrogen fuel cell solutions and systems need to have considerable flexibility in their business models. The themes of diversity and co-existence are developed from extensive research into the contemporary automotive industry, as well as an active involvement in the government policy arena at national, EU and international levels. The continued search for sustainability will not just entail the insertion of technology into otherwise familiar products by otherwise familiar manufacturing processes. It will enable and require the transformation of industry. This paper seeks to outline some of the ways in which the changes could unfold. (author)

Application Summary Report 22: LED MR16 Lamps

Energy Technology Data Exchange (ETDEWEB)

Royer, Michael P.

2014-07-23

This report analyzes the independently tested photometric performance of 27 LED MR16 lamps. It describes initial performance based on light output, efficacy, distribution, color quality, electrical characteristics, and form factor, with comparisons to a selection of benchmark halogen MR16s and ENERGY STAR qualification thresholds. Three types of products were targeted. First, CALiPER sought 3000 K lamps with the highest rated lumen output (i.e., at least 500 lm) or a claim of equivalency to a 50 W halogen MR16 or higher. The test results indicate that while the initial performance of LED MR16s has improved across the board, market-available products still do not produce the lumen output and center beam intensity of typical 50 W halogen MR16 lamps. In fact, most of the 18 lamps in this category had lower lumen output and center beam intensity than a typical 35 W halogen MR16 lamp. Second, CALiPER sought lamps with a CRI of 90 or greater. Only four manufacturers were identified with a product in this category. CALiPER testing confirmed the performance of these lamps, which are a good option for applications where high color fidelity is needed. A vast majority of the LED MR16 lamps have a CRI in the low 80s; this is generally acceptable for ambient lighting, but may not always be acceptable for focal lighting. For typical LED packages, there is a fundamental tradeoff between CRI and efficacy, but the lamps in the high-CRI group in this report still offer comparable performance to the rest of the Series 22 products in other performance areas. Finally, CALiPER sought lamps with a narrow distribution, denoted as a beam angle less than 15°. Five such lamps were purchased. Notably, no lamp was identified as having high lumen output (500 lumens or greater), high CRI (90 or greater), a narrow distribution (15° or less), and an efficacy greater than 60 lm/W. This would be an important achievement for LED MR16s especially if output could reach approximately 700 800 lumens

Price transparency on the market for automotive fuels. Final report

International Nuclear Information System (INIS)

Meindert, L.; Van Schijndel, M.; Volkerink, B.

2011-05-01

The objective of this study is to answer the main question: which bottlenecks may obstruct the road to up-to-date, reliable and fully market covering price comparison services for the Dutch market for automotive fuels. [nl

Advanced design of fast reactor-membrane reformer (FR-MR)

International Nuclear Information System (INIS)

Tashimo, M.; Hori, I.; Yasuda, I.; Shirasaki, Y.; Kobayashi, K.

2004-01-01

A new plant concept of nuclear-produced hydrogen is being studied using a Fast Reactor-Membrane Reformer (FR-MR). The conventional steam methane reforming (SMR) system is a three-stage process. The first stage includes the reforming, the second contains a shift reaction and the third is the separation process. The reforming process requires high temperatures of 800 ∼ 900 deg C. The shift process generates heat and is performed at around 200 deg C. The membrane reforming has only one process stage under a nonequilibrium condition by removing H2 selectively through a membrane tube. The steam reforming temperature can be decreased from 800 deg C to 550 deg C, which is a remarkable benefit offered by the non-equilibrium condition. With this new technology, the reactor type can be changed from a High Temperature Gas-cooled Reactor (HTGR) to a Fast Reactor (FR). A Fast Reactor-Membrane Reformer (FR-MR) is composed of a nuclear plant and a hydrogen plant. The nuclear plant is a sodium-cooled Fast Reactor with mixed oxide fuel and with a power of 240 MWt. The heat transport system contains two circuits, the primary circuit and the secondary circuit. The membrane reformer units are set in the secondary circuit. The heat, supplied by the sodium, can produce 200 000 Nm 3 /h by 2 units. There are two types of membranes. One is made of Pd another one (advanced) is made of, for example V, or Nb. The technology for the Pd membrane is already established in a small scale. The non-Pd type is expected to improve the performance. (author)

Spinal cord infarction: MR imaging and clinical features in 16 cases

International Nuclear Information System (INIS)

Weidauer, Stefan; Lanfermann, Heinrich; Zanella, Friedhelm E.; Nichtweiss, Michael

2002-01-01

Spinal cord infarctions are rare and due to heterogeneous etiologies. The aim of the study was to analyze the MR imaging findings and evaluate their correlations with clinical symptoms in ischemic spinal cord lesions. MR images and clinical features of 16 patients (11 male, 5 female) with typical sudden onset of neurological deficits caused by spinal cord ischemia were evaluated. MR imaging was performed within 2 h to 14 days after the initial neurological symptoms. Eight patients had follow-up examinations including contrast-enhanced MR imaging. MR abnormalities were best demonstrated on sagittal T2-weighted images, with ''pencil-like'' hyperintensities (16/16) and cord enlargement (9/16). Axial T2-weighted images showed bilateral (13/16) and unilateral (3/16) hyperintensities according, in 15 patients, to anterior spinal artery (ASA) territory, with three of them located particularly in the spinal sulcal artery territory. In one patient only the posterior spinal artery (PSA) territory was involved. Spinal cord was affected at the cervical level (especially C2-C3) in seven patients, at the upper thoracic level (T3-T5) in two patients and at the thoracolumbar region including the conus medullaris (T10-L1) in seven patients. Presumed etiologies were vascular surgery (3 patients), infrarenal aortic aneurysm (1 patient), bilateral vertebral artery dissection (1 patient), hypotension (1 patient), spine operation (1 patient), excessive cocaine misuse (1 patient) and cardioembolic vertebral artery occlusion (1 patient); six of seven patients with unclear etiologies had vascular risk factors such as hypertension, diabetes and cigarette smoking. MR imaging is therefore useful in detecting spinal cord infarction, with axial T2-weighted images showing hyperintensities in the ASA territory in 15 of 16 patients. Contrary to the presumed spinal cord watershed at the lower cervical and upper thoracic level, and despite numerous central arteries in the cervical cord, our data

Light-Duty Automotive Technology, Carbon Dioxide Emissions, and Fuel Economy Trends Data

Data.gov (United States)

U.S. Environmental Protection Agency — The Light-Duty Automotive Technology, Carbon Dioxide Emissions, and Fuel Economy Trends report is the authoritative reference for carbon dioxide (CO2) emissions,...

Sensitivities of Internal Combustion Automotive Engines to Variations in Fuel Properties

Science.gov (United States)

1982-02-01

An assessment of the sensitivity of the automotive gasoline and diesel engines to variations in fuel properties has been made. The variables studied include H/C ratio, distillation range, aromatic content, ignition quality as determined by the octane...

Industrial thermoforming simulation of automotive fuel tanks

International Nuclear Information System (INIS)

Wiesche, Stefan aus der

2004-01-01

An industrial thermoforming simulation with regard to automotive plastic fuel tanks is presented including all relevant process stages. The radiative and conductive heat transfer during the reheat stage, the deformation and stress behaviour during the forming stage, and the final cooling stage are simulated. The modelling of the thermal and rheological behaviour of the involved material is investigated in greater detail. By means of experimental data it is found that modelling of the phase transition during the process is highly important for predicting correct wall thickness distributions

Design and optimization of automotive thermoelectric generators for maximum fuel efficiency improvement

International Nuclear Information System (INIS)

Kempf, Nicholas; Zhang, Yanliang

2016-01-01

Highlights: • A three-dimensional automotive thermoelectric generator (TEG) model is developed. • Heat exchanger design and TEG configuration are optimized for maximum fuel efficiency increase. • Heat exchanger conductivity has a strong influence on maximum fuel efficiency increase. • TEG aspect ratio and fin height increase with heat exchanger thermal conductivity. • A 2.5% fuel efficiency increase is attainable with nanostructured half-Heusler modules. - Abstract: Automotive fuel efficiency can be increased by thermoelectric power generation using exhaust waste heat. A high-temperature thermoelectric generator (TEG) that converts engine exhaust waste heat into electricity is simulated based on a light-duty passenger vehicle with a 4-cylinder gasoline engine. Strategies to optimize TEG configuration and heat exchanger design for maximum fuel efficiency improvement are provided. Through comparison of stainless steel and silicon carbide heat exchangers, it is found that both the optimal TEG design and the maximum fuel efficiency increase are highly dependent on the thermal conductivity of the heat exchanger material. Significantly higher fuel efficiency increase can be obtained using silicon carbide heat exchangers at taller fins and a longer TEG along the exhaust flow direction when compared to stainless steel heat exchangers. Accounting for major parasitic losses, a maximum fuel efficiency increase of 2.5% is achievable using newly developed nanostructured bulk half-Heusler thermoelectric modules.

INVESTIGATION OF PEM FUEL CELL FOR AUTOMOTIVE USE

Directory of Open Access Journals (Sweden)

A. K. M. Mohiuddin

2015-11-01

Full Text Available This paper provides a brief investigation on suitability of Proton-exchange  membrane fuel cells (PEMFCs as the source of power for transportation purposes. Hydrogen is an attractive alternative transportation fuel. It is the least polluting fuel that can be used in an internal combustion engine (ICE and it is widely available. If hydrogen is used in a fuel cell which converts the chemical energy of hydrogen into electricity, (NOx emissions are eliminated. The investigation was carried out on a  fuel cell car model by implementing polymer electrolyte membrane (PEM types of fuel cell as the source of power to propel the prototype car. This PEMFC has capability to propel the electric motor by converting chemical energy stored in hydrogen gas into useful electrical energy. PEM fuel cell alone is used as the power source for the electric motor without the aid of any other power source such as battery associated with it. Experimental investigations were carried out to investigate the characteristics of fuel cell used and the performance of the fuel cell car. Investigated papameters are the power it develops, voltage, current and speed it produces under different load conditions. KEYWORDS: fuel cell; automotive; proton exchange membrane; polymer electrolyte membrane; internal combustion engine

19 CFR 10.84 - Automotive vehicles and articles for use as original equipment in the manufacture of automotive...

Science.gov (United States)

2010-04-01

... original equipment in the manufacture of automotive vehicles. 10.84 Section 10.84 Customs Duties U.S... vehicles and articles for use as original equipment in the manufacture of automotive vehicles. (a)(1... his declaration that the articles are being imported for use as original equipment in the manufacture...

Sustainable automotive energy system in China

Energy Technology Data Exchange (ETDEWEB)

Zhang, Xiliang (ed.) [Tsinghua Univ. Beijing (China). China Automotive Energy Research Center

2013-06-01

The latest research available on automotive energy system analysis in China. Thorough introduction on automotive energy system in China. Provides the broad perspective to aid in planning sustainable road transport in China. Sustainable Automotive Energy System in China aims at identifying and addressing the key issues of automotive energy in China in a systematic way, covering demography, economics, technology and policy, based on systematic and in-depth, multidisciplinary and comprehensive studies. Five scenarios of China's automotive energy development are created to analyze the possible contributions in the fields of automotive energy, vehicle fuel economy improvement, electric vehicles, fuel cell vehicles and the 2nd generation biofuel development. Thanks to this book, readers can gain a better understanding of the nature of China's automotive energy development and be informed about: (1) the current status of automotive energy consumption, vehicle technology development, automotive energy technology development and policy; (2) the future of automotive energy development, fuel consumption, propulsion technology penetration and automotive energy technology development, and (3) the pathways of sustainable automotive energy transformation in China, in particular, the technological and the policy-related options. This book is intended for researchers, engineers and graduates students in the low-carbon transportation and environmental protection field.

Automotive Engines; Automotive Mechanics I: 9043.03.

Science.gov (United States)

Dade County Public Schools, Miami, FL.

This automotive engines course studies and demonstrates the theory and principles of operation of the automotive four stroke cycle engine. The student will develop an understanding of the systems necessary to make the engine perform as designed, such as cooling, fuel, ignition and lubrication. This is a one or two quinmester credit course of 45…

Free automotive and heating fuels for home and farm

International Nuclear Information System (INIS)

Murray, K.

1991-01-01

This book is for farmers or any landowners with access to free materials, such as agricultural wastes, that can be converted with minimum expense to heating fuel of to ethanol for automotive use. Farmers can learn how to make and use stoves, furnaces or stills for processing their own free materials for their own use or their neighbors. If one is a good mechanic one can learn how to adjust carburetors, to start a business converting engines to burn ethanol. The book is intended to provide the information you need to make practical use of waste materials and to save money. The book contains five chapters: Ethanol feedstocks; Crops for burning; Conversion to fuel; Fuel Utilization; and Business Opportunities. These chapters have been processed separately for inclusion on the data base

Automotive fuel consumption in Brazil. Applying static and dynamic systems of demand equations

Energy Technology Data Exchange (ETDEWEB)

Iootty, Mariana [IE-UFRJ (Institute of Economics - Federal University of Rio de Janeiro), Energy Economics Group (Brazil); UFRRJ (Federal Rural University of Rio de Janeiro) (Brazil); Pinto, Helder Jr. [IE-UFRJ (Institute of Economics - Federal University of Rio de Janeiro), Energy Economics Group (Brazil); Ebeling, Francisco [Brazilian Petroleum Institute (Brazil)

2009-12-15

This paper aims to investigate and explain the performance of the Brazilian demand for automotive fuels in the period 1970-2005. It estimates the price and income elasticities for all the available fuels in the automotive sector in the country: gasoline, compressed natural gas (CNG), ethanol and diesel. The analysis of the expenditure allocation process among these fuels is carried out through the estimation of a linear approximation of an Almost Ideal Demand System (AIDS) model. Two estimation methods were implemented: the static (through a seemingly unrelated regression) and a dynamic (through a vector error correction model). Specification tests support the use of the latter. The empirical analysis suggests a high substitutability between gasoline and ethanol; being this relation higher than the one observed between gasoline and CNG. The study shows that gasoline, ethanol and diesel are normal goods, and with the exception of ethanol, they are expenditure elastic. CNG was estimated as an inferior good. (author)

Automotive fuel consumption in Brazil. Applying static and dynamic systems of demand equations

International Nuclear Information System (INIS)

Iootty, Mariana; Pinto, Helder Jr.; Ebeling, Francisco

2009-01-01

This paper aims to investigate and explain the performance of the Brazilian demand for automotive fuels in the period 1970-2005. It estimates the price and income elasticities for all the available fuels in the automotive sector in the country: gasoline, compressed natural gas (CNG), ethanol and diesel. The analysis of the expenditure allocation process among these fuels is carried out through the estimation of a linear approximation of an Almost Ideal Demand System (AIDS) model. Two estimation methods were implemented: the static (through a seemingly unrelated regression) and a dynamic (through a vector error correction model). Specification tests support the use of the latter. The empirical analysis suggests a high substitutability between gasoline and ethanol; being this relation higher than the one observed between gasoline and CNG. The study shows that gasoline, ethanol and diesel are normal goods, and with the exception of ethanol, they are expenditure elastic. CNG was estimated as an inferior good. (author)

Materials Challenges for Automotive PEM Fuel Cells

Science.gov (United States)

Gasteiger, Hubert

2004-03-01

Over the past few years, significant R efforts aimed at meeting the challenging cost and performance targets required for the use of Polymer Electrolyte Membrane (PEM) fuel cells in automotive applications. Besides engineering advances in bipolar plate materials and design, the optimization of membrane-electrode assemblies (MEAs) was an important enabler in reducing the cost and performance gaps towards commercial viability for the automotive market. On the one hand, platinum loadings were reduced from several mgPt/cm2MEA [1] to values of 0.5-0.6 mgPt/cm2MEA in current applications and loadings as low as 0.25 mgPt/cm2MEA have been demonstrated on the research level [2]. On the other hand, implementation of thin membranes (20-30 micrometer) [3, 4] as well as improvements in diffusion medium materials, essentially doubled the achievable power density of MEAs to ca. 0.9 W/cm2MEA (at 0.65 V) [5], thereby not only reducing the size of a PEMFC fuel cell system, but also reducing its overall materials cost (controlled to a large extent by membrane and Pt-catalyst cost). While this demonstrated a clear path towards automotive applications, a renewed focus of R efforts is now required to develop materials and fundamental materials understanding to assure long-term durability of PEM fuel cells. This presentation therefore will discuss the state-of-the-art knowledge of catalyst, catalyst-support, and membrane degradation mechanisms. In the area of Pt-catalysts, experience with phosphoric acid fuel cells (PAFCs) has shown that platinum sintering leads to long-term performance losses [6]. While this is less critical at the lower PEMFC operating temperatures (200C), very little is known about the dependence of Pt-sintering on temperature, cell voltage, and catalyst type (i.e., Pt versus Pt-alloys) and will be discussed here. Similarly, carbon-support corrosion can contribute significantly to voltage degradation in PAFCs [7], and even in the PEMFC environment more corrosion

Automotive Stirling engine development program. [fuel economy assessment

Science.gov (United States)

Kitzner, E. W.

1978-01-01

The Ford/DOE automotive Stirling engine development program is directed towards establishing the technological and developmental base that would enable a decision on whether an engineering program should be directed at Stirling engine production. The fuel economy assessment aims to achieve, with a high degree of confidence, the ERDA proposal estimate of 20.6 MPG (gasoline) for a 4500 lb 1WC Stirling engine passenger car. The current M-H fuel economy projection for the 170 HP Stirling engine is 15.7 MPG. The confidence level for this projection is 32%. A confidence level of 29% is projected for a 22.1 MPG estimate. If all of the planned analyses and test work is accomplished at the end of the one year effort, and the projected improvements are substantiated, the confidence levels would rise to 59% for the 20.6 MPG projection and 54% for the 22.1 MPG projection. Progress achieved thus far during the fuel economy assessment is discussed.

Study of the (p,pd), (p,pt) and (p,p3He) reactions on 12C and 16O at 75MeV

International Nuclear Information System (INIS)

Grossiord, J.Y.; Bedjidian, M.; Guichard, A.; Gusakow, M.; Pizzi, J.R.

1975-01-01

The (p,pd), (p,pt) and (p,p 3 He) quasi-free scattering reactions have been studied on 12 C and 16 O targets at 75MeV. The low lying excitation levels of the residual nuclei have been observed. The appearance of T=1 states in 10 B and 14 N and of positive parity states in 13 N and 13 C can only be explained by reaction mechanisms more complex than a simple quasi-free scattering. A comparison of relative values of experimental spectroscopic factors with theoretical calculations has been made in the case of the most populated states [fr

On the efficiency of an advanced automotive fuel cell system

Energy Technology Data Exchange (ETDEWEB)

Buechi, F.N.; Freunberger, S.A.; Reum, M.; Tsukada, A.; Dietrich, P. [Paul Scherrer Institut, Electrochemistry Laboratory, CH-5232 Villigen PSI (Switzerland); Paganelli, G.; Delfino, A. [Conception et Developpement Michelin, Route Andre-Piller 30, CH-1762 Givisiez (Switzerland)

2007-04-15

Efficiency is the key parameter for the application of fuel cells in automotive applications. The efficiency of a hydrogen/oxygen polymer electrolyte fuel cell system is analyzed and compared to hydrogen/air systems. The analysis is performed for the tank to electric power chain. Furthermore, the additional energy required for using pure oxygen as a second fuel is analyzed and included in the calculation. The results show that if hydrogen is produced from primary fossil energy carriers, such as natural gas and pure oxygen needs to be obtained by a conventional process; the fuel to electric current efficiency is comparable for hydrogen/oxygen and hydrogen/air systems. However, if hydrogen and oxygen are produced by the splitting of water, i.e., by electrolysis or by a thermochemical process, the fuel to electric current efficiency for the hydrogen/oxygen system is clearly superior. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

Status and Outlook for the U.S. Non-Automotive Fuel Cell Industry: Impacts of Government Policies and Assessment of Future Opportunities

Energy Technology Data Exchange (ETDEWEB)

Greene, David L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Duleep, K. G. [ICF International, Fairfax, VA (United States); Upreti, Girish [Univ. of Tennessee, Knoxville, TN (United States)

2011-05-15

Non-Automotive Fuel Cell Industry, Government Policy and Future Opportunities. Fuel cells (FCs)are considered essential future energy technologies by developed and developing economies alike. Several countries, including the United States, Japan, Germany,and South Korea have established publicly funded R&D and market transformation programs to develop viable domestic FC industries for both automotive and nonautomotive applications.

Performance of IN-706 and PE-16 cladding in mixed-oxide fuel pins

International Nuclear Information System (INIS)

Makenas, B.J.; Lawrence, L.A.; Jensen, B.W.

1982-05-01

Iron-nickel base, precipitation-strengthened alloys, IN-706 and PE-16, advanced alloy cladding considered for breeder reactor applications, were irradiated in mixed-oxide fuel pins in the HEDL-P-60 subassembly in EBR-II. Initial selection of candidate advanced alloys was done using only nonfueled materials test results. However, to establish the performance characteristics of the candidate cladding alloys, i.e., dimensional stability and structural integrity under conditions of high neutron flux, elevated temperature, and applied stress, it was necessary to irradiate fuel pins under typical operating conditions. Fuel pins were clad with solution treated IN-706 and PE-16 and irradiated to peak fluences of 6.1 x 10 22 n/cm 2 (E > .1 MeV) and 8.8 x 10 22 n/cm 2 (E > .1 MeV) respectively. Fabrication and operating parameters for the fuel pins with the advanced cladding alloy candidates are summarized. Irradiation of HEDL-P-60 was interrupted with the breach of a pin with IN-706 cladding at 5.1 at % and the test was terminated with cladding breach in a pin with PE-16 cladding at 7.6 at %

Standardized Curriculum for Automotive Mechanics.

Science.gov (United States)

Mississippi State Dept. of Education, Jackson. Office of Vocational, Technical and Adult Education.

Standardized curricula are provided for two courses for the secondary vocational education program in Mississippi: automotive mechanics I and II. The six units in automotive mechanics I are as follows: orientation and safety; tools, equipment, and manuals; measurement; automotive engines; basic electrical systems; and fuel systems. Automotive…

Engine Tune-Up Service. Unit 5: Fuel and Carburetion Systems. Student Guide. Automotive Mechanics Curriculum.

Science.gov (United States)

Goodson, Ludy

This student guide is for Unit 5, Fuel and Carburetion Systems, in the Engine Tune-Up Service portion of the Automotive Mechanics Curriculum. It deals with inspecting and servicing the fuel and carburetion systems. A companion review exercise book and posttests are available separately as CE 031 218-219. An introduction tells how this unit fits…

European Automotive Congress

CERN Document Server

Clenci, Adrian

2016-01-01

The volume includes selected and reviewed papers from the European Automotive Congress held in Bucharest, Romania, in November 2015. Authors are experts from research, industry and universities coming from 14 countries worldwide. The papers are covering the latest developments in fuel economy and environment, automotive safety and comfort, automotive reliability and maintenance, new materials and technologies, traffic and road transport systems, advanced engineering methods and tools, as well as advanced powertrains and hybrid and electric drives.

Mass Production Cost Estimation for Direct H2 PEM Fuel Cell Systems for Automotive Applications. 2009 Update

Energy Technology Data Exchange (ETDEWEB)

James, Brian D. [Directed Technologies, Arlington, VA (United States); Kalinoski, Jeffrey A. [Directed Technologies, Arlington, VA (United States); Baum, Kevin N. [Directed Technologies, Arlington, VA (United States)

2010-01-01

This report is the third annual update of a comprehensive automotive fuel cell cost analysis. It contains estimates for material and manufacturing cost of complete 80 kWnet direct hydrogen proton exchange membrane fuel cell systems suitable for powering light duty automobiles.

A 16-channel MR coil for simultaneous PET/MR imaging in breast cancer

International Nuclear Information System (INIS)

Dregely, Isabel; Lanz, Titus; Mueller, Matthias F.; Metz, Stephan; Kuschan, Marika; Nimbalkar, Manoj; Ziegler, Sibylle I.; Nekolla, Stephan G.; Schwaiger, Markus; Bundschuh, Ralph A.; Haase, Axel

2015-01-01

To implement and evaluate a dedicated receiver array coil for simultaneous positron emission tomography/magnetic resonance (PET/MR) imaging in breast cancer. A 16-channel receiver coil design was optimized for simultaneous PET/MR imaging. To assess MR performance, the signal-to-noise ratio, parallel imaging capability and image quality was evaluated in phantoms, volunteers and patients and compared to clinical standard protocols. For PET evaluation, quantitative 18 F-FDG PET images of phantoms and seven patients (14 lesions) were compared to images without the coil. In PET image reconstruction, a CT-based template of the coil was combined with the MR-acquired attenuation correction (AC) map of the phantom/patient. MR image quality was comparable to clinical MR-only examinations. PET evaluation in phantoms showed regionally varying underestimation of the standardised uptake value (SUV; mean 22 %) due to attenuation caused by the coil. This was improved by implementing the CT-based coil template in the AC (<2 % SUV underestimation). Patient data indicated that including the coil in the AC increased the SUV values in the lesions (21 ± 9 %). Using a dedicated PET/MR breast coil, state-of-the-art MRI was possible. In PET, accurate quantification and image homogeneity could be achieved if a CT-template of this coil was included in the AC for PET image reconstruction. (orig.)

Are today's automotive technician students ready for the increased use of ethanol fuels: A study of students' perceptions of ethanol and the effects of E20

Science.gov (United States)

Mead, Gary R.

As the price of petroleum rises, the use of alternative fuels such as ethanol will continue to increase. As ethanol use increases, consumers are asking automotive technicians questions about the fuel. But how much do automotive technicians know about ethanol? In order to answer this question, a study was conducted to describe automotive technician students' knowledge, attitudes, and perceptions of ethanol as a vehicle fuel. Automotive students were chosen because they will be tomorrow's generation of technicians who will be working on vehicles that have used ethanol fuels along with flex fuel vehicles. The students were selected from six two-year technical colleges located in southern Minnesota. The six schools were chosen because they are located in areas where ethanol use is prevalent. The study used a 33-question pencil-and-paper survey to measure 184 automotive students' perceptions of ethanol. The survey revealed that students' knowledge of ethanol is very superficial. They know well advertised terms and facts, but lack an in-depth knowledge of the fuel. Also, it was discovered that several myths about ethanol still exist. Because of the lack of knowledge on technical aspects of the fuel, it is recommended that instructors in automotive programs incorporate a one to two hour class covering ethanol fuels into their courses. The second part of this study was a review of several material compatibility studies conducted at Minnesota State University, Mankato on 20% ethanol blends. The studies were conducted on fuel system rubbers, plastics, and metals. Minnesota recently enacted a law that will require all gasoline sold in the state to contain 20% ethanol. These studies were reviewed to see if 20% ethanol, E20, will cause any vehicle fuel system problems that automotive technicians should know about. After reviewing the studies it was determined that the likelihood of fuel system problems from E20 would be very small and isolated. Even though the potential for

77 FR 55898 - Request for Comments on a Renewal of a Previously Approved Information Collection: Automotive...

Science.gov (United States)

2012-09-11

...: Kenneth R. Katz, Fuel Economy Division, Office of International Policy, Fuel Economy and Consumer Programs... Fuel Economy Reports ACTION: Notice and request for comments. SUMMARY: In compliance with the Paperwork... Part 537, Automotive Fuel Economy Reports. OMB Control Number: 2127-0019. Type of Request: Renewal of a...

75 FR 6112 - Approval and Promulgation of Air Quality Implementation Plans; Georgia: Update to Materials...

Science.gov (United States)

2010-02-08

...) Incinerators........ 6/15/98 12/2/99, 64 FR 67491 391-3-1-.02(2)(d) Fuel-burning 1/17/79 9/18/79, 44 FR 54047...-.02(2)(aa) VOC Emissions from 1/9/91 10/13/92, 57 FR 46780 Wire Coating. 391-3-1-.02(2)(bb) Petroleum...)(lll) NOX Emissions from 2/16/00 7/10/01, 66 FR 35906 Fuel-burning Equipment. 391-3-1-.02(2)(mmm) NOX...

Final report: U.S. competitive position in automotive technologies

Energy Technology Data Exchange (ETDEWEB)

Albert, Michael B.; Cheney, Margaret; Thomas, Patrick; Kroll, Peter

2002-09-30

Patent data are presented and analyzed to assess the U.S. competitive position in eleven advanced automotive technology categories, including automotive fuel cells, hydrogen storage, advanced batteries, hybrid electric vehicles and others. Inventive activity in most of the technologies is found to be growing at a rapid pace, particularly in advanced batteries, automotive fuel cells and ultracapacitors. The U.S. is the clear leader in automotive fuel cells, on-board hydrogen storage and light weight materials. Japan leads in advanced batteries, hybrid electric vehicles, ultracapacitors, and appears to be close to overtaking the U.S. in other areas of power electronics.

Satisfaction of the Automotive Fleet Fuel Demand and Its Impact on the Oil Refining Industry

Science.gov (United States)

1980-12-01

Because virtually all transportation fuels are based on petroleum, it is essential to include petroleum refining in any assessment of potential changes in the transportation system. A number of changes in the automotive fleet have been proposed to im...

Technology development goals for automotive fuel cell power systems. Final report

Energy Technology Data Exchange (ETDEWEB)

James, B.D.; Baum, G.N.; Kuhn, I.F. Jr. [Directed Technologies, Inc., Arlington, VA (United States)

1994-08-01

This report determines cost and performance requirements for Proton Exchange Membrane (PEM) fuel cell vehicles carrying pure H{sub 2} fuel, to achieve parity with internal combustion engine (ICE) vehicles. A conceptual design of a near term FCEV (fuel cell electric vehicle) is presented. Complete power system weight and cost breakdowns are presented for baseline design. Near term FCEV power system weight is 6% higher than ICE system, mid-term FCEV projected weights are 29% lower than ICE`s. There are no inherently high-cost components in FCE, and at automotive production volumes, near term FCEV cost viability is closer at hand than at first thought. PEM current vs voltage performance is presented for leading PEM manufacturers and researchers. 5 current and proposed onboard hydrogen storage techniques are critically compared: pressurized gas, cryogenic liquid, combined pressurized/cryogenic, rechargeable hydride, adsorption. Battery, capacitor, and motor/controller performance is summarized. Fuel cell power system component weight and cost densities (threshold and goal) are tabulated.

Assessment of effects of maturity of Japan`s economy and society and improvement in automotive fuel consumption on demand for automotive fuels; Nippon keizai shakai no seijukuka to nenpi kaizen ga jidoshayo nenryo juyo ni ataeru eikyo hyoka

Energy Technology Data Exchange (ETDEWEB)

Shimomura, S. [The Institute of Energy Economics, Tokyo (Japan)

1998-04-01

This paper evaluates impacts of the maturity of Japan`s economy and society and the improvement in automotive fuel efficiency on the demand for automotive fuels by FY 2010. Standard case and lower order case were examined. When the traffic volume of passenger cars in FY 1995 is assumed to be 100, it become 121 and 119 in standard and lower order cases, respectively. The traffic volume of lorries become 106 and 102 in standard and lower order cases, respectively, which showed a rather small growth. Deterioration rate of the fuel consumption was estimated by considering the difference in fuel consumption of new cars and existing cars. Although the fuel consumption will be lowered by FY 2000 when the cassation rate of ordinary passenger cars will rapidly increase, the impact will be lowered after that. For lorries for commercial use, the running fuel consumption will be gradually lowered due to the increased carrying capacity and vehicle weight a lorry with improving the transportation efficiency. Decreased running speed by traffic jam is also a cause of the deterioration of fuel consumption. When a policy of improvement in the fuel consumption is promoted in a background of CO2 issues, the fuel consumption of each vehicle will be gradually improved. The peak of fuel demand will be in FY 2005 by considering the changes in economical and social structures and the improvement in fuel consumption for the environmental protection. 5 figs., 3 tabs.

CALiPER Report 22.1: Photoelectric Performance of LED MR16 Lamps

Energy Technology Data Exchange (ETDEWEB)

Royer, Michael P. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Poplawski, Michael E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Brown, Charles C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Merzouk, Massine B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2015-09-01

This report is a follow-up to CALiPER Application Summary Report 22, which investigated the photometric performance of LED MR16 lamps. The initial report found that many of the LED MR16 lamps did not perform as required by ENERGY STAR based on their equivalency claims, although they generally did provide substantial efficacy advantages compared to halogen MR16 lamps. All testing was completed using laboratory power supplies, with all but one product tested at 12 V AC. In contrast, this report examined the photoelectric performance of the same set of lamps, using commercially available transformers and dimmers as well as laboratory power supplies providing both AC and DC power.

Characterizing automotive fuel cell materials by soft x-ray scanning transmission x-ray microscopy

International Nuclear Information System (INIS)

Hitchcock, A. P.; Lee, V.; Wu, J.; Cooper, G.; West, M. M.; Berejnov, V.; Soboleva, T.; Susac, D.; Stumper, J.

2016-01-01

Proton-Exchange Membrane Fuel Cell (PEM-FC) based engines are being developed rapidly for near-term implementation in hydrogen fueled, mass production, personal automobiles. Research is focused on understanding and controlling various degradation processes (carbon corrosion, Pt migration, cold start), and reducing cost by reducing or eliminating Pt catalyst. We are using soft X-ray scanning transmission X-ray microscopy (STXM) at the S 2p, C 1s, O 1s and F 1s edges to study a variety of issues related to optimization of PEM-FC materials for automotive applications. A method to efficiently and accurately measure perfluorosulfonic acid distributions was developed and is being used to better understand how different loadings and preparation methods affect the ionomer distribution in the cathode. Progress towards an environmental cell capable of controlling the temperature and humidity of a PEM-FC sample in the STXM is described. Methods for studying the 3D chemical structure of PEM-FC are outlined

Characterizing automotive fuel cell materials by soft x-ray scanning transmission x-ray microscopy

Energy Technology Data Exchange (ETDEWEB)

Hitchcock, A. P., E-mail: aph@mcmaster.ca; Lee, V.; Wu, J.; Cooper, G. [Chemistry & Chemical Biology, McMaster University, Hamilton, ON, L8S 4M1 (Canada); West, M. M.; Berejnov, V. [Faculty of Health Sciences Electron Microscopy, McMaster University, Hamilton, ON L8N 3Z5 (Canada); Soboleva, T.; Susac, D.; Stumper, J. [Automotive Fuel Cell Cooperation Corp., Burnaby BC V5J 5J8 (Canada)

2016-01-28

Proton-Exchange Membrane Fuel Cell (PEM-FC) based engines are being developed rapidly for near-term implementation in hydrogen fueled, mass production, personal automobiles. Research is focused on understanding and controlling various degradation processes (carbon corrosion, Pt migration, cold start), and reducing cost by reducing or eliminating Pt catalyst. We are using soft X-ray scanning transmission X-ray microscopy (STXM) at the S 2p, C 1s, O 1s and F 1s edges to study a variety of issues related to optimization of PEM-FC materials for automotive applications. A method to efficiently and accurately measure perfluorosulfonic acid distributions was developed and is being used to better understand how different loadings and preparation methods affect the ionomer distribution in the cathode. Progress towards an environmental cell capable of controlling the temperature and humidity of a PEM-FC sample in the STXM is described. Methods for studying the 3D chemical structure of PEM-FC are outlined.

MR imaging and MR spectroscopy for characterization of cardiomyopathies in adolescents - preliminary results

International Nuclear Information System (INIS)

Beer, M.; Buchner, S.; Fuchs, J.; Machann, W.; Ritter, C.O.; Beissert, M.; Darge, K.; Hahn, D.; Koestler, H.; Wirbelauer, J.

2007-01-01

Purpose: Cardiomyopathy is a rare but life-threatening disease in children and adolescents. Recent studies reported morphological, functional or metabolic alterations of the heart. We discuss a combined MR imaging and 31 P MR spectroscopy (MRS) protocol allowing the analysis of interdependencies between these parameters. Since normal values of cardiac MR parameters in this age group are not available, we included studies of age-matched healthy adolescents. Materials and Methods: 2D-CINE was used to assess left ventricular (LV) parameters. Additional 3D-Chemical Shift Imaging (3D-CSI) and Spectral Localization with Optimal Pointspread Function (SLOOP) reconstruction allowed quantification of the cardiac energy metabolism. Patients (n = 4; all male; age 16.8 ± 2.9 years) were included on the basis of an echocardiographic diagnosis of possible cardiomyopathy. The same protocol was applied to healthy young volunteers (n = 4; 1 female, 3 male; age 15.5 ± 0.6 years). Results: The patients had a significantly higher LV mass index compared to the control group (147 ± 41 g/m2 versus 97 ± 16 g/m2; p = 0.04). The other LV parameters (including LV EF with 59 ± 22 % versus 67 ± 10 %) showed no significant differences. The phosphocreatine to adenosine triphosphate ratio (PCr/ATP-ratio) of the patients was reduced to 1.71 ± 0.40 versus 2.44 ± 0.30 (p = 0.01), combined with a tendency towards decreased PCr concentrations of 9.1 ± 2.5 versus 7.9 ± 1.0 mmol/kg. Conclusion: The combination of 31 P MR spectroscopy and MR imaging allows quantitative determination of morphologic, functional and metabolic alterations in adolescents with suspected cardiomyopathy in one examination procedure. The reduction of energy metabolism combined with unaltered global function may indicate a primary role of metabolism in the pathogenesis of cardiomyopathies in adolescents. (orig.)

Fuels for homogeneous charge compression ignition (HCCI) engines. Automotive fuels survey. Part 6

Energy Technology Data Exchange (ETDEWEB)

Van Walwijk, M.

2001-01-01

. - So far, HCCI operation is only possible at light engine loads. - Engine-out emissions of HC and CO are not low. A low-temperature exhaust catalyst is required. Because it is possible to operate HCCI engines using a wide range of fuels, the conventional fuel specifications are not appropriate for HCCI engines. A fuel characteristic like cetane number for example, which is important for fuels in conventional diesel engines, has lost its significance for HCCI engines. Fuels like gasoline and natural gas, for which no cetane number is defined, can be used in HCCI engines. Research to establish the fuel requirements for HCCI engines has commenced. The first results indicate that the auto-ignition temperature of the fuel is important, because it has to be below the temperature that is reached in the combustion chamber after compression. The auto-ignition temperature is not specified for conventional fuel applications. Also fuel characteristics that affect the formation of a homogeneous air/fuel mixture are important, because inhomogeneities in the mixture lead to increased emission of NOx and particulates from HCCI engines. Consequently, volatility of the fuel and also boiling point may be considered important. Volatility of diesel fuel is low for example. To obtain a homogeneous air/fuel mixture with diesel, the inlet charge must be heated. A low sulphur content of the fuel is important in order to obtain high exhaust gas aftertreatment conversion efficiency. HCCI operation of internal combustion engines if possible with the fuels that are currently considered for automotive use. There are minor operational differences between the fuels, but no fundamental barriers seem to exist. This means that the conventional fuels from crude oil can be used in HCCI engines. Because the infrastructure to produce and distribute these fuels already exists, this is a plus for market introduction of HCCI engines. Fuel specifications for conventional fuels are becoming more and more

49 CFR 537.9 - Determination of fuel economy values and average fuel economy.

Science.gov (United States)

2010-10-01

... 49 Transportation 6 2010-10-01 2010-10-01 false Determination of fuel economy values and average fuel economy. 537.9 Section 537.9 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AUTOMOTIVE FUEL ECONOMY REPORTS § 537.9 Determination of fuel...

Mass Production Cost Estimation For Direct H₂ PEM Fuel Cell Systesm for Automotive Applications. 2010 Update

Energy Technology Data Exchange (ETDEWEB)

James, Brian D. [Directed Technologies, Arlington, VA (United States); Kalinoski, Jeffrey A. [Directed Technologies, Arlington, VA (United States); Baum, Kevin N. [Directed Technologies, Arlington, VA (United States)

2010-09-30

This report is the fourth annual update of a comprehensive automotive fuel cell cost analysis. It contains estimates for material and manufacturing costs of complete 80 kWnet direct-hydrogen proton exchange membrane fuel cell systems suitable for powering light-duty automobiles.

Engineering-economic analyses of automotive fuel economy potential in the United States

Energy Technology Data Exchange (ETDEWEB)

Greene, D.L.; DeCicco, J.

2000-02-01

Over the past 25 years more than 20 major studies have examined the technological potential to improve the fuel economy of passenger cars and light trucks in the US. The majority has used technology/cost analysis, a combination of analytical methods from the disciplines of economics and automotive engineering. In this paper the authors describe the key elements of this methodology, discuss critical issues responsible for the often widely divergent estimates produced by different studies, review the history of its use, and present results from six recent assessments. Whereas early studies tended to confine their scope to the potential of proven technology over a 10-year time period, more recent studies have focused on advanced technologies, raising questions about how best to include the likelihood of technological change. The paper concludes with recommendations for further research.

Measurement of P-31 MR relaxation times and concentrations in human brain and brain tumors

International Nuclear Information System (INIS)

Roth, K.; Naruse, S.; Hubesch, B.; Gober, I.; Lawry, T.; Boska, M.; Matson, G.B.; Weiner, M.W.

1987-01-01

Measurements of high-energy phosphates and pH were made in human brain and brain tumors using P-31 MR imaging. Using a Philips Gyroscan 1.5-T MRMRS, MR images were used to select a cuboidal volume of interest and P-31 MR spectra were obtained from that volume using the ISIS technique. An external quantitation standard was used. T 1 s were measured by inversion recovery. Quantitative values for metabolites were calculated using B 1 field plot of the head coil. The results for normal brain phosphates are as follows; adenosine triphosphate, 2.2 mM; phosphocreatin, 5.3 mM; inorganic phosphate, 1.6 mM. Preliminary studies with human brain tumors show a decrease of all phosphate compounds. These experiments are the first to quantitate metabolites in human brain

Fischer–tropsch diesel production and evaluation as alternative automotive fuel in pilot-scale integrated biomass-to-liquid process

International Nuclear Information System (INIS)

Kim, Young-Doo; Yang, Chang-Won; Kim, Beom-Jong; Moon, Ji-Hong; Jeong, Jae-Yong; Jeong, Soo-Hwa; Lee, See-Hoon; Kim, Jae-Ho; Seo, Myung-Won; Lee, Sang-Bong; Kim, Jae-Kon; Lee, Uen-Do

2016-01-01

Highlights: • A pilot scale biomass-to-liquid (BTL) process was investigated for Fischer-Tropsch diesel production. • 200 kW_t_h dual fluidized bed gasifier was integrated with 1 bbl/day F-T synthesis reactor. • Purified syngas satisfies minimum requirements of F-T synthesis. • F-T diesel produced successfully (1 L/h) and satisfies the automotive fuel standard. • Fully integrated BTL system was operated successfully more than 500 h. - Abstract: Fischer–Tropsch (F-T) diesel produced from biomass through gasification is a promising alternative fuel. In this study, a biomass-to-liquid (BTL) system involving a dual fluidized bed gasifier (DFBG), a methanol absorption tower, and an F-T synthesis process was investigated for producing clean biodiesel as an automotive fuel. A DFBG, which is an efficient indirect gasifier, can produce syngas with high caloric value while minimizing the amount of nitrogen in the product gas. In order to meet the strict requirements of syngas for F-T synthesis, any contaminants in the syngas must be minimized and its composition must be carefully controlled. In this work, the syngas mainly comprised 35 vol% of H_2 and 21.3 vol% of CO. The concentrations of H_2S and COS in the syngas were less than 1 ppmV owing to the use of chilled methanol cleaning process. Furthermore, long-term operation of a fully integrated BTL system was successfully conducted for over 500 h. The results showed that the BTL diesel can be used as an alternative automotive diesel fuel.

16 x 16 Vantage+ Fuel Assembly Flow Vibrational Testing

International Nuclear Information System (INIS)

Chambers, Martin; Kurincic, Bojan

2014-01-01

Nuklearna Elektrarna Krsko (NEK) has experienced leaking fuel after increasing the cycle duration to 18 months. The leaking fuel mechanism has predominantly been consistent over multiple cycles and is typically observed in highly irradiated Fuel Assemblies (FA) after around 4 years of continuous operation that were located at the core periphery (baffle). The cause of the leaking fuel is due to Grid-To-Rod-Fretting (GRTF) and occasional debris fretting. NEK utilises a 16x16 Vantage+ FA design with all Inconel structural mixing vane grids (8 in total), Zirlo thimbles, Integral Fuel Burnable Absorber (IFBA) rods with enriched ZrB2, enriched Annular Blanket, Debris Filter Bottom Nozzle (DFBN), Removable Top Nozzle (RTN) and Zirlo fuel cladding material with a high burnup capability of 60 GWD/MTU. Numerous design and operational changes are thought to have reduced the original 16x16 FA design margin to fretting resistance of either vibration or its wear work rate, such as significant power uprate (spring force loss, rod creep down...), operational cycle duration increase from 12 to 18 months (increasing residence time as well as lead FA and fuel rod burnup values), Reactor Coolant System flow increase (increased vibration), removal of Thimble Plugs (increased bypass flow, increased vibration) and Zirc-4 to Zirlo cladding change (decreasing wear work rate). The fuel rod to grid spring as well as dimple contact areas are relatively smaller than other FA designs that exhibit good in-reactor fretting performance. A FA design change project to address the small rod to dimple / spring contact area and utilise fuel cladding oxide coating is currently being pursued with the fuel supplier. The FA vibrational properties are very important to the in-reactor FA performance and reliability. The 16x16 Vantage+ vibrational testing was performed with a full size FA in the Fuel Assembly Compatibility Testing (FACTS) loop that is able to provide full flow rates at elevated temperature

78 FR 23630 - Notice of Final Federal Agency Actions on State Highway 99 (Segment C) in Texas

Science.gov (United States)

2013-04-19

... INFORMATION CONTACT: Mr. Gregory Punske, P.E., District Engineer, District B (South), Federal Highway...)]; Archeological and Historic Preservation Act [16 U.S.C. 469-469(c)]. 6. Social and Economic: Civil Rights Act of... Engineer. [FR Doc. 2013-08853 Filed 4-18-13; 8:45 am] BILLING CODE 4910-RY-P ...

Atmospheric Retrievals of HAT-P-16b and WASP-11b/HAT-P-10b

Science.gov (United States)

McIntyre, Kathleen; Harrington, Joseph; Challener, Ryan; Lenius, Maria; Hartman, Joel D.; Bakos, Gaspar A.; Blecic, Jasmina; Cubillos, Patricio E.; Cameron, Andrew

2018-01-01

We report Bayesian atmospheric retrievals performed on the exoplanets HAT-P-16b and WASP-11b/HAT-P-10b. HAT-P-16b is a hot (equilibrium temperature 1626 ± 40 K, assuming zero Bond albedo and efficient energy redistribution), 4.19 ± 0.09 Jupiter-mass exoplanet orbiting an F8 star every 2.775960 ± 0.000003 days (Buchhave et al 2010). WASP-11b/HAT-P-10b is a cooler (1020 ± 17 K), 0.487 ± 0.018 Jupiter-mass exoplanet orbiting a K3 star every 3.7224747 ± 0.0000065 days (Bakos et al. 2009, co-discovered by West et al. 2008). We observed secondary eclipses of both planets using the 3.6 μm and 4.5 μm channels of the Spitzer Space Telescope's Infrared Array Camera (program ID 60003). We applied our Photometry for Orbits, Eclipses, and Transits (POET) code to produce normalized eclipse light curves, and our Bayesian Atmospheric Radiative Transfer (BART) code to constrain the temperature-pressure profiles and atmospheric molecular abundances of the two planets. Spitzer is operated by the Jet Propulsion Laboratory, California Institute of Technology, under a contract with NASA. This work was supported by NASA Planetary Atmospheres grant NNX12AI69G and NASA Astrophysics Data Analysis Program grant NNX13AF38G.

The fuel cell: a coming technology for the cogeneration and the automotive; La pile a combustible: une technologie d'avenir pour la cogeneration et l'automobile

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

In the framework of the Eco-Industries 2000 meeting, the ATEE organized a colloquium on the fuel cell use in the automotive and cogeneration industries. This book presents the six papers proposed at this colloquium bringing information on the fuel cell market, design and advantages. In the automotive domain, the fuel cell integration in the future car at Renault is presented. The PEM (Proton Exchange Membrane) concept is also detailed. (A.L.B.)

Development of FR fuel cycle in japan (1) development scope of fuel cycle technology

International Nuclear Information System (INIS)

Nakamura, H.; Funasaka, H.; Namekawa, T.

2008-01-01

A fast reactor (FR) cycle has a potential to realize a sustainable energy supply system that is harmonized with environment by fully recycling both uranium (U) and transuranium (TRU) elements. In Japan, a Feasibility Study on Commercialized FR Cycle Systems (FS) was launched in July 1999, and through two different study phases, a final report was presented in 2006. As a result of FS, a combined system of sodium-cooled FR with mixed-oxide (MOX) fuel, advanced aqueous reprocessing and simplified pelletizing fuel fabrication was considered to be most promising for commercialization. The advanced aqueous reprocessing system, which is called the New Extraction system for TRU recovery (NEXT), consists of a U crystallization process for the bulk of U recovery, a simplified solvent extraction process for residual U, plutonium (Pu) and neptunium (Np) without Pu partitioning and purification, and a process for recovering americium (Am) and curium (Cm) from the raffinate. The ratio of Pu/U concentration in the mother solution after crystallization is adequate for MOX fuel fabrication, and thus complicated powder mixing processes for adjusting Pu content in MOX fuel can be eliminated in the subsequent simplified fuel fabrication system. In this system, lubricant-mixing process can also be eliminated by adopting the advanced technology in which lubricant is coated on the inner surface of a die before fuel powder supply. Such a simplification could help us overcoming the difficulty to treat MA bearing fuel powders in a hot cell. Ministry of Education, Culture, Sports, Science and Technology (MEXT) reviewed these results of FS in 2006 and identified the most promising FR cycle concept proposed in the FS phase II study as a mainline choice for commercialization. According to such a governmental assessment, R and D activities of FR cycle systems were decided to be concentrated mainly to the innovative technology development for the mainline concept. The stage of R and D project was

Two-body hypercharge-exchange reactions in K-p and π+p interactions at 10 and 16 GeV/c

International Nuclear Information System (INIS)

Girtler, P.; Otter, G.; Sliwa, K.; Barnham, K.W.J.; Eason, R.M.; Newham, P.; Pollock, B.; Wells, J.; Mandl, F.; Markytan, M.

1979-01-01

Cross section values or upper limits are presented for twenty-five two-body hypercharge-exchange reactions in K - p and π + p interactions at 10 and 16 GeV/c. The 16 GeV/c results are compared with some predictions of line-reversal plus exchange-degenerate Regge poles, of SU(3) and of the additive quark model. Agreement is found in all cases. (author)

Bimodal MR-PET agent for quantitative pH imaging

Science.gov (United States)

Frullano, Luca; Catana, Ciprian; Benner, Thomas; Sherry, A. Dean; Caravan, Peter

2010-01-01

Activatable or “smart” magnetic resonance contrast agents have relaxivities that depend on environmental factors such as pH or enzymatic activity, but the MR signal depends on relaxivity and agent concentration – two unknowns. A bimodal approach, incorporating a positron emitter, solves this problem. Simultaneous positron emission tomography (PET) and MR imaging with the biomodal, pH-responsive MR-PET agent GdDOTA-4AMP-F allows direct determination of both concentration (PET) and T1 (MRI), and hence pH. PMID:20191650

Degradation of automotive materials in palm biodiesel

International Nuclear Information System (INIS)

Fazal, M.A.; Haseeb, A.S.M.A.; Masjuki, H.H.

2012-01-01

As compared to petroleum diesel, biodiesel is more corrosive for automotive materials. Studies on the characterization of corrosion products of fuel exposed automotive materials are scarce. Automotive fuel system and engine components are made from different ferrous and non-ferrous materials. The present study aims to investigate the corrosion products of different types of automotive materials such as copper, brass, aluminum and cast iron upon exposure to diesel and palm biodiesel. Changes in fuel properties due to exposure of different materials were also examined. Degradation of metal surface was characterized by digital camera, SEM/EDS and X-ray diffraction (XRD). Fuel properties were examined by measuring TAN (total acid number), density and viscosity. Among the metal investigated, copper is found to be least resistant in biodiesel and formed comparatively more corrosion products than other metals. Upon exposure of metals in biodiesel, TAN number crosses the limit given by standard while density and viscosity remain within the acceptable range of limit. -- Highlights: ► Order of incompatible metals in palm biodiesel: copper > brass > aluminum > cast iron. ► The possible reactions for the degradation of copper and cast iron have been discussed. ► For metal exposed biodiesel, only TAN number crosses the limit while density and viscosity remain within the limit. ► Copper and copper based alloy (brass) increase TAN number comparatively more than other metals.

Sliding mode observer for proton exchange membrane fuel cell: automotive application

Science.gov (United States)

Piffard, Maxime; Gerard, Mathias; Fonseca, Ramon Da; Massioni, Paolo; Bideaux, Eric

2018-06-01

This work proposes a state observer as a tool to manage cost and durability issues for PEMFC (Proton Exchange Membrane Fuel Cell) in automotive applications. Based on a dead-end anode architecture, the observer estimates the nitrogen build-up in the anode side, as well as relative humidities in the channels. These estimated parameters can then be used at fuel cell management level to enhance the durability of the stack. This observer is based on transport equations through the membrane and it reconstructs the behavior of the water and nitrogen inside the channels without the need of additional humidity sensors to correct the estimate. The convergence of the output variables is proved with Lyapunov theory for dynamic operating conditions. The validation is made with a high-fidelity model running a WLTC (Worldwide harmonized Light vehicles Test Cycle). This observer provides the average values of nitrogen and relative humidities with sufficient precision to be used in a global real-time control scheme.

State of the art: Multi-fuel reformers for automotive fuel cell applications. Problem identification and research needs

Energy Technology Data Exchange (ETDEWEB)

Westerholm, R. [Stockholm Univ. (Sweden). Dept. of Analytical Chemistry; Pettersson, L.J. [Royal Inst. of Tech., Stockholm (Sweden). Dept. of Chemical Engineering and Technology

1999-12-01

On an assignment from the Transport and Communications Research Board (KFB) a literature study and a study trip to the USA and Great Britain have been performed. The literature study and the study trip was made during late spring and autumn 1999.The purpose of the project was to collect available information about the chemical composition of the product gas from a multi-fuel reformer for a fuel cell vehicle. It was furthermore to identify problems and research needs. The report recommends directions for future major research efforts. The results of the literature study and the study trip led to the following general conclusions: With the technology available today it does not seem feasible to develop a highly efficient and reliable multi-fuel reformer for automotive applications, i. e. for applications where all types of fuels ranging from natural gas to heavy diesel fuels can be used. The potential for developing a durable and reliable system is considerably higher if dedicated fuel reformers are used.The authors propose that petroleum-derived fuels should be designed for potential use in mobile fuel cell applications. In the present literature survey and the site visit discussions we found that there are relatively low emissions from fuel cell engines compared to internal combustion engines. However, the major research work on reformers/fuel cells have been performed during steady-state operation. Emissions during start-up, shutdown and transient operation are basically unknown and must be investigated in more detail. The conclusions and findings in this report are based on open/available information, such as discussions at site visits, reports, scientific publications and symposium proceedings.

75 FR 34170 - Plastic Omnium Automotive Exteriors, LLC, Anderson, SC; Plastic Omnium Automotive Exteriors, LLC...

Science.gov (United States)

2010-06-16

... Omnium Automotive Exteriors, LLC, Anderson, SC; Plastic Omnium Automotive Exteriors, LLC, Troy, MI... the Anderson, South Carolina location of Plastic Omnium Automotive Exteriors, LLC, working out of Troy... certification to include workers in support of the Anderson, South Carolina facility working out of Troy...

The European automotive LPG market

International Nuclear Information System (INIS)

Anon.

1998-01-01

The European automotive LPG market could reach at least 4 % of the European fuel market in 2005 versus 1 % in 1990. This would represent a rise of about 35 % in automotive LPG sales (from 2,4 million tonnes in 1997 to 7 million tonnes estimated for 2005). This was underlined by Alain Deleuse, Primagaz group's Marketing Director, in the paper he delivered at the AEGPL Budapest Convention. We publish large excepts of this paper. (author)

Future automotive fuels

International Nuclear Information System (INIS)

Lepik, M.

1993-01-01

There are several important factors which are fundamental to the choice of alternative automobile fuels: the chain of energetic efficiency of fuels; costs; environmental friendliness; suitability for usual engines or adapting easiness; existing reserves of crude oil, natural gas or the fossil energy sources; and, alternatively, agricultural potentiality. This paper covers all these factors. The fuels dealt with in this paper are alcohol, vegetable oil, gaseous fuel, hydrogen and ammonia fuels. Renewable fuels are the most valuable forms of renewable energy. In addition to that rank, they can contribute to three other problem areas: agricultural surpluses, environmental degradation, and conservation of natural resources. Due to the competitive utilization of biomass for food energy production, bio-fuels should mainly be produced in those countries where an energy shortage is combined with a food surplus. The fuels arousing the most interest are alcohol and vegetable oil, the latter for diesel engines, even in northern countries. (au)

Twenty-five years after introduction of automotive catalysts. What next?

Energy Technology Data Exchange (ETDEWEB)

Shelef, M.; McCabe, R.W. [Chemical and Physical Sciences Laboratory, Ford Research Laboratory, Ford Motor Company, MD-3179, SRL, PO Box 2053, 48121 Dearborn, MI (United States)

2000-09-25

The union of catalysts and the automobile has been one of the greatest successes of heterogeneous catalysis over the last 25 years. Here, the history of automotive catalysis is briefly reviewed, followed by an assessment of where automotive catalysis stands today and where it is headed in the future. A key distinction between past automotive catalysis experience and that projected for the future is an increased focus on catalysts in upstream of power plant applications, such as on-board fuel processing units for fuel cell vehicles. Driven by ever tighter regulations, there will be continued research and development activity focused also on downstream applications (i.e. exhaust emission aftertreatment), especially for fuel-efficient, lean-burn vehicles, both diesel and spark-ignited.

Efficiency Standard in automotive industry

International Nuclear Information System (INIS)

Goldoni, G.

2008-01-01

A technological transition in the transport sector could be only be possible with a convergence of objectives of the automotive and the fuel industries, which is not very simple to obtain. Fuel economy standards could differently reduce the growing trend of CO 2 emissions in this sector but regulators should avoid capture from domestic industry. [it

Ceramic technologies for automotive industry: Current status and perspectives

International Nuclear Information System (INIS)

Okada, Akira

2009-01-01

The automotive industry has developed substantially through advances in mechanical technologies, and technologies such as electronics and advanced materials have also contributed to further advances in automobiles. The contribution of ceramic materials to automobile technologies ranges over driving performance, exhaust gas purification, and fuel efficiency improvements. Several ceramic components, such as knock sensors, oxygen sensors, exhaust gas catalysts, and silicon nitride parts for automotive engines, have been successfully applied to automobiles. This paper focuses on the contribution of ceramics to automotive technologies. It also mentions potential contributions in the future, including adiabatic turbo-compound diesels, ceramic gas turbines, fuel cells, and electric vehicles because ceramic technologies have been intensively involved in the challenge to achieve advanced power sources.

Multiwalled carbon nanotubes and fluoroelastomer antistatic nanocomposite for automotive fuel system components

Energy Technology Data Exchange (ETDEWEB)

Lee, Seok; Park, Seong Hwan; Ha, Kiryong [Keimyung University, Daegu (Korea, Republic of); Lee, Jong Cheol [Jin-Yang Oil Seal Co., Ltd., Daegu (Korea, Republic of)

2016-03-15

Fluoroelastomer (FKM) composites, reinforced with multiwalled carbon nanotubes (MWNTs), were prepared by conventional method to determine the possibility of using MWNTs to develop an antistatic composite in automotive fuel systems. The results obtained from the composite containing 0-9 phr of MWNTs were compared. A 5 points increase in hardness was achieved with the addition of only 1 phr of MWNTs and 9 phr added FKM composite was increased 6.4MPa in tensile strength compared to the MWNTs unfilled FKM composite. In addition, electrical conductivity increased from 0 to 1.039 Scm{sup -1} with increase in the MWNTs concentration, and the dynamic damping property was increased in the rubbery state region accordingly. These phenomena can be explained by the MWNTs networks formed in FKM matrix. This research will therefore be useful in the development of an antistatic rubber composite for fuel system components, which are deformed or vibrated while in operation.

Multiwalled carbon nanotubes and fluoroelastomer antistatic nanocomposite for automotive fuel system components

International Nuclear Information System (INIS)

Lee, Seok; Park, Seong Hwan; Ha, Kiryong; Lee, Jong Cheol

2016-01-01

Fluoroelastomer (FKM) composites, reinforced with multiwalled carbon nanotubes (MWNTs), were prepared by conventional method to determine the possibility of using MWNTs to develop an antistatic composite in automotive fuel systems. The results obtained from the composite containing 0-9 phr of MWNTs were compared. A 5 points increase in hardness was achieved with the addition of only 1 phr of MWNTs and 9 phr added FKM composite was increased 6.4MPa in tensile strength compared to the MWNTs unfilled FKM composite. In addition, electrical conductivity increased from 0 to 1.039 Scm -1 with increase in the MWNTs concentration, and the dynamic damping property was increased in the rubbery state region accordingly. These phenomena can be explained by the MWNTs networks formed in FKM matrix. This research will therefore be useful in the development of an antistatic rubber composite for fuel system components, which are deformed or vibrated while in operation.

Cerebral cavernous angioma. 16 cases. Aspects in CT and MR

International Nuclear Information System (INIS)

Pina, J.I.; Medrano, J.; Lasierra, R.; Benito, J.L. de; Feijoo, R.; Fernandez, J.A.; Villavieja, J.L.

1995-01-01

The cerebral cavernous angioma (CA) is included in the group of cerebral malformations that can not be detected angiographically. We present the retrospective study of 16 patients, diagnosed as having CA, comparing the data provided by CT and MR, as well as the contribution of cerebral angiography. (Author) 25 refs

Techno-economic requirements for automotive composites

Science.gov (United States)

Arnold, Scot

1993-01-01

New technology generally serves two main goals of the automotive industry: one is to enable vehicles to comply with various governmental regulations and the other is to provide a competitive edge in the market. The latter goal can either be served through improved manufacturing and design capabilities, such as computer aided design and computer aided manufacturing, or through improved product performance, such as anti-lock braking (ABS). Although safety features are sometimes customer driven, such as the increasing use of airbags and ABS, most are determined by regulations as outlined by the Federal Motor Vehicle Safety Standards (FMVSS). Other standards, set by the Environmental Protection Agency, determine acceptable levels of emissions and fuel consumption. State governments, such as in California, are also setting precedent standards, such as requiring manufacturers to offer zero-emission vehicles as a certain fraction of their sales in the state. The drive to apply new materials in the automobile stems from the need to reduce weight and improve fuel efficiency. Topics discussed include: new lightweight materials; types of automotive materials; automotive composite applications; the role for composite materials in automotive applications; advantages and disadvantages of composite materials; material substitution economics; economic perspective; production economics; and composite materials production economics.

Final report on development and operation of instrumented irradiation capsules for creep experiments on nuclear fuels at FR2

International Nuclear Information System (INIS)

Haefner, H.E.; Philipp, K.; Blumhofer, M.

1980-02-01

The capsule test rig No. 154 removed from FR2 in April 1979 was the last irradiation rig in a long series of creep experiments. The target of the irradiation tests, started exactly ten years ago, was to investigate the creep behaviour of various ceramic nuclear fuels under different in-pile irradiation conditions. An irradiation test rig had been developed for this purpose which allowed the continuous measurement of changes in length of fuel specimens. A total of 28 capsule test rigs each containing two packages of creep specimens have been irradiated in FR2 during this decade. They included 23 specimen stacks of UO 2 , 16 specimen stacks of UO 2 -PuO 2 , 4 specimen stacks of UN, 10 specimen stacks of (U,Pu) C, and 13 reference specimens of molybdenum. Besides the description of the test facility, the report provides above all a survey of the operation data applicable to the specimens and of the operating experience gathered as well as of the findings obtained in post-irradiation examinations. (orig.) [de

HAT-P-16b

DEFF Research Database (Denmark)

Buchhave, Lars A.; Bakos, G. A.; Hartman, J. D.

2010-01-01

We report the discovery of HAT-P-16b, a transiting extrasolar planet orbiting the V = 10.8 mag F8 dwarf GSC 2792-01700, with a period P = 2.775960 ± 0.000003 days, transit epoch Tc = 2455027.59293 ± 0.00031 (BJD10), and transit duration 0.1276 ± 0.0013 days. The host star has a mass of 1.22 ± 0.0...

MR investigation of recurrent cholesteatomas

International Nuclear Information System (INIS)

Doyon, D.; Chan, K.Y.; Attia, M.; Halimi, P.; Sigal, R.; Bobin, S.; Sterkers, J.M.

1989-01-01

Nine cases of recurrent petrous cholesteatomas have been studied by a 1.5 T MR unit. Gadolinium was injected in 1 case. In all cases, comparison between MR, CT and clinical findings were made. MR allows for accurate topographic study and assessment of cholesteatomas extension, in particular in the posterior fossa and skull base. Relationships with the internal carotid artery and the jugular vein are clearly depicted [fr

Japanese automotive transportation sector's impact upon global warming

International Nuclear Information System (INIS)

Imaseki, Takashi

1998-01-01

Automobiles are still increasing in number in Japan. If this continues, CO 2 emissions in this sector may increase through the first half of the 21st century. Consequently, a study of measures for reducing these CO 2 emissions is essential. In this paper, possible automotive technologies, improvements in fuel consumption and the introduction of electric vehicles are discussed. These measures are then evaluated for the Japanese case. Furthermore, market penetration of these technologies is evaluated, using life-cycle cost analysis based on initial cost and annual fuel cost. It is concluded that reducing CO 2 emissions to 1995 levels by 2010 is possible. This would require the simultaneous implementation of fuel-consumption improvements and the introduction of electric vehicles. However, automotive consumers would be reluctant to accept these technologies, particularly electric vehicles, because of their high purchase-price and low benefits in terms of operating economy. Acceptance will require financial and institutional support from the public sector in introducing these automotive technologies into the Japanese transportation sector. (author)

16th International Forum on Advanced Microsystems for Automotive Applications (AMAA)

CERN Document Server

Advanced Microsystems for Automotive Applications 2012 : Smart Systems for Safe, Sustainable and Networked Vehicles

2012-01-01

The ambitious objectives of future road mobility, i.e. fuel efficiency, reduced emissions, and zero accidents, imply a paradigm shift in the concept of the car regarding its architecture, materials, and propulsion technology, and require an intelligent integration into the systems of transportation and power. ICT, components and smart systems have been essential for a multitude of recent innovations, and are expected to be key enabling technologies for the changes ahead, both inside the vehicle and at its interfaces for the exchange of data and power with the outside world. It has been the objective of the International Forum on Advanced Microsystems for Automotive Applications (AMAA) for almost two decades to detect novel trends and to discuss technological implications and innovation potential from day one on. In 2012, the topic of the AMAA conference is “Smart Systems for Safe, Sustainable and Networked Vehicles”. The conference papers selected for this book address current research, developments and i...

CALiPER Application Summary Report 22: LED MR16 Lamps

Energy Technology Data Exchange (ETDEWEB)

None, None

2014-09-01

An initial sample of 27 LED MR16 lamps and 8 halogen benchmarks underwent photometric testing according to IES LM-79-08. CALiPER Application Summary Report 22 focuses on the initial performance based on light output, efficacy, distribution, color quality, electrical characteristics, and form factor, with comparisons to the benchmarks and ENERGY STAR qualification thresholds.

Bone marrow MR imaging findings in disuse osteoporosis

International Nuclear Information System (INIS)

Abreu, Marcelo R. de; Wesselly, Michelle; Chung, Christine B.; Resnick, Donald

2011-01-01

To demonstrate MR imaging findings in the cortical and trabecular bone as well as marrow changes in patients with disuse osteoporosis (DO). Sixteen patients (14 men, 2 women, aged 27-86 years) with clinical and radiographic evidence of DO of a lower limb joint (10 knees, 6 ankles) with MR examination of the same joint performed within a 1-month period were selected, as well as 16 healthy volunteers (7 men, 9 women, aged 25-75 years, 10 knees and 6 ankles). MR imaging findings of the bone marrow were analyzed by 2 musculoskeletal radiologists in consensus regarding: diffuse or focal signal alteration, reinforcement of vertical or longitudinal trabecular lines, and presence of abnormal vascularization. All patients (100%,16/16) with DO presented MR imaging abnormalities of the bone marrow, such as: accentuation of vertical trabecular lines (50%, 8/16), presence of subchondral lobules of fat (37.5%, 6/16), presence of horizontal trabecular lines (31%, 5/16), prominence of bone vessels (25%, 4/16), and presence of dotted areas of high signal intensity on T2-weighted fat-suppressed sequences (12.5%, 2/16). Such MR findings did not appear in the control individuals. There are several MR imaging findings in bones with DO that range from accentuation of vertical and horizontal marrow lines, presence of subchondral lobules of fat, prominent bone vascularization and the presence of dotted foci of high signal intensity on T2-weighted fat-suppressed sequences. Recognition of these signs may prove helpful in the identification of DO as well as distinguishing these findings from other entities. (orig.)

Automotive Mechanics Curriculum Outline for Secondary Schools. Vocational Education Curriculum Guide.

Science.gov (United States)

Louisiana State Dept. of Education, Baton Rouge. Div. of Vocational Education.

This curriculum outline for secondary automotive mechanics is structured around Louisiana's Vocational-Technical Automotive Mechanics Curriculum. The curriculum is composed of 16 units of instruction, covering the following topics: benchwork, fundamentals of automotive engines, preventive maintenance, automotive brakes, steering and front…

Automotive Stirling engine: Mod 2 design report

Science.gov (United States)

Nightingale, Noel P.

1986-01-01

The design of an automotive Stirling engine that achieves the superior fuel economy potential of the Stirling cycle is described. As the culmination of a 9-yr development program, this engine, designated the Mod 2, also nullifies arguments that Stirling engines are heavy, expensive, unreliable, demonstrating poor performance. Installed in a General Motors Chevrolet Celebrity car, this engine has a predicted combined fuel economy on unleaded gasoline of 17.5 km/l (41 mpg)- a value 50% above the current vehicle fleet average. The Mod 2 Stirling engine is a four-cylinder V-drive design with a single crankshaft. The engine is also equipped with all the controls and auxiliaries necessary for automotive operation.

General Mechanical Repair. Minor Automotive Maintenance. Volume 1. Teacher's Guide.

Science.gov (United States)

East Texas State Univ., Commerce. Occupational Curriculum Lab.

Fourteen units on minor automotive maintenance are presented in this teacher's guide. The units are the following: introduction to minor automotive maintenance, shop safety, engine principles, fuel system operation and repair, electrical system, ignition system, lubrication system, engine cooling system, exhaust system, wheel bearings and tires,…

76 FR 15855 - Denial of Petitions for Reconsideration of Regulation of Fuels and Fuel Additives: Changes to...

Science.gov (United States)

2011-03-22

... Petitions for Reconsideration of Regulation of Fuels and Fuel Additives: Changes to Renewable Fuel Standard..., published on March 26, 2010 (75 FR 14670), which amended the Renewable Fuel Standard Program pursuant to... renewable fuels to verify domestic crops and crop residues used to produce the renewable fuels complied with...

16 CFR 306.6 - Certification.

Science.gov (United States)

2010-01-01

...) Include a delivery ticket or other paper with each transfer of automotive fuel. It may be an invoice, bill of lading, bill of sale, terminal ticket, delivery ticket, or any other written proof of transfer. It... new automotive fuel either with a delivery ticket or by sending a new letter of certification. (c...

Nano-crystalline P/M aluminium for automotive applications

International Nuclear Information System (INIS)

Hummert, K; Schattevoy, R; Broda, M; Knappe, M; Beiss, P; Klubberg, F; Schubert, T H; Leuschner, R

2009-01-01

The reduction of total vehicle weight and lowering of moving masses within the engine are key elements to overcome future emission challenges of the automotive industry. Within a German BMBF funded project the melt spinning technology will be driven to a series production status. The very fast cooling condition of the melt leads to a nano-structure of the aluminium material. This results in new material properties of known alloys. The strength increases dramatically without lowered forming behaviour. With this process the freedom of designing complex alloys is very flexible. Different alloys have been investigated for several applications, where high strength at room and elevated temperatures and/or high wear resistance is required. This paper presents some results regarding the processing, microstructure and mechanical properties of a developed Al-Ni-Fe alloy. This joined research project with partners from the automotive industry as well as automotive suppliers and universities is funded by the German BMBF 'NanoMobile' Program under Project number 03X3008.

MR cholangiopancreatography. Comparison of images obtained with 1.0 and 1.5 tesla units

International Nuclear Information System (INIS)

Yasui, Masayasu; Ito, Katsuyoshi; Koike, Shinji; Matsunaga, Naofumi

2002-01-01

The purpose of this study was to compare the image quality and visualization obtained in MR cholangiopancreatography (MRCP) using different high-field strength (1.0 vs. 1.5 Tesla) MR units and to assess the effect of field strength on MRCP. This study population included 10 healthy volunteers and 37 patients suspected of having pancreatobiliary diseases. MRCP images were obtained using two MR units with different high-field strengths (1.0 and 1.5 Tesla), with half-Fourier acquisition single-shot turbo spin-echo (HASTE) and rapid acquisition by relaxation enhancement (RARE) sequences. The image quality and visualization of each portion of the pancreatobiliary system were graded and recorded using a four-point scale. Additionally, the signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) were measured. The SNR and CNR in HASTE sequences acquired with the 1.5 Tesla (T) unit were significantly higher than those acquired with the 1.0 T unit (p=0.001). In qualitative analysis, there were no statistically significant differences in image quality or visualization of the ducts in either HASTE or RARE sequences between 1.0 T and 1.5 T. Our study showed that visual image quality provided by MRCP was equivalent at 1.0 and 1.5 T. (author)

Accelerator-driven systems (ADS) and fast reactors (FR) in advanced nuclear fuel cycles

International Nuclear Information System (INIS)

2002-01-01

The long-term hazard of radioactive waste arising from nuclear energy production is a matter of continued discussion and public concern in many countries. Through partitioning and transmutation (P and T) of the actinides and some of the long-lived fission products, the radiotoxicity of high-level waste (HLW) can be reduced by a factor of 100 compared with the current once-through fuel cycle. This requires very effective reactor and fuel cycle strategies, including fast reactors (FR) and/or accelerator-driven, sub-critical systems (ADS). The present study compares FR- and ADS-based actinide transmutation systems with respect to reactor properties, fuel cycle requirements, safety, economic aspects and (R and D) needs. Several advanced fuel cycle strategies are analysed in a consistent manner to provide insight into the essential differences between the various systems in which the role of ADS is emphasised. The report includes a summary aimed at policy makers and research managers as well as a detailed technical section for experts in this domain. (authors)

Conduction-driven cooling of LED-based automotive LED lighting systems for abating local hot spots

Science.gov (United States)

Saati, Ferina; Arik, Mehmet

2018-02-01

Light-emitting diode (LED)-based automotive lighting systems pose unique challenges, such as dual-side packaging (front side for LEDs and back side for driver electronics circuit), size, harsh ambient, and cooling. Packaging for automotive lighting applications combining the advanced printed circuit board (PCB) technology with a multifunctional LED-based board is investigated with a focus on the effect of thermal conduction-based cooling for hot spot abatement. A baseline study with a flame retardant 4 technology, commonly known as FR4 PCB, is first compared with a metal-core PCB technology, both experimentally and computationally. The double-sided advanced PCB that houses both electronics and LEDs is then investigated computationally and experimentally compared with the baseline FR4 PCB. Computational models are first developed with a commercial computational fluid dynamics software and are followed by an advanced PCB technology based on embedded heat pipes, which is computationally and experimentally studied. Then, attention is turned to studying different heat pipe orientations and heat pipe placements on the board. Results show that conventional FR4-based light engines experience local hot spots (ΔT>50°C) while advanced PCB technology based on heat pipes and thermal spreaders eliminates these local hot spots (ΔT<10°C), leading to a higher lumen extraction with improved reliability. Finally, possible design options are presented with embedded heat pipe structures that further improve the PCB performance.

Industrial Maturity of FR Fuel Cycle Processes and Technologies

International Nuclear Information System (INIS)

Bruezière, Jérôme

2013-01-01

FR fuel cycle processes and technologies have already been proven industrially for Oxide Fuel, and to a lesser extent for metal fuel. In addition, both used oxide fuel reprocessing and fresh oxide fuel manufacturing benefit from similar industrial experience currently deployed for LWR. Alternative fuel type will have to generate very significant benefit in reactor ( safety, cost, … ) to justify corresponding development and industrialization costs

A comparison of MR elastography and {sup 31}P MR spectroscopy with histological staging of liver fibrosis

Energy Technology Data Exchange (ETDEWEB)

Godfrey, Edmund M. [St James' Hospital, Leeds (United Kingdom); St James' Hospital, Department of Radiology, Leeds (United Kingdom); Patterson, Andrew J.; Priest, Andrew N.; Davies, Susan E.; Joubert, Ilse; Krishnan, Anant S.; Shaw, Ashley S.; Alexander, Graeme J.; Allison, Michael E.; Griffiths, William J.H.; Gimson, Alexander E.S. [Addenbrooke' s Hospital, Cambridge (United Kingdom); Griffin, Nyree [St Thomas' s Hospital, London (United Kingdom); Lomas, David J. [University of Cambridge, Department of Radiology, Cambridge (United Kingdom)

2012-12-15

Conventional imaging techniques are insensitive to liver fibrosis. This study assesses the diagnostic accuracy of MR elastography (MRE) stiffness values and the ratio of phosphomonoesters (PME)/phosphodiesters (PDE) measured using {sup 31}P spectroscopy against histological fibrosis staging. The local research ethics committee approved this prospective, blinded study. A total of 77 consecutive patients (55 male, aged 49 {+-} 11.5 years) with a clinical suspicion of liver fibrosis underwent an MR examination with a liver biopsy later the same day. Patients underwent MRE and {sup 31}P spectroscopy on a 1.5 T whole body system. The liver biopsies were staged using an Ishak score for chronic hepatitis or a modified NAS fibrosis score for fatty liver disease. MRE increased with and was positively associated with fibrosis stage (Spearman's rank = 0.622, P < 0.001). PME/PDE was not associated with fibrosis stage (Spearman's rank = -0.041, p = 0.741). Area under receiver operating curves for MRE stiffness values were high (range 0.75-0.97). The diagnostic utility of PME/PDE was no better than chance (range 0.44-0.58). MRE-estimated liver stiffness increases with fibrosis stage and is able to dichotomise fibrosis stage groupings. We did not find a relationship between {sup 31}P MR spectroscopy and fibrosis stage. circle Magnetic resonance elastography (MRE) and MR spectroscopy can both assess the liver. (orig.)

Integrated PET/MR breast cancer imaging: Attenuation correction and implementation of a 16-channel RF coil

Energy Technology Data Exchange (ETDEWEB)

Oehmigen, Mark, E-mail: mark.oehmigen@uni-due.de; Lindemann, Maike E. [High Field and Hybrid MR Imaging, University Hospital Essen, Essen 45147 (Germany); Lanz, Titus [Rapid Biomedical GmbH, Rimpar 97222 (Germany); Kinner, Sonja [Institute for Diagnostic and Interventional Radiology and Neuroradiology, University Hospital Essen, Essen 45147 (Germany); Quick, Harald H. [High Field and Hybrid MR Imaging, University Hospital Essen, Essen 45147, Germany and Erwin L. Hahn Institute for MR Imaging, University Duisburg-Essen, Essen 45141 (Germany)

2016-08-15

Purpose: This study aims to develop, implement, and evaluate a 16-channel radiofrequency (RF) coil for integrated positron emission tomography/magnetic resonance (PET/MR) imaging of breast cancer. The RF coil is designed for optimized MR imaging performance and PET transparency and attenuation correction (AC) is applied for accurate PET quantification. Methods: A 16-channel breast array RF coil was designed for integrated PET/MR hybrid imaging of breast cancer lesions. The RF coil features a lightweight rigid design and is positioned with a spacer at a defined position on the patient table of an integrated PET/MR system. Attenuation correction is performed by generating and applying a dedicated 3D CT-based template attenuation map. Reposition accuracy of the RF coil on the system patient table while using the positioning frame was tested in repeated measurements using MR-visible markers. The MR, PET, and PET/MR imaging performances were systematically evaluated using modular breast phantoms. Attenuation correction of the RF coil was evaluated with difference measurements of the active breast phantoms filled with radiotracer in the PET detector with and without the RF coil in place, serving as a standard of reference measurement. The overall PET/MR imaging performance and PET quantification accuracy of the new 16-channel RF coil and its AC were then evaluated in first clinical examinations on ten patients with local breast cancer. Results: The RF breast array coil provides excellent signal-to-noise ratio and signal homogeneity across the volume of the breast phantoms in MR imaging and visualizes small structures in the phantoms down to 0.4 mm in plane. Difference measurements with PET revealed a global loss and thus attenuation of counts by 13% (mean value across the whole phantom volume) when the RF coil is placed in the PET detector. Local attenuation ranging from 0% in the middle of the phantoms up to 24% was detected in the peripheral regions of the phantoms at

Starch-fueled microbial fuel cells by two-step and parallel fermentation using Shewanella oneidensis MR-1 and Streptococcus bovis 148.

Science.gov (United States)

Uno, Megumi; Phansroy, Nichanan; Aso, Yuji; Ohara, Hitomi

2017-08-01

Shewanella oneidensis MR-1 generates electricity from lactic acid, but cannot utilize starch. On the other hand, Streptococcus bovis 148 metabolizes starch and produces lactic acid. Therefore, two methods were trialed for starch-fueled microbial fuel cell (MFC) in this study. In electric generation by two-step fermentation (EGT) method, starch was first converted to lactic acid by S. bovis 148. The S. bovis 148 were then removed by centrifugation, and the fermented broth was preserved for electricity generation by S. oneidensis MR-1. Another method was electric generation by parallel fermentation (EGP) method. In this method, the cultivation and subsequent fermentation processes of S. bovis 148 and S. oneidensis MR-1 were performed simultaneously. After 1, 2, and 3 terms (5-day intervals) of S. oneidensis MR-1 in the EGT fermented broth of S. bovis 148, the maximum currents at each term were 1.8, 2.4, and 2.8 mA, and the maximum current densities at each term were 41.0, 43.6, and 49.9 mW/m 2 , respectively. In the EGP method, starch was also converted into lactic acid with electricity generation. The maximum current density was 140-200 mA/m 2 , and the maximum power density of this method was 12.1 mW/m 2 . Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

Permeability of EVOH Barrier Material Used in Automotive Applications: Metrology Development for Model Fuel Mixtures

Directory of Open Access Journals (Sweden)

Zhao Jing

2015-02-01

Full Text Available EVOH (Ethylene-Vinyl Alcohol materials are widely used in automotive applications in multi-layer fuel lines and tanks owing to their excellent barrier properties to aromatic and aliphatic hydrocarbons. These barrier materials are essential to limit environmental fuel emissions and comply with the challenging requirements of fast changing international regulations. Nevertheless, the measurement of EVOH permeability to model fuel mixtures or to their individual components is particularly difficult due to the complexity of these systems and their very low permeability, which can vary by several orders of magnitude depending on the permeating species and their relative concentrations. This paper describes the development of a new automated permeameter capable of taking up the challenge of measuring minute quantities as low as 1 mg/(m2.day for partial fluxes for model fuel mixtures containing ethanol, i-octane and toluene at 50°C. The permeability results are discussed as a function of the model fuel composition and the importance of EVOH preconditioning is emphasized for accurate permeability measurements. The last part focuses on the influence of EVOH conditioning on its mechanical properties and its microstructure, and further illustrates the specific behavior of EVOH in presence of ethanol oxygenated fuels. The new metrology developed in this work offers a new insight in the permeability properties of a leading barrier material and will help prevent the consequences of (bioethanol addition in fuels on environmental emissions through fuel lines and tanks.

Survey evidence on the willingness of U.S. consumers to pay for automotive fuel economy

International Nuclear Information System (INIS)

Greene, David L.; Evans, David H.; Hiestand, John

2013-01-01

Prospect theory holds that human beings faced with a risky bet will tend to value potential losses about twice as much as potential gains. Previous research has demonstrated that prospect theory could be sufficient to explain an energy paradox in the market for automotive fuel economy. This paper analyzes data from questions added to four commercial, multi-client surveys of 1000 U.S. households each in 2004, 2011, 2012 and 2013. Households were asked about willingness to pay for future fuel savings as well as the annual fuel savings necessary to justify a given upfront payment. Payback periods inferred from household responses are generally consistent over time and across different formulations of questions. Mean calculated payback periods are about 3 years, but there is substantial dispersion among individual responses. The calculated payback periods do not appear to be correlated with the attributes of respondents. Respondents were able to quantitatively describe their uncertainty about both vehicle fuel economy and future fuel prices. Simulation of loss averse behavior based on respondents’ stated uncertainty illustrates how loss aversion could lead consumers to substantially undervalue future fuel savings relative to their expected value. - Highlights: • Payback periods were calculated from stated willingness to pay for fuel savings in 4 US surveys. • US car buyers expect payback in 3 years in order to pay more for increased fuel economy. • Respondents’ payback periods are uncorrelated with their socio-economic attributes. • Survey respondents consider fuel economy ratings and future fuel prices highly uncertain. • The survey results are consistent with the behavioral economic principle of loss aversion

The AGT 101 advanced automotive gas turbine

Science.gov (United States)

Rackley, R. A.; Kidwell, J. R.

1982-01-01

A development program is described whose goal is the accumulation of the technology base needed by the U.S. automotive industry for the production of automotive gas turbine powertrains. Such gas turbine designs must exhibit reduced fuel consumption, a multi-fuel capability, and low exhaust emissions. The AGT101 powertrain described is a 74.6 kW, regenerated single-shaft gas turbine, operating at a maximum inlet temperature of 1644 K and coupled to a split differential gearbox and automatic overdrive transmission. The engine's single stage centrifugal compressor and single stage radial inflow turbine are mounted on a common shaft, and will operate at a maximum rotor speed of 100,000 rpm. All high temperature components, including the turbine rotor, are ceramic.

Dynamic MR-mammography in invasive lobular breast cancer; Dynamische MR-Mammographie beim invasiv lobulaeren Mammakarzinom bei 1,0 T

Energy Technology Data Exchange (ETDEWEB)

Sittek, H.; Perlet, C.; Kessler, M.; Reiser, M. [Institut fuer Radiologische Diagnostik, Klinikum Grossenhadern, Ludwig-Maximilians-Univ., Muenchen (Germany); Untch, M. [Klinik und Poliklinik fuer Frauenheilkunde und Geburtshilfe, Klinikum Grossenhadern, Ludwig-Maximilians-Univ., Muenchen (Germany)

1998-12-31

Material and Methods: We carried out 1505 MR mammographoes in 1357 patients. Biopsy was indicated in 413 cases. Among the malignancies, 23/214 (10%) were ILC. MR-M was performed with a 1.0 T whole body MRI system with a dynamic FLASH-3D sequence. Relative signal enhancement within lesions detected and morphologic pattern of contrast enhancement (mep) were determined. Three types of mep were distinguished: type 1 without contrast enhancement, type 2 with focal contrast enhancement, and type 3 with diffuse contrast enhancement of the glandular body. Results: Within MR-M alone, 19/23 (82.6%) of ILC were detected due to a mep type 2. Four ILC were false negative on MR-M (2 cases show mep type 1 or mep type 3). The sensitivity of Mx alone was 86.9% (20/23). When both Mx and MR-M were combined, all 23 ILC were detected. The addition of MR-M to Mx may increase sensitivity to about 100% in the detection of ILC. (orig.) [Deutsch] Material und Methode: Im Zeitraum 05/1993 bis 06/1996 fuehrten wir bei 1357 Patientinnen 1505 MR-Mammographien durch. In 413 Faellen wurde eine Probeexzision indiziert. Die histologische Untersuchung ergab in 214 Faellen einen malignen Tumor. Darunter befanden sich 23 ILC. Die MR-M wurden an einem 1,0 T MRT-System (Impact, Siemens, Erlangen) mit einer dynamischen FLASH 3D Sequenz durchgefuehrt. Neben dem prozentualen Anstieg der Signalintensitaet innerhalb einer Laesion haben wir fuer die Diagnostik folgende morphologische Befundmuster (BM) unterschieden: Typ 1: Keine Aufnahme, Typ 2: Fokale Aufnahme, Typ 3: Diffuse Aufnahme des Druesenkoerpers in der MR-M. Ergebnisse: Mit der MR-M konnten 19/23 (82,6%) der ILC anhand einer fokalen Zunahme der Signalintensitaet richtig positiv erkannt werden (BM Typ 2). Vier der ILC waren in der MR-M falsch negativ. In zwei Faellen (2/23) war keine Zunahme der Signalintensitaet zu verzeichnen (BM Typ 1). In zwei weiteren Faellen (2/23) maskierte eine diffuse Signalintensitaetszunahme des Druesenkoerpers (BM Typ 3

Exposure to automotive pollution increases plasma susceptibility to oxidation.

Science.gov (United States)

Sharman, James E; Coombes, Jeff S; Geraghty, Dominic P; Fraser, David I

2002-01-01

Low-density lipoprotein oxidation is implicated in the development of atherosclerosis. Plasma susceptibility to oxidation may be used as a marker of low-density lipoprotein oxidation and thus predict atherosclerotic risk. In this study the authors investigated the relationship between plasma susceptibility to oxidation and exposure to automotive pollution in a group of automobile mechanics (n = 16) exposed to high levels of automotive pollution, vs. matched controls (n = 13). The authors induced plasma oxidation by a free radical initiator and they determined susceptibility to oxidation by (1) change in absorbance at 234 nm, (2) lag time to conjugated diene formation, and (3) linear slope of the oxidation curve. Mechanics had significantly higher values (mean +/- standard error) for change in absorbance (1.60 +/- 0.05 vs. 1.36 +/- 0.05; p automotive pollutants increases plasma susceptibility to oxidation and may, in the long-term, increase the risk of developing atherosclerosis.

Shell model description of 16O(p,γ)17F and 16O(p,p)16O reactions

International Nuclear Information System (INIS)

Bennaceur, K.; Michel, N.; Okolowicz, J.; Ploszajczak, M.; Bennaceur, K.; Nowacki, F.; Okolowicz, J.

2000-01-01

We present shell model calculations of both the structure of 17 F and the reactions 16 O(p,γ) 17 F, 16 O(p,p) 16 O. We use the ZBM interaction which provides a fair description of the properties of 16 O and neighbouring nuclei and, in particular it takes account for the complicated correlations in coexisting low-lying states of 16 O. (authors)

Energy management for automotive power nets

NARCIS (Netherlands)

Kessels, J.T.B.A.

2007-01-01

Reducing fuel consumption has always been a major challenge to the automotive industry. Whereas first marketing aspects gave rise to innovative research, today the environmental regulations have become the main driving force behind new technologies. Historically, the research concentrated on

Chemical hydrogen storage material property guidelines for automotive applications

Science.gov (United States)

Semelsberger, Troy A.; Brooks, Kriston P.

2015-04-01

Chemical hydrogen storage is the sought after hydrogen storage media for automotive applications because of the expected low pressure operation (0.05 kg H2/kgsystem), and system volumetric capacities (>0.05 kg H2/Lsystem). Currently, the primary shortcomings of chemical hydrogen storage are regeneration efficiency, fuel cost and fuel phase (i.e., solid or slurry phase). Understanding the required material properties to meet the DOE Technical Targets for Onboard Hydrogen Storage Systems is a critical knowledge gap in the hydrogen storage research community. This study presents a set of fluid-phase chemical hydrogen storage material property guidelines for automotive applications meeting the 2017 DOE technical targets. Viable material properties were determined using a boiler-plate automotive system design. The fluid-phase chemical hydrogen storage media considered in this study were neat liquids, solutions, and non-settling homogeneous slurries. Material properties examined include kinetics, heats of reaction, fuel-cell impurities, gravimetric and volumetric hydrogen storage capacities, and regeneration efficiency. The material properties, although not exhaustive, are an essential first step in identifying viable chemical hydrogen storage material properties-and most important, their implications on system mass, system volume and system performance.

Factors affecting diesel fuel degradation using a bespoke high-pressure fuel system rig

OpenAIRE

Gopalan, Kesavan; Smith, Christopher; Pickering, Simon; Chuck, Christopher; Bannister, Christopher

2018-01-01

Recently, there has been automotive industry-wide impetus to reduce overall diesel vehicle emissions and fuel consumption by increasing fuel injection pressures within common rail systems. Many production fuel injection systems are now capable of delivering rail pressures of 1800-2000 bar with those able to achieve 3000 bar under development. In addition, there has been a gradual increase in the permitted FAME content in EN590 diesel from 5% to 7% with further increases to 10% proposed. With ...

Validating Westinghouse atom 16 x 16 and 18 x 18 PWR fuel performance

International Nuclear Information System (INIS)

Andersson, S.; Gustafson, J.; Jourdain, P.; Lindstroem, L.; Hallstadius, L.; Hofling, C.G.

2001-01-01

Westinghouse Atom designs and fabricates PWR fuel for all major European fuel types: 17 x 17 standard (12 ft) and 17 x 17 XL (14 ft) for Westinghouse type PWRs, and 16 x 16 and 18 x 18 fuel for Siemens type PWRs. The W Atom PWR fuel designs are based on the extensive Westinghouse CE PWR fuel experience from combustion engineering type PWRs. The W atom designs utilise basic design features from the W CE fuel tradition, such as all-Zircaloy mid grids and the proven ( 6 rod years) Guardian TM debris catcher, which is integrated in the bottom Inconel grid. Several new features have been developed to meet with stringent European requirements originating from requirements on very high burnup, in combination with low-leakage core operating strategies and high coolant temperatures. The overall reliability of the Westinghouse Atom PWR fuel is very high; no fuel failure has been detected since 1997. (orig.)

75 FR 12470 - Automotive Fuel Ratings, Certification and Posting

Science.gov (United States)

2010-03-16

.... 17021.\\5\\ Currently, the Rule's definition of ``alternative fuels'' does not specifically include either... benefitting consumers, commenters noted that the Rule benefits businesses. The Petroleum Marketers Association... (FFV). . . . Today . . . some marketers are selling blends like E20, and E30 (20% and 30% ethanol...

Modern materials for automotive industry

Directory of Open Access Journals (Sweden)

Hovorun T. P.

2017-12-01

Full Text Available The car industry uses a tremendous number of materials to build cars, including iron, aluminum, steel, glass, rubber, petroleum products, copper, steel and others. These materials have evolved greatly over the decades, becoming more sophisticated, better built, and safer. They've changed as new automotive manufacturing technologies have emerged over the years, and they're used in increasingly innovative ways. This article is devoted to systematization information on the introduction and application of modern materials in the automotive industry. Given both domestic and foreign sources of information, it follows that car manufacturers are constantly pushing to create the lightest cars possible to increase speed and power. Research and development into lightweight materials is essential for lowering their cost, increasing their ability to be recycled, enabling their integration into vehicles, and maximizing their fuel economy benefits. Light weighting without loss of strength and speed properties is the present, and the future, of the automotive manufacturing industry. It brings innovative materials to the frontline of design.

Life-cycle analysis of energy and greenhouse gas emissions of automotive fuels in India: Part 1 – Tank-to-Wheel analysis

International Nuclear Information System (INIS)

Gupta, S.; Patil, V.; Himabindu, M.; Ravikrishna, R.V.

2016-01-01

As part of a two-part life cycle efficiency and greenhouse gas emission analysis for various automotive fuels in the Indian context, this paper presents the first part, i.e., Tank-to-Wheel analysis of various fuel/powertrain configurations for a subcompact passenger car. The Tank-to-Wheel analysis was applied to 28 fuel/powertrain configurations using fuels such as gasoline, diesel, compressed natural gas, liquefied petroleum gas and hydrogen with various conventional and hybrid electric powertrains. The gasoline-equivalent fuel economy and carbon dioxide emission results for individual fuel/powertrain configuration are evaluated and compared. It is found that the split hybrid configuration is best among hybrids as it leads to fuel economy improvement and carbon dioxide emissions reduction by 20–40% over the Indian drive cycle. Further, the engine efficiency, engine on-off time and regenerative braking energy assessment is done to evaluate the causes for higher energy efficiency of hybrid electric vehicles. The hybridization increases average engine efficiency by 10–60% which includes 19–23% of energy recovered at wheel through regenerative braking over the drive cycle. Overall, the Tank-to-Wheel energy use and efficiency results are evaluated for all fuel/powertrain configurations which show Battery Electric Vehicle, fuel cell vehicles and diesel hybrids are near and long term energy efficient vehicle configurations. - Highlights: • Tank-to-Wheel energy use & CO_2 emissions for subcompact car on Indian driving cycle. • Gasoline, diesel, CNG, LPG, hydrogen and electric vehicles are evaluated in this study. • First comprehensive Tank-to-Wheel analysis for India on small passenger car platform. • Parallel, series and split hybrid electric vehicles with various fuels are analysed.

MR-Guided PTA in Experimental Bilateral Rabbit Renal Artery Stenosis and MR Angiography Follow-Up Versus Histomorphometry

International Nuclear Information System (INIS)

Le Blanche, Alain-Ferdinand; Rossert, Jerome; Wassef, Michel; Levy, Bernard; Bigot, Jean-Michel; Boudghene, Frank

2000-01-01

Purpose: To assess in vivo 1) MR-guided percutaneous transluminal renal angioplasty (PTRA) in experimental bilateral rabbit renal artery stenosis (RAS); 2) postprocedural follow-up by gadolinium-enhanced MR angiography versus histomorphometry.Methods: Fifteen male NZW rabbits of mean weight 4.0 kg (range 3.5-4.2 kg) underwent bilateral RAS induction by combined overdilation-deendothelialization with a gadolinium-filled balloon, passively MR-guided by the artifact of a 0.014-inch guidewire. After 4 weeks the rabbits were randomized into two groups: group A (n = 8) underwent right-sided PTRA for treatment of RAS, group B (n = 7) underwent left-sided PTRA. After another 4 weeks the rabbits were killed to assess by histomorphometry recurrent stenosis and contralateral induction injury stenosis lesions. Each step was preceded by gadolinium-enhanced three-dimensional MR angiography, and the cortex-to-aorta (C/A) signal intensity ratio was calculated.Results: RAS induction was successful in all cases. Fourteen arteries developed restenosis and 13 only initial stenosis. MR-guided PTRAs were feasible in 22 arteries (73%). For a successful catheterization of the ostium (20 arteries, 66% success rate), 10-25 steps were required. Five to eight steps were required for balloon localization and inflation for each PTRA. The restenosis effect was reflected by a 16% (12%-27%) decrease in C/A values on MR angiograms (p < 0.05).Conclusion: MR guidance and MR angiography represent a feasible, less invasive alternative for performing and assessing experimental PTRA in RAS

MR-guided vacuum-assisted breast biopsy of MRI-only lesions: a single center experience

Energy Technology Data Exchange (ETDEWEB)

Spick, Claudio; Schernthaner, Melanie; Pinker, Katja; Kapetas, Panagiotis; Bernathova, Maria; Polanec, Stephan H.; Bickel, Hubert; Wengert, Georg J.; Helbich, Thomas H.; Baltzer, Pascal A. [Medical University of Vienna (AKH), Department of Biomedical Imaging and Image-guided Therapy, Division of Molecular and Gender Imaging, Wien (Austria); Rudas, Margaretha [Medical University of Vienna (AKH), Clinical Institute of Pathology, Wien (Austria)

2016-11-15

The purpose of this study was to compare three different biopsy devices on false-negative and underestimation rates in MR-guided, vacuum-assisted breast biopsy (VABB) of MRI-only lesions. This retrospective, single-center study was IRB-approved. Informed consent was waived. 467 consecutive patients underwent 487 MR-guided VABB using three different 8-10-gauge-VABB devices (Atec-9-gauge,A; Mammotome-8-gauge,M; Vacora-10-gauge,V). VABB data (lesion-type, size, biopsy device, histopathology) were compared to final diagnosis (surgery, n = 210 and follow-up, n = 277). Chi-square, and Kruskal-Wallis tests were applied. P values < 0.05 were considered significant. Final diagnosis was malignant in 104 (21.4 %), high risk in 64 (13.1 %) and benign in 319 (65.5 %) cases. Eleven of 328 (3.4 %) benign-rated lesions were false-negative (1/95, 1.1 %, A; 2/73, 2.7 %, M; 8/160 5.0 % V; P = 0.095). Eleven high-risk (11/77, 14.3 %) lesions proved to be malignant (3/26, 11.5 % A; 4/12, 33.3 % M; 4/39, 10.3 % V; P = 0.228). Five of 34 (14.7 %) DCIS were upgraded to invasive cancer (2/15, 13.3 %, A; 1/6, 16.6 % M; 2/13, 15.3 %, V; P = 0.977). Lesion size (P = 0.05) and type (mass vs. non-mass, P = 0.107) did not differ significantly. MR-guided VABB is an accurate method for diagnosis of MRI-only lesions. No significant differences on false-negative and underestimation rates were observed between three different biopsy devices. (orig.)

Prospects for MEMS in the Automotive Industry

Directory of Open Access Journals (Sweden)

Richard DIXON

2007-12-01

Full Text Available An automotive sector as a growth market for MEMS sensors is analyzed in the article. The automotive sector accounted for $1.6 billion, making this the second biggest opportunity after IT peripherals and inkjet print heads. By 2011 the market will top $2.2 billion, a CAGR of around 7%. The main applications in revenues terms are, in order, pressure sensors, gyroscopes, accelerometers and flow sensors and this will remain so for the foreseeable future. Automotive companies are forced to innovate as a result of competition and price pressures.

31P MR spectroscopic imaging in preoperative embolization therapy of meningiomas; Phosphor-31-MR-spektroskopische Bildgebung bei praeoperativer Embolisationstherapie von Meningeomen

Energy Technology Data Exchange (ETDEWEB)

Blankenhorn, M. [Psychiatrische Universitaetsklinik, Ulm (Germany). Abteilung III; Bachert, P.; Kaick, G. van [Deutsches Krebsforschungszentrum Heidelberg (Germany). Forschungsschwerpunkt Radiologische Diagnostik; Semmler, W. [Freie Univ. Berlin (Germany). Inst. fuer Diagnostikforschung; Ende, G. [Zentralinstitut fuer Seelische Gesundheit, Mannheim (Germany). NMR-Forschung in der Psychiatrie; Tronnier, V. [Neurochirurgische Klinik, Klinikum der Universitaet, Heidelberg (Germany); Sartor, K. [Neurologische Klinik, Klinikum der Universitaet, Heidelberg (Germany). Abt. Neuroradiologie

1999-06-01

Purpose: {sup 31}P MR spectroscopic imaging ({sup 31}P SI) was evaluated in a clinical study as a method for monitoring presurgical devascularization of meningiomas. The aim was to assess noninvasively metabolic alterations in tumor and in healthy brain tissue before and after embolization. Methods: Localized {sup 31}P MR spectra of the brain were obtained by means of 2D-SI (voxel size: 36 cm{sup 3}) using a 1,5-T whole-body MR tomograph. Results: Eleven of 19 patients with intracranial meningiomas examined in this study underwent preoperative embolization therapy; eight patients were examined before and after treatment. After embolization, alterations of pH and of the concentrations of high-energy phosphates (nucleoside-5`triphosphate=NTP, phosphocreatine=PCr), inorganic phosphate (P{sub i}), and membrane constituents were observed in the tumors. A tendency of [P{sub i}] increase and decrease of [NTP], [PCr], and pH predominated, which is explained by ischemic processes after tumor devascularization. Conclusion: {sup 31}P SI is applicable in clinical studies and detects alterations of phosphate metabolism in a meningioma after embolization. (orig.) [Deutsch] Ziel: Die {sup 31}P-MR-spektroskopische Bildgebung ({sup 31}P-SI) wurde im Rahmen der praeoperativen Embolisationstherapie von Patienten mit Meningeomen als Methode zur Therapieverlaufskontrolle klinisch geprueft. Ziel der Studie war die nichtinvasive Erfassung von Veraenderungen im Metabolismus der Tumoren vor und nach Embolisation im Vergleich zum gesunden Hirngewebe. Methoden: Lokalisierte {sup 31}P-MR-Spektren des Gehirns wurden mit 2D-SI (Voxelgroesse: 36 cm{sup 3}) an einem 1,5-T-Ganzkoerper-MR-Tomographen aufgenommen. Ergebnisse: Elf von insgesamt 19 untersuchten Patienten unterzogen sich einer praeoperativen Embolisation, bei acht Patienten konnte eine Verlaufskontrolle durchgefuehrt werden. Nach Embolisation wurden Veraenderungen des pH und der Konzentrationen von energiereichen Phosphaten (Nukleosid

Environmental potential of the alternative automotive fuels biogas, ethanol, methanol, natural gas, rape oil methyl ester, and dimethyl ether

International Nuclear Information System (INIS)

Egebaeck, K.E.; Westerholm, R.

1997-09-01

The aim of the project was to estimate the future emission levels when using alternative fuels, as a contribution to the Committee for Evaluation of Alternative Automotive Fuels (organized by the Swedish Ministry of Environment). The method used for the project was to use the today's knowledge about the emission levels and the emission control technology as a base for the estimation of what additional potential there is to decrease the emissions by coming development of vehicles and the emission control technology. The results of the analysis and the estimations show that there exist a positive development for all types of vehicles and alternative fuels. However, there will be a difference between the different fuel alternatives depending on chemical and physical differences between the different fuels. There will also be a difference in the possibilities of the different fuels to capture a market which will have certain impact on the willingness and the economic possibilities for the car manufacturers to invest in the development needed to reach low emission levels. 124 refs

pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

Directory of Open Access Journals (Sweden)

Sidan Tian

2016-06-01

Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

Occupational skin diseases in automotive industry workers.

Science.gov (United States)

Yakut, Yunus; Uçmak, Derya; Akkurt, Zeynep Meltem; Akdeniz, Sedat; Palanci, Yilmaz; Sula, Bilal

2014-03-01

Studies on occupational skin diseases in workers of the automotive industry are few. To investigate the prevalence of occupational skin diseases in workers of the automotive industry. Between September and December 2011, a total of 405 workers from the automotive repair industry in Diyarbakır were interviewed. They were active workers in the repair industry who had been employed for at least six months. Business owners, sellers of spare parts and accounting officers were not included. The employees were examined at their workplaces and the working conditions were observed. Detailed dermatological examination was performed. The mean age of the 405 workers who participated in the study was 27.7 ± 10.3. The mean working time of employees was 13.3 ± 10.4 years. All of the employees were male. Dermatological diseases were not detected in 144 out of 405 workers (35.6%) and at least one condition was diagnosed in 261 (64.4%). The most frequent diagnosis was callus, hyperkeratosis, clavus (27.7%), followed by nail changes (16.8%) and superficial mycoses (12.1%). Contact dermatitis was seen at a rate of 5.9%. Traumatic lesions such as hyperkeratotic lesions and nail changes were found most frequently. Traumatic lesions were common among individuals who did not use gloves. Most nail changes were localized leuconychia, a finding not reported in the studies on automotive industry workers. In accordance with the literature, irritant contact dermatitis was observed in patients with a history of atopy and who had been working for a long time. Occupational skin diseases comprise an important field in dermatology, deserving much attention. Further studies on occupational dermatology are necessary.

{sup 31}P-MR-spectroscopy of the skeletal muscles under load: demonstration of normal energy metabolism compared to different neuromuscular diseases; {sup 31}P-MR-Spektroskopie der peripheren Skelettmuskulatur unter Belastung: Darstellung des normalen Energiestoffwechsels im Vergleich zu metabolischen Muskelerkrankungen

Energy Technology Data Exchange (ETDEWEB)

Block, W.; Traeber, F.; Kuhl, C.K.; Keller, E.; Rink, H.; Schild, H.H. [Bonn Univ. (Germany). Radiologische Klinik; Lamerichs, R. [Philips Medical Systems, Best (Netherlands); Karitzky, J. [Bonn Univ. (Germany). Neurologische Klinik

1998-03-01

Purpose: {sup 31}P-MR spectroscopy of skeletal muscle under ecercise was used to obtain the range of normal variation and comparison was made for different neuromascular diseases. Methods: 41 examinations of 24 volunteers and 41 investigations in 35 patients were performed on 1.5 T MR systems (Gyroscan S15 und S15/ACSII, Philips). Localised {sup 31}P-MR spectra of the calf muscle were obtained in time series with a resolution of 12 s. Results: Two types of muscle energy metabolism were identified from the pattern of spectroscopic time course in volunteers: While the first group was characterised by a remarkable decline to lower pH values during exercise, the second group showed only small pH shifts (minimum pH: 6.48{+-}0.13 vs 6.87{+-}0.07, p<10{sup -6}) although comparable workload conditions were maintained. The pH-values correlated well with blood lactate analysis. Patients with metabolic disorders and chronic fatigue syndrome (CFS) showed decreased resting values of PCr/(PCr+P{sub i}) and increased pH levels during exercise. PCr recovery was significantly delayed (0.31 vs 0.65 min{sup -1}, p<0.00005) in metabolic muscle disorders but was normal in CFS patients. Conclusion: Findings in volunteers indicate utilisation of different metabolic pathways which seems to be related to the fibre type composition of muscle. Reduced resting levels for PCr/(PCr+P{sub i}), altered pH time courses, and decreased PCr recovery seem to be helpful indicators for diagnosis of metabolic muscle disorders. (orig./MG) [Deutsch] Ziel: Bestimmung der Bandbreite des gesunden Energiestoffwechsels der peripheren Skelettmuskulatur mit Hilfe der {sup 31}P-MR-Spektroskopie als Grundlage der Diagnostik neuromuskulaerer Erkrankungen. Methoden: In Mehrfachuntersuchungen an 24 Probanden und 35 Patienten in 1,5 T MR-Systemen (Gyroscan S15 und S15/ACSII, Philips) wurden {sup 31}P-MR-Spektren unter Belastung akquiriert. Ergebnisse: Die Probanden liessen sich streng in zwei Gruppen einteilen

Treament Response in the neck: p16+ versus p16- oropharyngeal cancer

International Nuclear Information System (INIS)

Mak, Daisy; Hicks, Rodney J.; Rischin, Danny; Solomon, Ben; Peters, Lester; Corry, June; Bressel, Mathias; Young, Richard J.

2013-01-01

To compare nodal response rates following chemoradiotherapy in patients with p16+ and p16− oropharyngeal squamous cell carcinoma (OPSCC). Patients with node-positive OPSCC treated at Peter MacCallum Cancer Centre on the published phase I–III tirapazamine trials were identified. All patients had conventional assessment (clinical examination (CA), CT and/or MRI) and positron emission tomography (PET) at both baseline and 2–4 months post-treatment. There were 30 p16+ and 18 p16− patients, the former group having significantly higher stage nodal disease (P=0.016). The mean overall reduction in nodal size at post-treatment assessment was similar in p16+ and p16− patients (78% vs. 75%), and no statistically significant difference in nodal complete response (CR) rates was detected by either CA (50% vs. 39%, P=0.35) or PET/PET-CT (93% vs. 83%, P=0.19). PET was significantly more accurate in determining the true nodal CR rate in both groups, with a negative predictive value of 96%. Nodal response rates following chemoradiotherapy appear to be similar in p16+ and p16− patients when assessed by either CA or PET/PET-CT. However, higher nodal CR was seen in PET/PET-CT compared with CA in both groups. Metabolic imaging is more accurate than CA in assessing nodal response post-treatment.

31P-MR spectroscopy of the brain in patients with anorexia nervosa: characteristic differences in the spectra between patients and healthy control subjects

International Nuclear Information System (INIS)

Rzanny, R.; Reichenbach, J.R.; Mentzel, H.J.; Pfleiderer, S.O.R.; Kaiser, W.A.; Freesmeyer, D.; Klemm, S.; Gerhard, U.J.; Blanz, B.

2003-01-01

Purpose: To investigate whether 31 P-MR spectroscopy can detect reduced concentrations of high-energy phosphates, like PCr and NTP, caused by decreased metabolic activity in the brain of patients with anorexia nervosa (AN) and, furthermore, whether any impairment of the cerebral membrane metabolism can be derived from the spectra. Material and Methods: 10 female patients, age range 12 - 20 years and mean BMI (body mass index) of 14.8 ± 1.6 kg/m 2 , with clinically diagnosed AN (ICD-10, F50.0) and 10 healthy control subjects, age range 12 - 21 years and mean BMI 19.0 ± 2.1 kg/m 2 , without nutritional disturbances: were investigated. 31 P-MR spectroscopy was performed with a 1.5 T MRI unit using single volume selection in the frontal/prefrontal region of brain. Relative metabolic concentrations were quantified by normalizing the peak areas of the metabolites with the total area of the complete phosphorous spectrum, P tot , as well as with the peak area of β;-NTP. Results: Significant differences between the two groups were observed for the metabolic ratios PDE/P tot , PDE/β;-NTP and α-NTP/P tot which were lower in the patient group except for α-NTP/P tot . These ratios also revealed a statistically significant correlation with the BMI (r PDE/Ptot = 0.747, r PDE/β;-NTP = 0.57, r α-NTP/Ptot = -0.56; p ≤ 0.1). Reduced relative concentrations of PCr/P tot , β;-NTP/P tot or Pi/P tot were not encountered. Conclusion: The lowered PDE/P tot ratio for patients with AN and its correlation with BMI suggests that decreased BMI induces compositional changes of the phospholipids in the brain, which decrease the fraction of mobile phospholipids. (orig.) [de

Lightweighting Automotive Materials for Increased Fuel Efficiency and Delivering Advanced Modeling and Simulation Capabilities to U.S. Manufacturers

Energy Technology Data Exchange (ETDEWEB)

Hale, Steve

2013-09-11

Abstract The National Center for Manufacturing Sciences (NCMS) worked with the U.S. Department of Energy (DOE), National Energy Technology Laboratory (NETL), to bring together research and development (R&D) collaborations to develop and accelerate the knowledgebase and infrastructure for lightweighting materials and manufacturing processes for their use in structural and applications in the automotive sector. The purpose/importance of this DOE program: • 2016 CAFÉ standards. • Automotive industry technology that shall adopt the insertion of lightweighting material concepts towards manufacturing of production vehicles. • Development and manufacture of advanced research tools for modeling and simulation (M&S) applications to reduce manufacturing and material costs. • U.S. competitiveness that will help drive the development and manufacture of the next generation of materials. NCMS established a focused portfolio of applied R&D projects utilizing lightweighting materials for manufacture into automotive structures and components. Areas that were targeted in this program: • Functionality of new lightweighting materials to meet present safety requirements. • Manufacturability using new lightweighting materials. • Cost reduction for the development and use of new lightweighting materials. The automotive industry’s future continuously evolves through innovation, and lightweight materials are key in achieving a new era of lighter, more efficient vehicles. Lightweight materials are among the technical advances needed to achieve fuel/energy efficiency and reduce carbon dioxide (CO2) emissions: • Establish design criteria methodology to identify the best materials for lightweighting. • Employ state-of-the-art design tools for optimum material development for their specific applications. • Match new manufacturing technology to production volume. • Address new process variability with new production-ready processes.

Integrative analysis of cardiac function and metabolism in patients with idiopathic hypertrophic cardiomyopathy with H-1 cine MR imaging and P-31 MR spectroscopy

International Nuclear Information System (INIS)

Wagner, S.; Chew, W.M.; Semelka, R.; Tomei, E.; Caputo, G.; O'Sullivan, M.; Chatterjee, K.; Parmley, W.W.; Wolfe, C.L.; Higgins, C.B.

1989-01-01

The purpose of the study was to use MR imaging and P-31 spectroscopy for the functional and metabolic characterization of patients with hypertrophic cardiomyopathy (HCM). Nine patients with HCM underwent combined P-31 spectroscopy (one-dimensional chemical shift imaging) and MR imaging at 1.5 T. MR imaging localized the distribution of ventricular hypertrophy and cine MR imaging quantitated cardiac volumes, contractility, and left ventricular mass. The phosphodiester/phosphocreatine ratio (PDE/PCr) in six HCM patients was not different from normal, but in three patients it was significantly (P <.01) higher. This finding could not be attributed to contractible abnormalities, the distribution of hypertrophy, or the left ventricular mass. The abnormal PDE/PCr ratio was found only in patients with echocardiographic findings of resting left ventricular outflow obstruction but was not associated with severity or distribution of hypertrophy. The study shows the use of combined MR imaging and MR spectroscopy to characterize HCM and possibly to identify abnormal myocardial tissue

A Low Cost Ferritic Stainless Steel Microalloyed by Higher Nb for Automotive Exhaust System

Science.gov (United States)

Chen, Erhu; Wang, Xuelin; Shang, Chengjia

Automotive engine exhaust gas after combustion of fuel, and the gas will be liquefied in the rear of automotive exhaust system. A lot of corrosive anions existing in the condensate make corrosion of the exhaust system materials. Therefore, once pitting perforation, automotive exhaust system will fail directly. In 1980s, automotive exhaust manifold was made of Si-Mo ductile iron, mufflers and the tail pipe were made of carbon steel or aluminized steel. But with higher emission standards carried out, the improvement of engine performance and the higher exhaust temperature as well as the needs of the automotive light-weighting, we need the higher corrosion resistance of the material for automotive exhaust systems to meet the requirements.

Feasibility Study on Nitrogen-15 Enrichment and Recycling System for Innovative FR Cycle System With Nitride Fuel

International Nuclear Information System (INIS)

Masaki Inoue; Kiyoshi Ono; Tsuna-aki Fujioka; Koji Sato; Takeo Asaga

2002-01-01

Highly-isotopically-enriched nitrogen (HE-N 2 ; 15 N abundance 99.9%) is indispensable for a nitride fueled fast reactor (FR) cycle to minimize the effect of carbon-14 ( 14 C) generated mainly by 14 N(n,p) 14 C reaction in the core on environmental burden. Thus, the development of inexpensive 15 N enrichment and recycling technology is one of the key aspects for the commercialization of a nitride fueled FR cycle. Nitrogen isotope separation by the gas adsorption technique was experimentally confirmed in order to obtain its technological perspective. A conventional pressure swing adsorption technique, which is already commercialized for recovering the nitrogen gas from multi-composition gas-mixture, would be suitable for recovering in both reprocessing and fuel fabrication to recycle the HE-N 2 gas. A couple of the nitride fuel cycle system concepts including the reprocessing and fuel fabrication process flow diagrams with the HE-N 2 gas recycling were newly designed for both aqueous and non-aqueous (pyrochemical) nitride fuel recycle plants, and also the effect of the HE-N 2 gas recycling on the economics of each concept was evaluated. (authors)

Petroleum Diesel Fuel and Linseed Oil Mixtures as Engine Fuels

Science.gov (United States)

Markov, V. A.; Kamaltdinov, V. G.; Savastenko, A. A.

2018-01-01

The actual problem is the use of alternative biofuels in automotive diesel engines. Insufficiently studied are the indicators of toxicity of exhaust gases of these engines operating on biofuel. The aim of the study is to identify indicators of the toxicity of exhaust gases when using of petroleum diesel fuel and linseed oil mixtures as a fuel for automotive diesel engines. Physical and chemical properties of linseed oil and its mixtures with petroleum diesel fuel are considered. Experimental researches of D-245.12C diesel are carried out on mixtures of diesel fuel and corn oil with a different composition. An opportunity of exhaust toxicity indexes improvement using these mixtures as a fuel for automobiles engine is shown.

Correlation between intravoxel incoherent motion MR parameters and MR nodular grade of parotid glands in patients with Sjögren’s syndrome: A pilot study

International Nuclear Information System (INIS)

Chu, Chen; Zhou, Nan; Zhang, Huayong; Dou, Xin; Li, Ming; Liu, Song; Zhu, Yun; Chen, Weibo; Chan, Queenie; He, Jian; Sun, Lingyun; Zhou, Zhengyang

2017-01-01

Highlights: • Parotid glands at grade 0–3 had significant values from those in healthy glands. • Parotid D and f values were correlated with MR nodule grade significantly. • There were significant differences of D, f, and D * values among glands at grade 0–3. - Abstract: Purpose: To explore the correlation between intravoxel incoherent motion (IVIM) magnetic resonance (MR) parameters and MR nodular grade of parotid glands in patients with Sjögren’s syndrome (SS). Materials and methods: A total of 31 consecutive patients with SS and 28 gender- and age-matched healthy volunteers underwent bilateral parotid 3.0T MR examination including the IVIM sequence (9 b values, 0–800 s/mm 2 ). The apparent diffusion coefficient (ADC), diffusion coefficient D, pseudo-diffusion coefficient D * , and perfusion fraction f of bilateral parotid glands were obtained, and the nodular grade of each parotid gland was evaluated according to the MR morphological appearance. Results: Sixty-two parotid glands in 31 patients with SS consisted of 32, 14, 8, and 8 parotid glands at MR nodular grades 0, 1, 2, and 3, respectively. In parotid glands of grade 0, 1, 2, 3 and healthy volunteers, the ADC values were (1.13 ± 0.25, 1.11 ± 0.17, 1.05 ± 0.24, 0.89 ± 0.04 and 1.00 ± 0.21) × 10 −3 mm 2 /s, D values were (0.92 ± 0.13, 0.90 ± 0.19, 0.90 ± 0.03, 0.67 ± 0.03, 0.81 ± 0.03) × 10 −3 mm 2 /s, f values were 0.20 ± 0.04, 0.18 ± 0.02, 0.15 ± 0.01, 0.11 ± 0.01, 0.15 ± 0.06, and D * values were (53.89 ± 28.26, 41.78 ± 16.35, 51.24 ± 18.69, 31.83 ± 18.03, 36.83 ± 16.14) × 10 −3 mm 2 /s respectively. The ADC, D, f, and D * values of parotid glands in patients with SS at grade 0 were significantly higher than those in healthy volunteers (all P < 0.05). Significant differences were observed in the D and f values of parotid glands in patients with SS among different grades (P = 0.003, < 0.001, respectively). The IVIM parameters (D, f) of parotid glands at early

Correlation between intravoxel incoherent motion MR parameters and MR nodular grade of parotid glands in patients with Sjögren’s syndrome: A pilot study

Energy Technology Data Exchange (ETDEWEB)

Chu, Chen, E-mail: chuchen19920905@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhou, Nan, E-mail: snscorpion@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhang, Huayong, E-mail: 13770560567@163.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Dou, Xin, E-mail: douxin125@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Li, Ming, E-mail: lm069393@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Liu, Song, E-mail: liusongnj@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhu, Yun, E-mail: qqt111@hotmail.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Chen, Weibo, E-mail: Weibo.Chen@philips.com [Philips Healthcare, Shanghai, 200233 (China); Chan, Queenie, E-mail: queenie.chan@philips.com [Philips Healthcare, Hong Kong (China); He, Jian, E-mail: hjxueren@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Sun, Lingyun, E-mail: lysun_nju@163.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhou, Zhengyang, E-mail: zyzhou@nju.edu.cn [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China)

2017-01-15

Highlights: • Parotid glands at grade 0–3 had significant values from those in healthy glands. • Parotid D and f values were correlated with MR nodule grade significantly. • There were significant differences of D, f, and D{sup *} values among glands at grade 0–3. - Abstract: Purpose: To explore the correlation between intravoxel incoherent motion (IVIM) magnetic resonance (MR) parameters and MR nodular grade of parotid glands in patients with Sjögren’s syndrome (SS). Materials and methods: A total of 31 consecutive patients with SS and 28 gender- and age-matched healthy volunteers underwent bilateral parotid 3.0T MR examination including the IVIM sequence (9 b values, 0–800 s/mm{sup 2}). The apparent diffusion coefficient (ADC), diffusion coefficient D, pseudo-diffusion coefficient D{sup *}, and perfusion fraction f of bilateral parotid glands were obtained, and the nodular grade of each parotid gland was evaluated according to the MR morphological appearance. Results: Sixty-two parotid glands in 31 patients with SS consisted of 32, 14, 8, and 8 parotid glands at MR nodular grades 0, 1, 2, and 3, respectively. In parotid glands of grade 0, 1, 2, 3 and healthy volunteers, the ADC values were (1.13 ± 0.25, 1.11 ± 0.17, 1.05 ± 0.24, 0.89 ± 0.04 and 1.00 ± 0.21) × 10{sup −3} mm{sup 2}/s, D values were (0.92 ± 0.13, 0.90 ± 0.19, 0.90 ± 0.03, 0.67 ± 0.03, 0.81 ± 0.03) × 10{sup −3} mm{sup 2}/s, f values were 0.20 ± 0.04, 0.18 ± 0.02, 0.15 ± 0.01, 0.11 ± 0.01, 0.15 ± 0.06, and D{sup *}values were (53.89 ± 28.26, 41.78 ± 16.35, 51.24 ± 18.69, 31.83 ± 18.03, 36.83 ± 16.14) × 10{sup −3} mm{sup 2}/s respectively. The ADC, D, f, and D{sup *} values of parotid glands in patients with SS at grade 0 were significantly higher than those in healthy volunteers (all P < 0.05). Significant differences were observed in the D and f values of parotid glands in patients with SS among different grades (P = 0.003, < 0.001, respectively). The IVIM

Environmental Innovation Dynamics in the Automotive industry

NARCIS (Netherlands)

Kuik, O

2006-01-01

This paper addresses the innovation dynamics induced by environmental policy in the automotive industry. It examines car fuel efficiency programs in the EU, the US and Japan. It concludes that existing programs have not yet succeeded in promoting radical and breakthrough technologies, but that, at

MR imaging of acute transverse myelitis (myelopathy)

Energy Technology Data Exchange (ETDEWEB)

Isoda, Haruo [Hamamatsu Univ., Shizuoka (Japan). School of Medicine; Ramsey, R.G.

1998-05-01

The purpose of our study was to review the MR characteristics of acute transverse myelitis (ATM) retrospectively and to review the literature. The subjects were 26 patients (two males, 24 females). MR examinations were carried out using a 1.5 Tesla scanner. MR imaging in eight of 16 lesions in nine subjects with preexisting MS showed multiple areas of increased signal intensity on T{sub 2}-weighted sagittal images, and 11 lesions had no cord swelling. Twelve of 16 lesions showed heterogeneous enhancement. MR imaging in 10 of 13 lesions in 12 subjects with preexisting HTLV-1 infection, mycoplasma pneumonia infection, hepatitis B vaccinations, and uncertain etiologies revealed fusiform increased signal intensity areas on T{sub 2}-weighted sagittal images and cord swelling. Seven of 11 lesions in the patients who underwent injection of contrast medium showed heterogeneous enhancement, whereas others showed no enhancement. MR examination is recommended for the evaluation of ATM. (author)

Natural gas as an automotive fuel

Energy Technology Data Exchange (ETDEWEB)

Gritsenko, A I; Vasiliev, Y N; Jankiewicz, A [VPO ' Soyuzgastekhnologiya' All-Union Scientific Research Inst. of Natural gases (VNIIGAS) (SU)

1990-02-01

The review presented covers mass production of gas-petrol and gas-diesel automobiles in the USSR, second generation auto gas filling compressor stations, principal exhaust toxicants, and tests indicating natural gas fired autos emit >5 times less NO{sub x} and 10 times less hydrocarbons excluding methane. The switch over to gas as auto fuel and ensuing release of petrol and diesel for other uses are discussed. (UK).

Percutaneous MR-guided focal cryoablation for recurrent prostate cancer following radiation therapy. Retrospective analysis of iceball margins and outcomes

Energy Technology Data Exchange (ETDEWEB)

Overduin, Christiaan G.; Jenniskens, Sjoerd F.M.; Bomers, Joyce G.R. [Radboud University Medical Center, Department of Radiology and Nuclear Medicine, Nijmegen (Netherlands); Sedelaar, J.P.M. [Radboud University Medical Center, Department of Urology, Nijmegen (Netherlands); Fuetterer, Jurgen J. [Radboud University Medical Center, Department of Radiology and Nuclear Medicine, Nijmegen (Netherlands); University of Twente, MIRA Institute for Biomedical Engineering and Technical Medicine, Enschede (Netherlands)

2017-11-15

To evaluate iceball margins after magnetic resonance (MR)-guided focal salvage prostate cryoablation and determine the correlation with local outcome. A retrospective review was performed on 47 patients that underwent percutaneous MR-guided focal cryoablation for biopsy-proven locally recurrent prostate cancer after primary radiotherapy. Preprocedural diagnostic and intraprocedural MR images were analysed to derive three-directional iceball margins. Local tumour progression after cryoablation was defined as evident tumour recurrence on follow-up MRI, positive MR-guided biopsy or biochemical failure without radiological evidence of metastatic disease. Mean iceball margins were 8.9 mm (range -7.1 to 16.2), 10.1 mm (range 1.1-20.3) and 12.5 mm (range -1.5 to 22.2) in anteroposterior, left-right and craniocaudal direction respectively. Iceball margins were significantly smaller for tumours that were larger (P =.008) or located in the posterior gland (P =.047). Significantly improved local progression-free survival at 1 year post focal cryoablation was seen between patients with iceball margin >10 mm (100%), 5-10 mm (84%) and <5 mm (15%) (P <.001). Iceball margins appear to correlate with local outcome following MR-guided focal salvage prostate cryoablation. Our initial data suggest that freezing should be applied at minimum 5 mm beyond the border of an MR-visible recurrent prostate tumour for successful ablation, with a wider margin appearing desirable. (orig.)

General Mechanical Repair. Minor Automotive Maintenance, Small Engine [Repair, and] Welding: Student Manual.

Science.gov (United States)

Hamlin, Larry

This document is a student manual for a general mechanical repair course. Following a list of common essential elements of trade and industrial education, the manual is divided into three sections. The first section, on minor automotive maintenance, contains 13 units: automotive shop safety; engine principles; fuel system operation and repair;…

Towards Highly Performing and Stable PtNi Catalysts in Polymer Electrolyte Fuel Cells for Automotive Application

Directory of Open Access Journals (Sweden)

Sabrina C. Zignani

2017-03-01

Full Text Available In order to help the introduction on the automotive market of polymer electrolyte fuel cells (PEFCs, it is mandatory to develop highly performing and stable catalysts. The main objective of this work is to investigate PtNi/C catalysts in a PEFC under low relative humidity and pressure conditions, more representative of automotive applications. Carbon supported PtNi nanoparticles were prepared by reduction of metal precursors with formic acid and successive thermal and leaching treatments. The effect of the chemical composition, structure and surface characteristics of the synthesized samples on their electrochemical behavior was investigated. The catalyst characterized by a larger Pt content (Pt3Ni2/C presented the highest catalytic activity (lower potential losses in the activation region among the synthesized bimetallic PtNi catalysts and the commercial Pt/C, used as the reference material, after testing at high temperature (95 °C and low humidification (50% conditions for automotive applications, showing a cell potential (ohmic drop-free of 0.82 V at 500 mA·cm−2. In order to assess the electro-catalysts stability, accelerated degradation tests were carried out by cycling the cell potential between 0.6 V and 1.2 V. By comparing the electrochemical and physico-chemical parameters at the beginning of life (BoL and end of life (EoL, it was demonstrated that the Pt1Ni1/C catalyst was the most stable among the catalyst series, with only a 2% loss of voltage at 200 mA·cm−2 and 12.5% at 950 mA·cm−2. However, further improvements are needed to produce durable catalysts.

Optimization and optimal control in automotive systems

CERN Document Server

Kolmanovsky, Ilya; Steinbuch, Maarten; Re, Luigi

2014-01-01

This book demonstrates the use of the optimization techniques that are becoming essential to meet the increasing stringency and variety of requirements for automotive systems. It shows the reader how to move away from earlier  approaches, based on some degree of heuristics, to the use of  more and more common systematic methods. Even systematic methods can be developed and applied in a large number of forms so the text collects contributions from across the theory, methods and real-world automotive applications of optimization. Greater fuel economy, significant reductions in permissible emissions, new drivability requirements and the generally increasing complexity of automotive systems are among the criteria that the contributing authors set themselves to meet. In many cases multiple and often conflicting requirements give rise to multi-objective constrained optimization problems which are also considered. Some of these problems fall into the domain of the traditional multi-disciplinary optimization applie...

Fuel reprocessing and environmental problem

International Nuclear Information System (INIS)

Ichikawa, Ryushi

1977-01-01

The radioactive nuclides which are released from the reprocessing plants of nuclear fuel are 137 Cs, 106 Ru, 95 Zr and 3 H in waste water and 85 Kr in the atmosphere. This release affects the environment for example, the reprocessing plant of the Nuclear Fuel Service Co in the USA releases about 2 x 10 5 Ci/y of 85 Kr, which is evaluated as about 0.025 mr/y as external exposure dose. The radioactivity in milk around this plant was measured as less than 10 pCi/lit of 129sup(I. The radioactive concentration in the sea, especially in fish and shellfish, was measured near the reprocessing plant of Windscale in UK. The radioactive release rate from this plants more than 10)5sup( Ci/y as the total amount of )137sup(Cs, )3sup(H, )106sup(Ru, )95sup(Zr, )95sup(Nb, )90sup(Sr, )144sup(Ce, etc., and the radioactivity in seaweeds near Windscale is about 400 pCi/g as the maximum value, and the mayonnaise which was made of this seaweeds contained about 1 pCi/g of )106sup(Ru, which is estimated as about 7 mr/y for the digestive organ if 100 g is eaten every day. On the other hand, the experimental result is presented for the reprocessing plant of La Hague in France, in which the radioactive release rate from this plant is about 10)4sup( Ci/y, and the radioactivity in sea water and shellfish is about 4 pCi/l of )106sup(Ru and about 400 pCi/kg of )137 Cs, respectively, near this plant. The philosophy of ALAP (as low as practicable) is also applied to reprocessing plants. (Nakai, Y.)

First qualitative analysis of fuel irradiation results carried out in the MR reactor on WWER-1000 fuel

Energy Technology Data Exchange (ETDEWEB)

Chantoin, P [International Atomic Energy Agency, Vienna (Austria); Dubrovin, K; Platonov, P [Russian Research Centre Kurchatov Inst., Moscow (Russian Federation); Onufriev, V [Vsesoyuznyj Nauchno-Issledovatel` skij Inst. Neorganicheskikh Materialov, Moscow (Russian Federation)

1994-12-31

Four experiments carried out in the MR reactor are evaluated. They are aimed to assess the influence of burnup and the size of the pellet central hole on the fuel temperature and thus on the fuel swelling and fission gas release. The experiments have been performed at different linear rate and burnup of the fuel rods which are above the actual licensed values in WWER power stations. In this paper the results on WWER fuel rod behaviour are examined. The main fabrication and irradiation characteristics for each experiment are given. The main results from destructive and non-destructive examinations are summarized. They include: burnup determination by gamma spectroscopy, caesium shifting along fuel column and accumulation at the end of the fuel stack, fission gas release. fuel rod diameter and length change and macro-graphs showing the central hole size and the morphology after irradiation. From observation of fuel structure, Cs spectrometry and fission gas release, a large degradation of fuel thermal conductivity can be identified at high burnup. If the fuel burnup is the right parameter to be considered, burnup limits identified are: 0 70-75 MWd/kg for rods with large central hole; (2) 58-64 MWd/kg for rods with small central hole. As a general conclusion it is stressed the importance of the study due to irradiation beyond the usual linear rates at high burnup. Up to now the fuel life limiting factor was cladding corrosion when using Zircaloy-4. As the cladding corrosion situation improves, the next life limiting factor to be met could be the fuel itself. The decreasing fuel thermal conductivity is probably of prime importance and should be further studied and modelled. 5 tabs., 5 figs., 3 refs.

Fuel management of HTR-10

International Nuclear Information System (INIS)

Wu Zongxin; Jing Xingqing

2001-01-01

The 10 MW high temperature cooled reactor (HTR-10) built in Tsinghua University is a pebble bed type of HTGR. The continuous recharge and multiple-pass of spherical fuel elements are used for fuel management. The initiative stage of core is composed of the mix of spherical fuel elements and graphite elements. The equilibrium stage of core is composed of identical spherical fuel elements. The fuel management during the transition from the initiative stage to the equilibrium stage is a key issue for HTR-10 physical design. A fuel management strategy is proposed based on self-adjustment of core reactivity. The neutron physical code is used to simulate the process of fuel management. The results show that the graphite elements, the recharging fuel elements below the burn-up allowance, and the discharging fuel elements over the burn-up allowance could be identified by burn-up measurement. The maximum of burn-up fuel elements could be controlled below the burn-up limit

Ionomer equivalent weight structuring in the cathode catalyst layer of automotive fuel cells: Effect on performance, current density distribution and electrochemical impedance spectra

Science.gov (United States)

Herden, Susanne; Hirschfeld, Julian A.; Lohri, Cyrill; Perchthaler, Markus; Haase, Stefan

2017-10-01

To improve the performance of proton exchange membrane fuel cells, membrane electrode assemblies (MEAs) with segmented cathode electrodes have been manufactured. Electrodes with a higher and lower ionomer equivalent weight (EW) were used and analyzed using current density and temperature distribution, polarization curve, temperature sweep and electrochemical impedance spectroscopy measurements. These were performed using automotive metallic bipolar plates and operating conditions. Measurement data were used to manufacture an optimized segmented cathode electrode. We were able to show that our results are transferable from a small scale hardware to automotive application and that an ionomer EW segmentation of the cathode leads to performance improvement in a broad spectrum of operating conditions. Furthermore, we confirmed our results by using in-situ electrochemical impedance spectroscopy.

75 FR 39680 - Houston Pipe Line Company LP, Worsham-Steed Gas Storage, L.P., Energy Transfer Fuel, LP, Mid...

Science.gov (United States)

2010-07-12

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR10-44-000; Docket No. PR10-46-000; Docket No. PR10-48- 000; Docket No. PR10-49-000; Docket No. PR10-50-000] Houston Pipe Line Company LP, Worsham-Steed Gas Storage, L.P., Energy Transfer Fuel, LP, Mid Continent Market Center, L.L.C...

Rheo-processing of semi-solid metal alloys: a new technology for manufacturing automotive and aerospace components

CSIR Research Space (South Africa)

Ivanchev, L

2008-01-01

Full Text Available The latest trend in the automotive industry to produce fuel-efficient vehicles has resulted in the increased use of aluminium and magnesium alloys. Liquid metal high pressure die-casting (HPDC) currently satisfies the bulk of the automotive industry...

Subthreshold pion production of 20-100 MeV energy with various projectiles (p, 3He, 12C, 16O)

International Nuclear Information System (INIS)

Sanouillet, G.; Bolore, M.; Charlot, X.

1986-05-01

The described experiments refer to pion production below and near the threshold with different projectiles (p, 3 He, 12 C, 16 O). The pion detection device was a range telescope. Experimental methods are presented and discussed. Data are compared to predictions of some models [fr

Bladder carcinoma. Apport MR imaging

International Nuclear Information System (INIS)

Roy, C.; Spittler, G.; Jacqmin, D.; Morel, M.

1991-01-01

Bladder carcinoma is the second most commun cause of urogenital tumor. It is suspected by abdominal ultrasound and prouved by cystoscopy with biopsy. At present, MR Imaging is the most accurate diagnostic modality for loco-regional staging. Urography is still useful to appreciate urinary tract [fr

Ethanol extract of Lycoris radiata induces cell death in B16F10 melanoma via p38-mediated AP-1 activation.

Science.gov (United States)

Son, Minsik; Kim, Aeyung; Lee, Jaewoo; Park, Chul-Hong; Heo, Jin-Chul; Lee, Hyun-Jin; Lee, Sang-Han

2010-08-01

Some active alkaloids isolated from Lycoris, a bulbous perennial herb, was shown to possess various anti-tumor and anti-inflammatory activities. In this study, we evaluated the in vitro apoptotic effect of ethanol extract from Lycoris radiata (LRE) and further probed the underlying molecular mechanisms of LRE effects. The survival rate of B16F10 melanoma cells exposed to LRE was decreased in a dose-dependent manner, cell growth was retarded by arresting cell cycle at G1 phase and apoptotic appearance such as caspase-3 activation as well as DNA fragmentation was observed by LRE treatment. In addition, LRE induced p38 and c-Jun phosphorylation, followed by activation of transcription factor AP-1. Pretreatment with the p38 inhibitor (SB203580) blocked LRE-induced AP-1 transcriptional activity, and curcumin, AP-1 inhibitor, dramatically inhibited LRE-induced apoptosis in B16F10 melanoma cells. Our results collectively indicate that LRE-mediated apoptosis occurs through the activation of p38 and AP-1 pathway and potentially LRE exhibits anti-cancer activity against B16F10 melanoma cells.

Fuel fabrication and reprocessing for nuclear fuel cycle with inherent safety demands

Energy Technology Data Exchange (ETDEWEB)

Shadrin, Andrey Yurevich; Dvoeglazov, Konstantin Nikolaevich; Ivanov, Valentine Borisovich; Volk, Vladimir Ivanovich; Skupov, Mikhail Vladimirovich; Glushenkov, Alexey Evgenevich [Joint Stock Company ' ' The High Technological Research Institute of Inorganic Materials' ' , Moscow (Russian Federation); Troyanov, Vladimir Mihaylovich; Zherebtsov, Alexander Anatolievich [Innovation and Technology Center of Project ' ' PRORYV' ' , State Atomic Energy Corporation ' ' Rosatom' ' , Moscow (Russian Federation)

2015-06-01

The strategies adopted in Russia for a closed nuclear fuel cycle with fast reactors (FR), selection of fuel type and recycling technologies of spent nuclear fuel (SNF) are discussed. It is shown that one of the possible technological solutions for the closing of a fuel cycle could be the combination of pyroelectrochemical and hydrometallurgical methods of recycling of SNF. This combined scheme allows: recycling of SNF from FR with high burn-up and short cooling time; decreasing the volume of stored SNF and the amount of plutonium in a closed fuel cycle in FR; recycling of any type of SNF from FR; obtaining the high pure end uranium-plutonium-neptunium end-product for fuel refabrication using pellet technology.

CALiPER Report 22.1: Photoelectric Performance of LED MR16 Lamps

Energy Technology Data Exchange (ETDEWEB)

None, None

2015-08-31

This report looks at the photoelectric performance of the same set of lamps assessed in Report 22, using commercially available transformers and dimmers as well as laboratory power supplies providing either AC or DC. The investigation explores several issues related to the testing and use of MR16 lamps in lighting systems and examines the range of performance that is possible for a given lamp model, based on the system to which it is connected.

Study of the (p,pd), (p,pt) and (p,p3He) reactions on 12C and 16O at 75MeV

International Nuclear Information System (INIS)

Grossiord, Jean-Yves.

1976-01-01

These experiments have been performed at the Louvain-la-Neuve cyclotron (Belgium). Protons were detected by a two-detector telescope (one of them being a 7mm thick intrinsic germanium detector) and detection of d, t, 3 He was made with a three-detector telescope. The energy signals coming from these detectors together with the time difference between the two outgoing particles were registered on magnetic tapes. An off-line analysis of these data enabled to construct the excitation spectra of the residual nuclei 10 B, 9 B, 9 Be and 14 N, 13 N, 13 C; the energy resolution was about 400keV. For some of the levels of these nuclei, it has been possible to extract the momentum distribution of the corresponding cluster in 12 C and 16 O. The quasi-free scattering mechanism with distorted waves gives a good representation of the measured distributions and then seems to represent correctly the reaction mechanism. Moreover, assuming for the two and three particle spectroscopic amplitudes the values computed in the framework of the shell model with an effective interaction, it appears that the off-shell scattering cross-sections values are close to the free scattering cross-sections values taken at a proton energy which gives the same relative impulsion p-x as in the incident channel of the three body reaction. Finally, other informations can be obtained from the comparison of these data with experimental results from transfer reactions (p, 3 He) and (p,α): in particular, the population of the T=1 levels of 10 B (1.74MeV) and 14 N(2.31MeV) can be explained by the scattering of a proton on an n-p pair in singlet state (S=0) followed by a transition to the triplet state [fr

Analysis on the fuel cycle requirements of the FR systems

International Nuclear Information System (INIS)

Maki, Takashi; Horiuchi, Nobutake

2002-01-01

The functions of the nuclear fuel cycle amount analysis code, developed in 2001 were extended. This code is a program that calculates the change in characteristics with time of mass balance (for example, the amount of natural uranium demand, plutonium mass balance, environmental load reduction, etc.) in a nuclear fuel cycle, to examine the state of future reactor types or recycling facilities. In 2002, as for this code, calculation functions of reprocessing facilities on plutonium-thermal spent fuels, recovery uranium recycling, and multiple FR concepts were added, and the I/O function was improved according to it. Moreover, benchmark calculation to the extended amount analysis code was performed using the other tool, and it was confirmed that mass balance was calculated appropriately. Furthermore, the mass balance of a few typical FR cycle concepts was calculated in this analysis code, and the feature of each concept was clarified. (author)

Basic MR sequence parameters systematically bias automated brain volume estimation

International Nuclear Information System (INIS)

Haller, Sven; Falkovskiy, Pavel; Roche, Alexis; Marechal, Benedicte; Meuli, Reto; Thiran, Jean-Philippe; Krueger, Gunnar; Lovblad, Karl-Olof; Kober, Tobias

2016-01-01

Automated brain MRI morphometry, including hippocampal volumetry for Alzheimer disease, is increasingly recognized as a biomarker. Consequently, a rapidly increasing number of software tools have become available. We tested whether modifications of simple MR protocol parameters typically used in clinical routine systematically bias automated brain MRI segmentation results. The study was approved by the local ethical committee and included 20 consecutive patients (13 females, mean age 75.8 ± 13.8 years) undergoing clinical brain MRI at 1.5 T for workup of cognitive decline. We compared three 3D T1 magnetization prepared rapid gradient echo (MPRAGE) sequences with the following parameter settings: ADNI-2 1.2 mm iso-voxel, no image filtering, LOCAL- 1.0 mm iso-voxel no image filtering, LOCAL+ 1.0 mm iso-voxel with image edge enhancement. Brain segmentation was performed by two different and established analysis tools, FreeSurfer and MorphoBox, using standard parameters. Spatial resolution (1.0 versus 1.2 mm iso-voxel) and modification in contrast resulted in relative estimated volume difference of up to 4.28 % (p < 0.001) in cortical gray matter and 4.16 % (p < 0.01) in hippocampus. Image data filtering resulted in estimated volume difference of up to 5.48 % (p < 0.05) in cortical gray matter. A simple change of MR parameters, notably spatial resolution, contrast, and filtering, may systematically bias results of automated brain MRI morphometry of up to 4-5 %. This is in the same range as early disease-related brain volume alterations, for example, in Alzheimer disease. Automated brain segmentation software packages should therefore require strict MR parameter selection or include compensatory algorithms to avoid MR parameter-related bias of brain morphometry results. (orig.)

Basic MR sequence parameters systematically bias automated brain volume estimation

Energy Technology Data Exchange (ETDEWEB)

Haller, Sven [University of Geneva, Faculty of Medicine, Geneva (Switzerland); Affidea Centre de Diagnostique Radiologique de Carouge CDRC, Geneva (Switzerland); Falkovskiy, Pavel; Roche, Alexis; Marechal, Benedicte [Siemens Healthcare HC CEMEA SUI DI BM PI, Advanced Clinical Imaging Technology, Lausanne (Switzerland); University Hospital (CHUV), Department of Radiology, Lausanne (Switzerland); Meuli, Reto [University Hospital (CHUV), Department of Radiology, Lausanne (Switzerland); Thiran, Jean-Philippe [LTS5, Ecole Polytechnique Federale de Lausanne, Lausanne (Switzerland); Krueger, Gunnar [Siemens Medical Solutions USA, Inc., Boston, MA (United States); Lovblad, Karl-Olof [University of Geneva, Faculty of Medicine, Geneva (Switzerland); University Hospitals of Geneva, Geneva (Switzerland); Kober, Tobias [Siemens Healthcare HC CEMEA SUI DI BM PI, Advanced Clinical Imaging Technology, Lausanne (Switzerland); LTS5, Ecole Polytechnique Federale de Lausanne, Lausanne (Switzerland)

2016-11-15

Automated brain MRI morphometry, including hippocampal volumetry for Alzheimer disease, is increasingly recognized as a biomarker. Consequently, a rapidly increasing number of software tools have become available. We tested whether modifications of simple MR protocol parameters typically used in clinical routine systematically bias automated brain MRI segmentation results. The study was approved by the local ethical committee and included 20 consecutive patients (13 females, mean age 75.8 ± 13.8 years) undergoing clinical brain MRI at 1.5 T for workup of cognitive decline. We compared three 3D T1 magnetization prepared rapid gradient echo (MPRAGE) sequences with the following parameter settings: ADNI-2 1.2 mm iso-voxel, no image filtering, LOCAL- 1.0 mm iso-voxel no image filtering, LOCAL+ 1.0 mm iso-voxel with image edge enhancement. Brain segmentation was performed by two different and established analysis tools, FreeSurfer and MorphoBox, using standard parameters. Spatial resolution (1.0 versus 1.2 mm iso-voxel) and modification in contrast resulted in relative estimated volume difference of up to 4.28 % (p < 0.001) in cortical gray matter and 4.16 % (p < 0.01) in hippocampus. Image data filtering resulted in estimated volume difference of up to 5.48 % (p < 0.05) in cortical gray matter. A simple change of MR parameters, notably spatial resolution, contrast, and filtering, may systematically bias results of automated brain MRI morphometry of up to 4-5 %. This is in the same range as early disease-related brain volume alterations, for example, in Alzheimer disease. Automated brain segmentation software packages should therefore require strict MR parameter selection or include compensatory algorithms to avoid MR parameter-related bias of brain morphometry results. (orig.)

Analysis of cardiac energy metabolism in valve disease using 31P-MR-spectroscopy

International Nuclear Information System (INIS)

Beer, M.; Viehrig, M.; Seyfarth, T.; Sandstede, J.; Lipke, C.; Pabst, T.; Kenn, W.; Hahn, D.; Harre, K.; Horn, M.; Neubauer, S.; Landschuetz, W.; Kienlin, M. von

2000-01-01

Patients and methods: 10 healthy volunteers and 10 patients with aortic stenosis (pressure gradients >60 mmHg) were included. For assessment of energy metabolism, 31 P-MR spectra were obtained with a double oblique 3D-CSI technique (voxel size 25 cm 3 ). In 5 of 10 patients, follow-up examination was performed 3 months after surgical valve replacement (SVR). Left ventricular (LV) function was analyzed by cine MRI. Results: Before SVR the myocardial phosphocreatine to adenosinetriphosphate (PCr-ATP) ratio was significantly (p=0.0002) reduced to 0.80±0.25 in patients compared to 1.65±0.21 in volunteers. 3 months after SVR, LV mass had significantly (p=0.04) decreased from 238±33 g to 206±47 g. At the same time a significant (p=0.04) increase of the PCr-ATP ratio from 0.80±0.25 to 1.28±0.22 was observed. A slight, but not significant, reduction of the phosphodiester ATP ratio was observed before SVR, with a trend towards normalization after SVR. (orig.) [de

Development of an advanced 16x165 Westinghouse type PWR fuel assembly for Slovenia

International Nuclear Information System (INIS)

Boone, M. L.; King, S. J.; Pulver, E. F.; Jeon, K.-L.; Esteves, R.; Kurincic, B.

2004-01-01

Industrias Nucleares do Brasil (INB), KEPCO Nuclear Fuel Company, Ltd. (KNFC), and Westinghouse Electric Company (Westinghouse) have jointly designed an advanced 16x16 Westinghouse type PWR fuel assembly. This advanced 16x16 Westinghouse type PWR fuel assembly, which will be implemented in both Kori Unit 2 (in Korea) and Angra Unit 1 (in Brazil) in January and March 2005, respectively, is an integral part of the utilities fuel management strategy. This same fuel design has also been developed for future use in Krsko Unit 1 (in Slovenia). In this paper we will describe the front-end nuclear fuel management activities utilized by the joint development team and describe how these activities played an integral part in defining the direction of the advanced 16x16 Westinghouse type PWR fuel assembly design. Additionally, this paper will describe how this design demonstrates improved margins under high duty plant operating conditions. The major reason for initiating this joint development program was to update the current 16x16 fuel assembly, which is also called 16STD. The current 16STD fuel assembly contains a non-optimized fuel rod diameter for the fuel rod pitch (i.e. 9.5 mm OD fuel rods at a 0.485 inch pitch), non-neutronic efficient components (i.e. Inconel Mid grids), no Intermediate Flow Mixer (IFM) grids, and other mechanical features. The advanced 16x16 fuel assembly is being designed for peak rod average burnups of up to 75 MWd/kgU and will use an optimized fuel rod diameter (i.e. 9.14 mm OD ZIRLO TM fuel rods), neutronic efficient components (i.e. ZIRLO TM Mid grids), ZIRLO TM Intermediate Flow Mixer (IFM) grids to improve Departure from Nucleate Boiling (DNB) margin, and many other mechanical features that improve design margins. Nuclear design activities in the areas of fuel cycle cost and fuel management were performed in parallel to the fuel assembly design efforts. As the change in reactivity due to the change in the fuel rod diameter influences directly

MICROALLOYED STEELS FOR THE AUTOMOTIVE INDUSTRY

Directory of Open Access Journals (Sweden)

Debanshu Bhattacharya

2014-12-01

Full Text Available Two major drivers for the use of newer steels in the automotive industry are fuel efficiency and increased safety performance. Fuel efficiency is mainly a function of weight of steel parts, which in turn, is controlled by gauge and design. Safety is determined by the energy absorbing capacity of the steel used to make the part. All of these factors are incentives for the U.S. automakers to use both Highly Formable and Advanced High Strength Steels (AHSS to replace the conventional steels used to manufacture automotive parts in the past. AHSS is a general term used to describe various families of steels. The most common AHSS is the dual-phase steel that consists of a ferrite-martensite microstructure. These steels are characterized by high strength, good ductility, low tensile to yield strength ratio and high bake hardenability. Another class of AHSS is the complex-phase or multi-phase steel which has a complex microstructure consisting of various phase constituents and a high yield to tensile strength ratio. Transformation Induced Plasticity (TRIP steels is another class of AHSS steels finding interest among the U.S. automakers. These steels consist of a ferrite-bainite microstructure with significant amount of retained austenite phase and show the highest combination of strength and elongation, so far, among the AHSS in use. High level of energy absorbing capacity combined with a sustained level of high n value up to the limit of uniform elongation as well as high bake hardenability make these steels particularly attractive for safety critical parts and parts needing complex forming. A relatively new class of AHSS is the Quenching and Partitioning (Q&P steels. These steels seem to offer higher ductility than the dual-phase steels of similar strengths or similar ductility as the TRIP steels at higher strengths. Finally, martensitic steels with very high strengths are also in use for certain parts. The most recent initiative in the area of AHSS

Automotive mechatronics automotive networking, driving stability systems, electronics

CERN Document Server

2015-01-01

As the complexity of automotive vehicles increases this book presents operational and practical issues of automotive mechatronics. It is a comprehensive introduction to controlled automotive systems and provides detailed information of sensors for travel, angle, engine speed, vehicle speed, acceleration, pressure, temperature, flow, gas concentration etc. The measurement principles of the different sensor groups are explained and examples to show the measurement principles applied in different types. Contents Basics of mechatronics.- Architecture.- Electronic control unit.- Software development.- Basic principles of networking.- Automotive networking.- Bus systems.- Automotive sensors.- Sensor measuring principles.- Sensor types.- Electric actuators.- Electrohydraulic actuators.- Electronic transmission control.- Electronic transmission control unit.- Modules for transmission control.- Antilock braking system.- Traction control system.- Electronic stability program.- Automatic brake functions.- Hydraulic modu...

Automotive Fuel Processor Development and Demonstration with Fuel Cell Systems

Energy Technology Data Exchange (ETDEWEB)

Nuvera Fuel Cells

2005-04-15

The potential for fuel cell systems to improve energy efficiency and reduce emissions over conventional power systems has generated significant interest in fuel cell technologies. While fuel cells are being investigated for use in many applications such as stationary power generation and small portable devices, transportation applications present some unique challenges for fuel cell technology. Due to their lower operating temperature and non-brittle materials, most transportation work is focusing on fuel cells using proton exchange membrane (PEM) technology. Since PEM fuel cells are fueled by hydrogen, major obstacles to their widespread use are the lack of an available hydrogen fueling infrastructure and hydrogen's relatively low energy storage density, which leads to a much lower driving range than conventional vehicles. One potential solution to the hydrogen infrastructure and storage density issues is to convert a conventional fuel such as gasoline into hydrogen onboard the vehicle using a fuel processor. Figure 2 shows that gasoline stores roughly 7 times more energy per volume than pressurized hydrogen gas at 700 bar and 4 times more than liquid hydrogen. If integrated properly, the fuel processor/fuel cell system would also be more efficient than traditional engines and would give a fuel economy benefit while hydrogen storage and distribution issues are being investigated. Widespread implementation of fuel processor/fuel cell systems requires improvements in several aspects of the technology, including size, startup time, transient response time, and cost. In addition, the ability to operate on a number of hydrocarbon fuels that are available through the existing infrastructure is a key enabler for commercializing these systems. In this program, Nuvera Fuel Cells collaborated with the Department of Energy (DOE) to develop efficient, low-emission, multi-fuel processors for transportation applications. Nuvera's focus was on (1) developing fuel

Bacterial contamination of automotive fuels in a tropical region: the case of Costa Rica

Directory of Open Access Journals (Sweden)

Carlos E Rodríguez-Rodríguez

2009-09-01

Full Text Available Microbial contamination of fuel has been the cause of several problems in transportation and storage of these products. Due to the lack of previous studies related to these problems in Costa Rica, bacterial quality was evaluated biannually in automotive fuels stored in the four oil distribution facilities of the Costa Rican Petroleum Refinery (RECOPE. In 12 oil storage tanks, for a total of 96 samples, mesophilic, heterotrophic aerobic/facultative counts (ASTM D6974-04 and identification of bacteria presented in regular gas, premium gas and diesel from the bottom and superior part of the tanks were done; in the samples containing an aqueous phase, sulfate reducing bacteria (SRB were also quantified by the most probable number technique (MPN, according to the ASTM D4412-84 standard. The higher contamination was shown at the bottom of the tanks (populations up to 10(4 UFC/l, especially if there was accumulated water, in which case populations reached 10(8 UFC/l. The most contaminated fuel was diesel (counts up to 10(4 UFC/l, whereas the less contaminated was premium gas. The less contaminated fuels were from the facilities of La Garita and Barranca, whereas the most contaminated were from Ochomogo. Nevertheless, the quantified populations did not cause significant alteration in quality physicochemical parameters in the samples analyzed. A total of 149 bacterial strains were isolated, 136 (91.3% Gram positive and 13 (8.7% Gram negative. The most frequent genera were Staphylococcus (24.0%, Micrococcus (21.9%, Bacillus (18.8% and Kocuria (11.5% among Gram positive bacteria and Pseudomonas (7.3% among Gram negative bacteria. The majority of these genera have been found as fuel contaminants or even as degraders of this kind of products; nevertheless, some species for which their appearance or growth in hydrocarbons have not been described were found with low frequencies. SRB were present in counts up to 10(5 MPN/l in 42.9% of water containing samples

Recent Trends of Coated Sheet Steels for Automotive use

International Nuclear Information System (INIS)

Moon, Manbeen

2012-01-01

Recent issues in the automotive industries are, improvement of fuel efficiency according to the worldwide CO 2 regulation, passenger safety through enhanced crash worthiness, superior design and cost reduction due to price fluctuation of raw material. To meet these demands, steelmaking companies are developing advanced high strength steel and new process technologies such as hydroforming, TWB(Tailor Welded Blank), hot stamping and so on. In addition, eco-friendly and high corrosion resistant coating technologies are getting more attention to comply with the environmental regulations. In this paper, reviews and prospects of recent coating technologies for automotive use are presented

Immunohistochemical study of p53, pRb, p16 in esophageal cancer

International Nuclear Information System (INIS)

Zo, Jae Ill; Zo, Kyung Ja; Park, Jong Ho; Kim, Mi Hee

1998-01-01

To confirm the expression of molecular genetic alterations of p53, pRb, p16 in esophageal cancer and to investigate the expression of p53, pRb, p16 in esophageal cancer according to the pathologic steps of carcinogenesis, immuno-histochemistry was performed in 15 resected esophageal cancer specimens with multiple separated lesions after pathologic mapping. The accumulation of mutant p53 was observed in 60 % of dysplasia and 47 % of invasive cancer, while pRb was not detected in 91 % of dysplasia and 72.7 % of invasive cancer. But p16 was not observed in 0 % in dysplasia and 7 % of invasive cancer. But p16 was not observed in 0 % in dysplasia and 28.6 % in invasive cancer. There was no simultaneous negative pRb and p16 expression. There was no relations between p53 and p16, pRb. As a results, the expression of p53, pRb, p16 was co-related well with molecular genetic changes and inactivation of p53, pRb, p16 was co-related well with molecular genetic changes and inactivation of p53 and pRb was common and early event in esophageal carcinogenesis in Korea, but inactivation of p16 was a infrequent change. (author). 17 refs., 2 tabs., 7 figs

Reproducibility of Quantitative Brain Imaging Using a PET-Only and a Combined PET/MR System

Directory of Open Access Journals (Sweden)

Martin L. Lassen

2017-07-01

Full Text Available The purpose of this study was to test the feasibility of migrating a quantitative brain imaging protocol from a positron emission tomography (PET-only system to an integrated PET/MR system. Potential differences in both absolute radiotracer concentration as well as in the derived kinetic parameters as a function of PET system choice have been investigated. Five healthy volunteers underwent dynamic (R-[11C]verapamil imaging on the same day using a GE-Advance (PET-only and a Siemens Biograph mMR system (PET/MR. PET-emission data were reconstructed using a transmission-based attenuation correction (AC map (PET-only, whereas a standard MR-DIXON as well as a low-dose CT AC map was applied to PET/MR emission data. Kinetic modeling based on arterial blood sampling was performed using a 1-tissue-2-rate constant compartment model, yielding kinetic parameters (K1 and k2 and distribution volume (VT. Differences for parametric values obtained in the PET-only and the PET/MR systems were analyzed using a 2-way Analysis of Variance (ANOVA. Comparison of DIXON-based AC (PET/MR with emission data derived from the PET-only system revealed average inter-system differences of −33 ± 14% (p < 0.05 for the K1 parameter and −19 ± 9% (p < 0.05 for k2. Using a CT-based AC for PET/MR resulted in slightly lower systematic differences of −16 ± 18% for K1 and −9 ± 10% for k2. The average differences in VT were −18 ± 10% (p < 0.05 for DIXON- and −8 ± 13% for CT-based AC. Significant systematic differences were observed for kinetic parameters derived from emission data obtained from PET/MR and PET-only imaging due to different standard AC methods employed. Therefore, a transfer of imaging protocols from PET-only to PET/MR systems is not straightforward without application of proper correction methods.Clinical Trial Registration:www.clinicaltrialsregister.eu, identifier 2013-001724-19

Comparison of PWR-IMF and FR fuel cycles

International Nuclear Information System (INIS)

Darilek, Petr; Zajac, Radoslav; Breza, Juraj; Necas, Vladimir

2007-01-01

The paper gives a comparison of PWR (Russia origin VVER-440) cycle with improved micro-heterogeneous inert matrix fuel assemblies and FR cycle. Micro-heterogeneous combined assembly contains transmutation pins with Pu and MAs from burned uranium reprocessing and standard uranium pins. Cycle analyses were performed by HELIOS spectral code and SCALE code system. Comparison is based on fuel cycle indicators, used in the project RED-IMPACT - part of EU FP6. Advantages of both closed cycles are pointed out. (authors)

Assembly Bow Characteristics of the HIPER16TM Fuel Design

International Nuclear Information System (INIS)

Jeon, Sang-Youn; Kwon, O-Cheol; Ha, Dong-Geun; Kim, Jae-Ik

2015-01-01

The out-of-pile tests were performed either in air or in a hydraulic loop and at room temperature or operating temperature conditions. The test results include the required physical and thermal-hydraulic data needed to verify the HIPER16 TM fuel design. The mechanical integrity and safety of HIPER16 TM fuel design has been verified based on the final verification tests and evaluations. The visual examinations and dimensional measurements were performed on the LTAs using poolside examination equipment. The in-reactor verification test results showed that the HIPER16 TM fuel design met the irradiation related design requirement. The poolside examinations after 3rd irradiation cycle of LTA will be performed in the end of 2015.

Stepwise evolution of fuel assembly design toward a sustainable fuel cycle with hard neutron spectrum light water reactors

International Nuclear Information System (INIS)

Uchikawa, Sadao; Okubo, Tsutomu; Nakano, Yoshihiro

2011-01-01

An advanced LWR with hard neutron spectrum, FLWR, aims at efficient and flexible utilization of nuclear resources by evolving its fuel assembly design keeping the same core configuration. A proposed evolution process of the design toward a sustainable fuel cycle is composed of three stages, the first one based on the LWR fuel cycle infrastructures, the second one for transitioning from the LWR fuel cycle to the FR fuel cycle, and the third one based on the FR fuel cycle infrastructures. For the first stage, a fuel assembly design concept named FLWR/MIX has been developed in which enriched UO 2 fuel rods are arranged in the peripheral region of the assembly, surrounding the MOX fuel rods in the central region. The FLWR/MIX design realizes a breeder type operation under the framework of the LWR-MOX technologies and there experience. A modified FLWR/MIX design with low Pu inventory for the second stage has a potential of high Puf conversion ratio of 1.1 and can contribute to smooth and speedy transition from the LWR fuel cycle to the FR fuel cycle. For the third stage, the FLWR/MIX design is extended into a design with natural UO 2 fuel rods to realize multiple Pu recycling keeping a Puf conversion ratio of around 1.0. (author)

Army Demonstration of Light Obscuration Particle Counters for Monitoring Aviation Fuel Contamination

Science.gov (United States)

2013-05-07

Hydraulic industry has utilized this technology for decades and created a mature process •Hydraulic industry has developed recognized calibration ...Vehicle Fuel Tank Fuel Injector Aviation Fuel DEF (AUST) 5695B 18/16/13 Parker 18/16/13 14/10/7 Pamas/Parker/Particle Solutions 19/17/12 U.S. Army 19...17/14/13* Diesel Fuel World Wide Fuel Charter 4th 18/16/13 DEF (AUST) 5695B 18/16/13 Bosch/Cummins 18/16/13 Donaldson 22/21/18 14/13/11 12/9/6 P ll

4D flow MR imaging of the portal venous system: a feasibility study in children

International Nuclear Information System (INIS)

Parekh, Keyur; Rose, Michael; Popescu, Andrada; Rigsby, Cynthia K.; Markl, Michael; Schnell, Susanne

2017-01-01

To determine the feasibility of 4D flow MRI for visualization and quantification of the portal venous haemodynamics in children and young adults. 4D flow was performed in 28 paediatric patients (median age, 8.5 years; interquartile range, 5.2-16.5), 15 with non-operated native portal system and 13 with surgically created portal shunt. Image quality assessment for 3D flow visualization and flow pattern analyses was performed. Regional 4D flow peak velocity and net flow were compared with 2D-cine phase contrast MRI (2D-PC MR) in the post-surgical patients. Mean 3D flow visualization quality score was excellent (mean ± SD, 4.2 ± 0.9) with good inter-rater agreement (κ,0.67). Image quality in children aged >10 years was better than children ≤10 years (p < 0.05). Flow pattern was defined for portal, superior mesenteric, splenic veins and splenic artery in all patients. 4D flow and 2D-PC MR peak velocity and net flow were similar with good correlation (peak velocity: 4D flow 22.2 ± 9.1 cm/s and 2D-PC MR 25.2 ± 11.2 cm/s, p = 0.46; r = 0.92, p < 0.0001; net flow: 4D flow 9.5 ± 7.4 ml/s and 2D-PC MR 10.1 ± 7.3 ml/s, p = 0.65; r = 0.81, p = 0.0007). 4D flow MRI is feasible and holds promise for the comprehensive 3D visualization and quantification of portal venous flow dynamics in children and young adults. (orig.)

4D flow MR imaging of the portal venous system: a feasibility study in children

Energy Technology Data Exchange (ETDEWEB)

Parekh, Keyur; Rose, Michael; Popescu, Andrada; Rigsby, Cynthia K. [Ann and Robert H. Lurie Children' s Hospital of Chicago, Department of Medical Imaging, Chicago, IL (United States); Northwestern University, Department of Radiology, Feinberg School of Medicine, Chicago, IL (United States); Markl, Michael [Northwestern University, Department of Radiology, Feinberg School of Medicine, Chicago, IL (United States); McCormick School of Engineering, Northwestern University, Department of Biomedical Engineering, Chicago, IL (United States); Schnell, Susanne [Northwestern University, Department of Radiology, Feinberg School of Medicine, Chicago, IL (United States)

2017-02-15

To determine the feasibility of 4D flow MRI for visualization and quantification of the portal venous haemodynamics in children and young adults. 4D flow was performed in 28 paediatric patients (median age, 8.5 years; interquartile range, 5.2-16.5), 15 with non-operated native portal system and 13 with surgically created portal shunt. Image quality assessment for 3D flow visualization and flow pattern analyses was performed. Regional 4D flow peak velocity and net flow were compared with 2D-cine phase contrast MRI (2D-PC MR) in the post-surgical patients. Mean 3D flow visualization quality score was excellent (mean ± SD, 4.2 ± 0.9) with good inter-rater agreement (κ,0.67). Image quality in children aged >10 years was better than children ≤10 years (p < 0.05). Flow pattern was defined for portal, superior mesenteric, splenic veins and splenic artery in all patients. 4D flow and 2D-PC MR peak velocity and net flow were similar with good correlation (peak velocity: 4D flow 22.2 ± 9.1 cm/s and 2D-PC MR 25.2 ± 11.2 cm/s, p = 0.46; r = 0.92, p < 0.0001; net flow: 4D flow 9.5 ± 7.4 ml/s and 2D-PC MR 10.1 ± 7.3 ml/s, p = 0.65; r = 0.81, p = 0.0007). 4D flow MRI is feasible and holds promise for the comprehensive 3D visualization and quantification of portal venous flow dynamics in children and young adults. (orig.)

Status and Outlook for the U.S. Non-Automotive Fuel Cell Industry: Impacts of Government Policies and Assessment of Future Opportunities

Energy Technology Data Exchange (ETDEWEB)

Greene, David L [ORNL; Duleep, K. G. [ICF International; Upreti, Girish [ORNL

2011-06-01

Fuel cells (FCs) are considered essential future energy technologies by developed and developing economies alike. Several countries, including the United States, Japan, Germany, and South Korea have established publicly funded R&D and market transformation programs to develop viable domestic FC industries for both automotive and non-automotive applications. Important non-automotive applications include large scale and small scale distributed combined heat and electrical power, backup and uninterruptible power, material handling and auxiliary power units. The U.S. FC industry is in the early stages of development, and is working to establish sustainable markets in all these areas. To be successful, manufacturers must reduce costs, improve performance, and overcome market barriers to new technologies. U.S. policies are assisting via research and development, tax credits and government-only and government-assisted procurements. Over the past three years, the industry has made remarkable progress, bringing both stack and system costs down by more than a factor of two while improving durability and efficiency, thanks in part to government support. Today, FCs are still not yet able to compete in these markets without continued policy support. However, continuation or enhancement of current policies, such as the investment tax credit and government procurements, together with continued progress by the industry, appears likely to establish a viable domestic industry within the next decade.

MR-guided percutaneous biopsy of solitary pulmonary lesions using a 1.0-T open high-field MRI scanner with respiratory gating

Energy Technology Data Exchange (ETDEWEB)

Liu, Ming; Huang, Jie; Xu, Yujun; He, Xiangmeng; Lue, Yubo; Liu, Qiang; Li, Chengli [Department of Interventional MRI, Shandong Medical Imaging Research Institute affiliated to Shandong University, Shandong Key Laboratory of Advanced Medical Imaging Technologies and Applications, Jinan, Shandong (China); Li, Lei [Qingdao Central Hospital, Department of Interventional Radiology, Qingdao, Shandong (China); Blanco Sequeiros, Roberto [Turku University Hospital, The South Western Finland Imaging Centre, Turku (Finland)

2017-04-15

To prospectively evaluate the feasibility, safety and accuracy of MR-guided percutaneous biopsy of solitary pulmonary lesions using a 1.0-T open MR scanner with respiratory gating. Sixty-five patients with 65 solitary pulmonary lesions underwent MR-guided percutaneous coaxial cutting needle biopsy using a 1.0-T open MR scanner with respiratory gating. Lesions were divided into two groups according to maximum lesion diameters: ≤2.0 cm (n = 31) and >2.0 cm (n = 34). The final diagnosis was established in surgery and subsequent histology. Diagnostic accuracy, sensitivity and specificity were compared between the groups using Fisher's exact test. Accuracy, sensitivity and specificity of MRI-guided percutaneous pulmonary biopsy in diagnosing malignancy were 96.9 %, 96.4 % and 100 %, respectively. Accuracy, sensitivity and specificity were 96.8 %, 96.3 % and 100 % for lesions 2.0 cm or smaller and 97.1 %, 96.4 % and 100 %, respectively, for lesions larger than 2.0 cm. There was no significant difference between the two groups (P > 0.05). Biopsy-induced complications encountered were pneumothorax in 12.3 % (8/65) and haemoptysis in 4.6 % (3/65). There were no serious complications. MRI-guided percutaneous biopsy using a 1.0-T open MR scanner with respiratory gating is an accurate and safe diagnostic technique in evaluation of pulmonary lesions. (orig.)

46 CFR 58.01-10 - Fuel oil.

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Fuel oil. 58.01-10 Section 58.01-10 Shipping COAST GUARD... SYSTEMS General Requirements § 58.01-10 Fuel oil. (a) The following limits apply to the use of oil as fuel: (1) Except as otherwise permitted by this section, no fuel oil with a flashpoint of less than 60 °C...

Intrahepatic and hilar mass-forming cholangiocarcinoma: Qualitative and quantitative evaluation with diffusion-weighted MR imaging

Energy Technology Data Exchange (ETDEWEB)

Fattach, Hassan El, E-mail: hassangreenmed@gmail.com [Department of Abdominal Imaging, Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, 2 rue Ambroise Paré, 75010 Paris (France); Dohan, Anthony, E-mail: anthony.dohan@lrb.aphp.fr [Department of Abdominal Imaging, Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, 2 rue Ambroise Paré, 75010 Paris (France); Université Paris-Diderot, Sorbonne Paris Cité, 10 Avenue de Verdun, 75010 Paris (France); UMR INSERM 965-Paris 7 “Angiogenèse et recherche translationnelle”, 2 rue Amboise Paré, 75010 Paris (France); Guerrache, Youcef, E-mail: docyoucef05@yahoo.fr [Department of Abdominal Imaging, Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, 2 rue Ambroise Paré, 75010 Paris (France); Dautry, Raphael, E-mail: raphael.dautry@lrb.aphp.fr [Department of Abdominal Imaging, Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, 2 rue Ambroise Paré, 75010 Paris (France); Université Paris-Diderot, Sorbonne Paris Cité, 10 Avenue de Verdun, 75010 Paris (France); and others

2015-08-15

Highlights: • DW-MR imaging helps depicts all intrahepatic or hilar mass-forming cholangiocarcinomas. • DW-MRI provides best conspicuity of intrahepatic or hilar mass-forming cholangiocarcinomas than the other MRI sequences (P < 0.001). • The use of normalized ADC using the liver as reference organ results in the most restricted distribution of ADC values of intrahepatic or hilar mass-forming cholangiocarcinomas (variation coefficient = 16.6%). - Abstract: Objective: To qualitatively and quantitatively analyze the presentation of intrahepatic and hilar mass-forming cholangiocarcinoma with diffusion-weighted magnetic resonance imaging (DW-MRI). Materials and methods: Twenty-eight patients with histopathologically proven mass-forming cholangiocarcinoma (hilar, n = 17; intrahepatic, n = 11) underwent hepatic DW-MRI at 1.5-T using free-breathing acquisition and three b-values (0,400,800 s/mm{sup 2}). Cholangiocarcinomas were evaluated qualitatively using visual analysis of DW-MR images and quantitatively with conventional ADC and normalized ADC measurements using liver and spleen as reference organs. Results: All cholangiocarcinomas (28/28; 100%) were visible on DW-MR images. DW-MRI yielded best conspicuity of cholangiocarcinomas than the other MRI sequences (P < 0.001). Seven cholangiocarcinomas (7/11; 64%) showed hypointense central area on DW-MR images. Conventional ADC value of cholangiocarcinomas (1.042 × 10{sup −3} mm{sup 2}/s ± 0.221 × 10{sup −3} mm{sup 2}/s; range: 0.616 × 10{sup −3} mm{sup 2}/s to 2.050 × 10{sup −3} mm{sup 2}/s) was significantly lower than that of apparently normal hepatic parenchyma (1.362 × 10{sup −3} mm{sup 2}/s ± 0.187 × 10{sup −3} mm{sup 2}/s) (P < 0.0001), although substantial overlap was found. No significant differences in ADC and normalized ADC values were found between intrahepatic and hilar cholangiocarcinomas. The use of normalized ADC using the liver as reference organ resulted in the most restricted

Intrahepatic and hilar mass-forming cholangiocarcinoma: Qualitative and quantitative evaluation with diffusion-weighted MR imaging

International Nuclear Information System (INIS)

Fattach, Hassan El; Dohan, Anthony; Guerrache, Youcef; Dautry, Raphael

2015-01-01

Highlights: • DW-MR imaging helps depicts all intrahepatic or hilar mass-forming cholangiocarcinomas. • DW-MRI provides best conspicuity of intrahepatic or hilar mass-forming cholangiocarcinomas than the other MRI sequences (P < 0.001). • The use of normalized ADC using the liver as reference organ results in the most restricted distribution of ADC values of intrahepatic or hilar mass-forming cholangiocarcinomas (variation coefficient = 16.6%). - Abstract: Objective: To qualitatively and quantitatively analyze the presentation of intrahepatic and hilar mass-forming cholangiocarcinoma with diffusion-weighted magnetic resonance imaging (DW-MRI). Materials and methods: Twenty-eight patients with histopathologically proven mass-forming cholangiocarcinoma (hilar, n = 17; intrahepatic, n = 11) underwent hepatic DW-MRI at 1.5-T using free-breathing acquisition and three b-values (0,400,800 s/mm 2 ). Cholangiocarcinomas were evaluated qualitatively using visual analysis of DW-MR images and quantitatively with conventional ADC and normalized ADC measurements using liver and spleen as reference organs. Results: All cholangiocarcinomas (28/28; 100%) were visible on DW-MR images. DW-MRI yielded best conspicuity of cholangiocarcinomas than the other MRI sequences (P < 0.001). Seven cholangiocarcinomas (7/11; 64%) showed hypointense central area on DW-MR images. Conventional ADC value of cholangiocarcinomas (1.042 × 10 −3 mm 2 /s ± 0.221 × 10 −3 mm 2 /s; range: 0.616 × 10 −3 mm 2 /s to 2.050 × 10 −3 mm 2 /s) was significantly lower than that of apparently normal hepatic parenchyma (1.362 × 10 −3 mm 2 /s ± 0.187 × 10 −3 mm 2 /s) (P < 0.0001), although substantial overlap was found. No significant differences in ADC and normalized ADC values were found between intrahepatic and hilar cholangiocarcinomas. The use of normalized ADC using the liver as reference organ resulted in the most restricted distribution of ADC values of cholangiocarcinomas (variation

Minimizing of the boundary friction coefficient in automotive engines using Al2O3 and TiO2 nanoparticles

International Nuclear Information System (INIS)

Ali, Mohamed Kamal Ahmed; Xianjun, Hou; Elagouz, Ahmed; Essa, F.A.; Abdelkareem, Mohamed A. A.

2016-01-01

Minimizing of the boundary friction coefficient is critical for engine efficiency improvement. It is known that the tribological behavior has a major role in controlling the performance of automotive engines in terms of the fuel consumption. The purpose of this research is an experimental study to minimize the boundary friction coefficient via nano-lubricant additives. The tribological characteristics of Al 2 O 3 and TiO 2 nano-lubricants were evaluated under reciprocating test conditions to simulate a piston ring/cylinder liner interface in automotive engines. The nanoparticles were suspended in a commercially available lubricant in a concentration of 0.25 wt.% to formulate the nano-lubricants. The Al 2 O 3 and TiO 2 nanoparticles had sizes of 8–12 and 10 nm, respectively. The experimental results have shown that the boundary friction coefficient reduced by 35–51% near the top and bottom dead center of the stroke (TDC and BDC) for the Al 2 O 3 and TiO 2 nano-lubricants, respectively. The anti-wear mechanism was generated via the formation of protective films on the worn surfaces of the ring and liner. These results will be a promising approach for improving fuel economy in automotive.

The Progressive Insurance Automotive X PRIZE Education Program

Energy Technology Data Exchange (ETDEWEB)

Robyn Ready

2011-12-31

The Progressive Insurance Automotive X PRIZE Education Program conducted education and outreach activities and used the competition's technical goals and vehicle demonstrations as a means of attracting students and the public to learn more about advanced vehicle technologies, energy efficiency, climate change, alternative fuels, and the science and math behind efficient vehicle development. The Progressive Insurance Automotive X PRIZE Education Program comprised three integrated components that were designed to educate the general public and create a multi-tiered initiative to engage students and showcase the 21st century skills students will need to compete in our global economy: teamwork, creativity, strong literacy, math and science skills, and innovative thinking. The elements included an Online Experience, a National Student Contest, and in person education events and activites. The project leveraged online connections, strategic partnerships, in-classroom, and beyond-the-classroom initiatives, as well as mainstream media. This education program supported by the U.S. Department of Energy (DOE) also funded the specification of vehicle telemetry and the full development and operation of an interactive online experience that allowed internet users to follow the Progressive Insurance Automotive X PRIZE vehicles as they performed in real-time during the Progressive Insurance Automotive X PRIZE competition events.

31P MR spectroscopic measurement of intracellular pH in normal human hearts

International Nuclear Information System (INIS)

Kwon, Jae Hyun; Lee, Hui Joong; Jang, Yong Min

2002-01-01

To assess the usefulness of intracellular pH (pHi), calculated by determining the shift of a high-energy metabolite such as inorganic phosphate (Pi) of γ-ATP after performing MRS with ECG-gated two-dimensional 31 P CSI (chemical shift imaging), as a parameter for the overall state of the intracellular milieu. Proto decoupled 31 P CSI was performed on a 1.5-T scanner using a 1 H 31 P dual-tuned surface coil. Cardiac MRS data were obtained from eight normal volunteers aged 24-32 years with no history of heart disease. From the spectra obtained from several regions of the heart, peack position and peak area were estimated. The metabolic ratios of α-, β-, γ-ATP, PCr, Pi, phosphodiester and diphosphoglycerate were calculated, and pHi was estimated from the chemical shift of Pi and γ-ATP resonance. We then compared the data for the anterior myocardium with those previously published. The major phosphorous metabolites identified in these human hearts were as follows: PCr, at -0.1 to +0.1 ppm; three phosphate peaks from ATP, with a chemical shift centered at about -2.7 ppm (γ-ATP), -7.8 ppm (α-ATP), and -16.3 ppm (β-ATP); and phosphodiester (PDE) at 2-3 ppm, inorganic phosphate (Pi) at 4.5-5.4 ppm, and diphosphoglycerate (DPG) at 5.4-6.3 ppm. The PCr/β-ATP ratio was 2.20±0.17 and the PDE/β-ATP ratio, 1.04±0.09 pHi readings were 7.31±0.23 (calculated by the shift of Pi) and 6.81±0.20 (calculated by the shift of γ-ATP). Pi/PCR was 0.539, a ratio higher than that mentioned in previously published reports. The measurement of intracellular metabolism was affected by various kinds of factors. We believe, however, that pHi readings indicate the overall state of the cardiac intracellular milieu. An unexpected pHi readings, seen at MRS, may reflect errors in the MR procedure itself and, or in the analytical method

Effect of selenium compounds on murine B16 melanoma cells and pigmented cloned pB16 cells

International Nuclear Information System (INIS)

Siwek, B.; Bahbouth, E.; Serra, M.A.; Sabbioni, E.; Pauw-Gillet, M.C. de; Bassleer, R.

1994-01-01

The effects of selenium compounds such as sodium selenite, sodium selenate, seleno-DL-cystine and seleno-DL-methionine (100 μM and 10 μM) on B16 and pigmented cloned pB 16 murine melanoma cells were investigated in vitro. At the tested concentrations, B16 cells showed a greater sensitivity to the toxic effects of sodium selenite and seleno-DL-cystine than pB 16 cells, whereas no decrease of B 16 and pB 16 cell number was observed after incubation with sodium selenate or seleno-DL-methionine. Glutathione (GSH) percentages were strongly decreased only by selenite and seleno-DL-cystine; it was marked more in B 16 than in pB 16 cells. The pretreatment of B 16 cells with a GSH depleting agent (10 μM buthionine-[S,R]-sulfoximine) did not significantly influence the cytotoxic effects of selenite and seleno-DL-cystine. On both cell populations. GSH preincubation (50 μM) enhanced the cytotoxicity of selenite whereas the survival of seleno-DL-cystine treated cells was increased. Glutathione peroxidase (GSH-Px) activity in B 16 cells was more sensitive than in pB 16 cells to the activating effect of selenite, and particularly of seleno-DL-cystine; however, cell-free controls indicated that activation was mainly due to glutathione reductase. The rate of 75 Se (as sodium selenite) uptake in both cell populations was maximal within the first hour of incubation, with a preferential accumulation in the cytosol; after 24 h of incubation, the amount of 75 Se in cytosol and pellet was approximately the same. Gel filtration chromatography of lysed cells after incubation for 6 h with 10 μM 75 Se-selenite showed that the radioactivity was eluted as two peaks corresponding to low (4-9 kDa) and high (280-320 kDa) molecular weights. Possible toxicological mechanisms are discussed at molecular level. (orig./MG)

Firm and Product Heterogeneity in China's Automotive Exports

Directory of Open Access Journals (Sweden)

Jing Wang

2015-12-01

Full Text Available The main purpose of this paper is to provide an in-depth analysis of the anatomy of China's automotive exports, relying on the literature on firm and product heterogeneity. For this purpose, we use highly disaggregated HS 8-digit product-category level data collected by the Chinese Customs Office for 2000 and 2008, and we distinguish between foreign firms, domestic public firms, and domestic private firms. We also decompose automotive products into autos and auto parts and components (P/C. We then calculate both the extensive margins – number of products exported – and intensive margins – average value of exports per product – of China's automotive exports. We estimate gravity equations to assess the determinants of China's exports of autos and auto P/C. Overall, our analysis yields a number of new, interesting stylized facts about China's automotive exports by confirming the need for taking into account different types of heterogeneity in analyzing international trade.

High CpG island methylation of p16 gene and loss of p16 protein ...

Indian Academy of Sciences (India)

The study subjects consisted of 75 healthy ... that p16 protein expression was significantly lower in ToF group compared to ... in p16 promoters in ToF patients was negatively correlated with p16 protein ... studies, human foetal ventricular cardiomyocytes (HFCs) are ..... oral epithelial dysplasia: a prospective cohort study.

High CpG island methylation of p16 gene and loss of p16 protein

Indian Academy of Sciences (India)

Methylation-specific polymerase chain reaction (MSP) was employed to detect CpG island methylation in p16 promoter region andWestern blotting was used to detect p16 expression of all subjects. Real-time fluorescence quantitative polymerase chain reaction (FQ-PCR) was performed to test p16 mRNA expression.

k-t SENSE-accelerated Myocardial Perfusion MR Imaging at 3.0 Tesla - comparison with 1.5 Tesla

Science.gov (United States)

Plein, Sven; Schwitter, Juerg; Suerder, Daniel; Greenwood, John P.; Boesiger, Peter; Kozerke, Sebastian

2008-01-01

Purpose To determine the feasibility and diagnostic accuracy of high spatial resolution myocardial perfusion MR at 3.0 Tesla using k-space and time domain undersampling with sensitivity encoding (k-t SENSE). Materials and Methods The study was reviewed and approved by the local ethic review board. k-t SENSE perfusion MR was performed at 1.5 Tesla and 3.0 Tesla (saturation recovery gradient echo pulse sequence, repetition time/echo time 3.0ms/1.0ms, flip angle 15°, 5x k-t SENSE acceleration, spatial resolution 1.3×1.3×10mm3). Fourteen volunteers were studied at rest and 37 patients during adenosine stress. In volunteers, comparison was also made with standard-resolution (2.5×2.5×10mm3) 2x SENSE perfusion MR at 3.0 Tesla. Image quality, artifact scores, signal-to-noise ratios (SNR) and contrast-enhancement ratios (CER) were derived. In patients, diagnostic accuracy of visual analysis to detect >50% diameter stenosis on quantitative coronary angiography was determined by receiver-operator-characteristics (ROC). Results In volunteers, image quality and artifact scores were similar for 3.0 Tesla and 1.5 Tesla, while SNR was higher (11.6 vs. 5.6) and CER lower (1.1 vs. 1.5, p=0.012) at 3.0 Tesla. Compared with standard-resolution perfusion MR, image quality was higher for k-t SENSE (3.6 vs. 3.1, p=0.04), endocardial dark rim artifacts were reduced (artifact thickness 1.6mm vs. 2.4mm, pTesla and 1.5 Tesla, respectively. Conclusions k-t SENSE accelerated high-resolution perfusion MR at 3.0 Tesla is feasible with similar artifacts and diagnostic accuracy as at 1.5 Tesla. Compared with standard-resolution perfusion MR, image quality is improved and artifacts are reduced. PMID:18936311

Analysis on the fuel cycle requirements of the FR systems

International Nuclear Information System (INIS)

Maki, Takashi; Horiuchi, Nobutake

2003-01-01

The functions of the nuclear fuel cycle amount analysis code, developed in 2002 were extended. This code calculates the change in characteristics with time of mass balance (for example, the amount of natural uranium demand, plutonium mass balance, environmental load reduction, etc.) in nuclear fuel cycles, to examine the state of future reactor types or recycling facilities. In 2003, as for this code, calculation functions of automatic adjustment of FR capacity, LWR's recovery minor actinide (MA) recycling, were added, and the I/O function was improved according to it. Moreover, benchmark calculation to the extended amount analysis code was performed using the other tool, and it was confirmed that mass balance was calculated appropriately. Furthermore, the mass balance of a few typical FR cycle concepts was calculated with this analysis code, and the further of each concept was clarified. (author)

Normal variation and long-term reproducibility of image-selected in vivo brain MR spectroscopy

International Nuclear Information System (INIS)

Smith, M.A.; Porter, D.; Lowry, M.; Ayton, V.; Twelves, C.J.; Richards, M.A.; Garlick, P.; Maisey, M.N.

1988-01-01

MR spectroscopy of P-31 in the brain was performed with a 1.5-T MR imaging and spectroscopy system using ISIS with a 5-cm cube. A standardized spectral processing routine was adopted, and the ratios of peak areas were measured. Localized brain spectra were obtained from 17 healthy subjects, of whom ten had undergone repeated investigations after a delay of at least 1 month. The variation among healthy subjects, expressed as the mean +- standard deviation, and the long-term reproducibility, expressed as the coefficient of variation, were as follows: for peak areas phosphocreatine (PCr) Pi 2.46 +- 0.72, 21.3%, for PCr/PME, 1.97 +- 0.62, 16.8%, for PCr/PDE, 0.51 +- 0.07, 8.1%; for PCr/Υ-adenosine triphosphate (ATP), 1.13 + 0.15, 6.3%; for PCr/α-ATP, 1.09 +- 0.21, 10.3%, for PCr/β-ATP, 1.66 +- .027, 10.4%; and for pH, 7.00 +- 0.05, 0.8%

Flair MR imaging in the Detection of subarachnoid hemorrhage : comparison with CT and T1-weighted MR imaging

Energy Technology Data Exchange (ETDEWEB)

Min, Soo Hyun; Kim, Soo Youn; Lee, Ghi Jai; Shim, Jae Chan; Oh, Tae Kyung; Kim, Ho Kyun [College of Medicine, Jnje University, Seoul (Korea, Republic of)

2000-03-01

To compare the findings of fluid-attenuated inversion recovery (FLAIR) MR imaging in the detection of subarachnoid hemorrhage (SAH), with those of precontrast CT and T1-weighted MR imaging. In 13 patients (14 cases) with SAH, FLAIR MR images were retrospectively analyzed and compared with CT (10 patients, 11 cases) and T1-weighted MR images (9 cases). SAH was confirmed on the basis of high density along the subarachnoid space, as seen on precontrast CT, or lumbar puncture. MR imaging was performed on a 1.0T unit. FLAIR MR and CT images were obtained during the acute stage(less than 3 days after ictus) in 10 and 9 cases, respectively, during the subacute stage (4-14 days after ictus) in two cases and one, respectively, and during the chronic stage (more than 15 days after ictus) in two cases and one, respectively. CT was performed before FLAIR MR imaging, and the interval between CT and FLAIR ranged from 24 hours (6 cases) to 2-3 (2 cases) or 4-7 days (3 cases). In each study, the conspicuity of visualization of SAH was graded as excellent, good, fair, or negative at five locations (sylvian fissure, cortical sulci, anterior basal cistern, posterior basal cistern, and perimesencephalic cistern). In all cases, subarachnoid hemorrhages were demonstrated as high signal intensity areas on FLAIR images. The detection rates for SAH on CT and T1-weighted MR images were 100% (11/11) and 89% (8/9), respectively. FLAIR was superior to T1-weighted imaging in the detection of SAH at all sites except the anterior basal cistern (p less than 0.05) and superior to CT in the detection of SAH at the cortical sulci (p less than 0.05). On FLAIR MR images, subarachnoid hemorrhages at all stages are demonstrated as high signal intensity areas; the FLAIR MR sequence is thus considered useful in the detection of SAH. In particular FLAIR is more sensitive than CT for the detection of SAH in the cortical sulci. (author)

The MrCYP52 cytochrome P450 monoxygenase gene of Metarhizium robertsii is important for utilizing insect epicuticular hydrocarbons.

Directory of Open Access Journals (Sweden)

Liangcai Lin

Full Text Available Fungal pathogens of plants and insects infect their hosts by direct penetration of the cuticle. Plant and insect cuticles are covered by a hydrocarbon-rich waxy outer layer that represents the first barrier against infection. However, the fungal genes that underlie insect waxy layer degradation have received little attention. Here we characterize the single cytochrome P450 monoxygenase family 52 (MrCYP52 gene of the insect pathogen Metarhizium robertsii, and demonstrate that it encodes an enzyme required for efficient utilization of host hydrocarbons. Expressing a green florescent protein gene under control of the MrCYP52 promoter confirmed that MrCYP52 is up regulated on insect cuticle as well as by artificial media containing decane (C10, extracted cuticle hydrocarbons, and to a lesser extent long chain alkanes. Disrupting MrCYP52 resulted in reduced growth on epicuticular hydrocarbons and delayed developmental processes on insect cuticle, including germination and production of appressoria (infection structures. Extraction of alkanes from cuticle prevented induction of MrCYP52 and reduced growth. Insect bioassays against caterpillars (Galleria mellonella confirmed that disruption of MrCYP52 significantly reduces virulence. However, MrCYP52 was dispensable for normal germination and appressorial formation in vitro when the fungus was supplied with nitrogenous nutrients. We conclude therefore that MrCYP52 mediates degradation of epicuticular hydrocarbons and these are an important nutrient source, but not a source of chemical signals that trigger infection processes.

78 FR 7852 - Qualification of Drivers; Exemption Applications; Diabetes Mellitus

Science.gov (United States)

2013-02-04

... license from New York. Isaias Gomez Mr. Gomez, 54, has had ITDM since 2009. His endocrinologist examined..., Associate Administrator for Policy. [FR Doc. 2013-02268 Filed 2-1-13; 8:45 am] BILLING CODE P ...

The future of automotive technology

Energy Technology Data Exchange (ETDEWEB)

Carpenter, J.A.Jr.; Hamilton, D. [USDOE, Washington, DC (United States); Shah, R.; Belanger, M. [Computer Systems Management Inc., Alexandria, VA (United States)

2000-07-01

An overview of the technological advances that have been made in the automotive industry worldwide in recent years were presented with a brief insight into the potential ramifications in terms of fuel efficiency and pollution abatement. Developments in power trains, materials and alternative fuels were reviewed. Up to and including the 1980's most vehicles consisted of internal combustion engines. Today, advanced spark ignition and electric vehicles/hybrid electric vehicles are already in production in Japan, North America and Europe and all major automakers are working on vehicles powered by fuel cells. The use of alternative fuels such as natural gas, propane, alcohols, biodiesel and hydrogen will be encouraged for economic, environmental and energy security reasons. These alternative fuels, however, will not reduce emissions of carbon dioxide as long as they are made from fossil-carbon sources. Cars with all aluminum or fiber-reinforced polymetric-matrix composite bodies and aluminum chassis are emerging as a challenge to steel's domination. Also family sedans with fuel efficiencies of 80 miles per US gallon will be common place. It was emphasized that the extent to which these new technologies will be implemented will depend on consumer acceptance and on governmental regulations. 8 refs., 1 tab.

Future Automotive Systems Technology Simulator (FASTSim)

Energy Technology Data Exchange (ETDEWEB)

2018-04-11

An advanced vehicle powertrain systems analysis tool, the Future Automotive Systems Technology Simulator (FASTSim) provides a simple way to compare powertrains and estimate the impact of technology improvements on light-, medium- and heavy-duty vehicle efficiency, performance, cost, and battery life. Created by the National Renewable Energy Laboratory, FASTSim accommodates a range of vehicle types - including conventional vehicles, electric-drive vehicles, and fuel cell vehicles - and is available for free download in Microsoft Excel and Python formats.

Hybrid-electric propulsion for automotive and aviation applications

OpenAIRE

Friedrich, C; Robertson, Paul Andrew

2014-01-01

In parallel with the automotive industry, hybrid-electric propulsion is becoming a viable alternative propulsion technology for the aviation sector and reveals potential advantages including fuel savings, lower pollution, and reduced noise emission. Hybrid-electric propulsion systems can take advantage of the synergy between two technologies by utilizing both internal combustion engines and electric motors together, each operating at their respective optimum conditions...

Quantitative analysis of energy metabolism in human muscle using SLOOP 31P-MR-spectroscopy

International Nuclear Information System (INIS)

Beer, M.; Koestler, H.; Buchner, S.; Sandstede, J.; Hahn, D.

2002-01-01

Objective: Energy metabolism is vital for regular muscle function. In humans, in vivo analysis using 31 P-MR-spectroscopy (MRS) is mostly restricted to semiquantitative parameters due to technical demands. We applied spatial localization with optimal pointspread function (SLOOP) for quantification in human skeletal and cardiac muscle. Subjects/Methods: 10 healthy volunteers and 4 patients with myotonic dystrophy type 1 were examined using a 1.5 T system (Magnetom VISION) and chemical shift imaging (CSI) for data collection. Concentrations of PCr, ATP and P i as well as PCr/ATP ratios were calculated by SLOOP. Results: Concentrations of PCr, ATP and P i were 29.9±3.4, 7.1±0.9 and 5.7±1.2 [mmol/kg] in normal skeletal muscle, corresponding to previously published studies. Two of the patients with a duration of disease longer than 10 years and a pronounced muscle weakness showed a significant decrease of PCr and ATP in skeletal muscle below 10 and 5 mmol/kg. One of these patients had an additional reduction of PCr in cardiac muscle. (orig.) [de

Catabolic and regulatory systems in Shewanella oneidensis MR-1 involved in electricity generation in microbial fuel cells

Directory of Open Access Journals (Sweden)

Atsushi eKouzuma

2015-06-01

Full Text Available Shewanella oneidensis MR-1 is a facultative anaerobe that respires using a variety of inorganic and organic compounds. MR-1 is also capable of utilizing extracellular solid materials, including anodes in microbial fuel cells (MFCs, as electron acceptors, thereby enabling electricity generation. As MFCs have the potential to generate electricity from biomass waste and wastewater, MR-1 has been extensively studied to identify the molecular systems that are involved in electricity generation in MFCs. These studies have demonstrated the importance of extracellular electron-transfer pathways that electrically connect the quinone pool in the cytoplasmic membrane to extracellular electron acceptors. Electricity generation is also dependent on intracellular catabolic pathways that oxidize electron donors, such as lactate, and regulatory systems that control the expression of genes encoding the components of catabolic and electron-transfer pathways. In addition, recent findings suggest that cell-surface polymers, e.g., exopolysaccharides, and secreted chemicals, which function as electron shuttles, are also involved in electricity generation. Despite these advances in our knowledge on the extracellular electron-transfer processes in MR-1, further efforts are necessary to fully understand the underlying intra- and extra-cellular molecular systems for electricity generation in MFCs. We suggest that investigating how MR-1 coordinates these systems to efficiently transfer electrons to electrodes and conserve electrochemical energy for cell proliferation is important for establishing the biological bases for MFCs.

Whole shaft visibility and mechanical performance for active MR catheters using copper-nitinol braided polymer tubes

Directory of Open Access Journals (Sweden)

McVeigh Elliot R

2009-08-01

Full Text Available Abstract Background Catheter visualization and tracking remains a challenge in interventional MR. Active guidewires can be made conspicuous in "profile" along their whole shaft exploiting metallic core wire and hypotube components that are intrinsic to their mechanical performance. Polymer-based catheters, on the other hand, offer no conductive medium to carry radio frequency waves. We developed a new "active" catheter design for interventional MR with mechanical performance resembling braided X-ray devices. Our 75 cm long hybrid catheter shaft incorporates a wire lattice in a polymer matrix, and contains three distal loop coils in a flexible and torquable 7Fr device. We explored the impact of braid material designs on radiofrequency and mechanical performance. Results The incorporation of copper wire into in a superelastic nitinol braided loopless antenna allowed good visualization of the whole shaft (70 cm in vitro and in vivo in swine during real-time MR with 1.5 T scanner. Additional distal tip coils enhanced tip visibility. Increasing the copper:nitinol ratio in braiding configurations improved flexibility at the expense of torquability. We found a 16-wire braid of 1:1 copper:nitinol to have the optimum balance of mechanical (trackability, flexibility, torquability and antenna (signal attenuation properties. With this configuration, the temperature increase remained less than 2°C during real-time MR within 10 cm horizontal from the isocenter. The design was conspicuous in vitro and in vivo. Conclusion We have engineered a new loopless antenna configuration that imparts interventional MR catheters with satisfactory mechanical and imaging characteristics. This compact loopless antenna design can be generalized to visualize the whole shaft of any general-purpose polymer catheter to perform safe interventional procedures.

Career Development Standards for Vocational Automotive Service Instruction.

Science.gov (United States)

Motor Vehicle Manufacturers Association of the U.S., Inc., Detroit, MI.

The book, prepared for educators and industry, was designed as a complete guide to establishing an automotive training program. The 10 sections describe the following aspects of program planning and implementation: (1) career opportunities in automotive service; (2) guidance, counseling, placement, and followup; (3) school, parent, emPloyer,…

40 CFR 79.56 - Fuel and fuel additive grouping system.

Science.gov (United States)

2010-07-01

... industry-sponsored or other independent brokering arrangements. (3) Manufacturers who enroll a fuel or fuel... Specification for Automotive Spark-Ignition Engine Fuel”, used to define the general characteristics of gasoline... shall be chemical-grade quality, at a minimum, and shall not contain a significant amount of other...

MR imaging in following follicular and endometrial development during the menstrual cycle

International Nuclear Information System (INIS)

Janus, C.L.; Gendal, E.S.; Wiczyk, H.; Rabinowitz, J.G.; Laufer, N.

1987-01-01

The authors assessed the usefulness of MR imaging in monitoring follicular and endometrial development during the menstrual cycle. MR images, sonograms, and hormonal levels of estradiol (E2) and progesterone (P) obtained from five ovulatory volunteers were evaluated in approximately days 4, 8, 12, 16, 20, and 24 of the cycle. MR imaging surpassed US in demonstrating endometrial and myometrial changes. Follicular growth and development seen on MR images correlated well with US appearance and hormonal levels, with MR imaging demonstrating more secondary smaller follicles than US. Information about the normal cycle obtained with MR imaging is described and may have practical implications for women in infertility programs undergoing stimulated cycles and in vitro fertilization

An Analysis of the Thermal and Structure Behaviour of the UO2-PuO2-Fuel in the Irradiation Experiment of the UO2-PuO2-Fuel in the Irradiation Experiment FR2 Capsule Test Series 5a

International Nuclear Information System (INIS)

Lopez Jimenez, J.; Helmut, E.

1981-01-01

In the Karlsruhe research reactor FR2 nine fuel pins were irradiated within three irradiation capsules in the course of the test series 5a. The pins contained UO 2 -PuO 2 fuel pellets. They reached bump values of about 6, 17 and 47 Mwd/Kg Me with linear rod powers of 400 to 600 W/cm and clad surface temperature between 500 and 700 degree centigree. A detailed analysis of the fuel structuration data (columnar-grain and equiaxed- -grain growth regions) have allowed to determine, with the help of physic-mathematical models, the radii of these regions and the heat transfer through the contact zone between fuel and clad depending on the bump. The results of the analysis showed that the fuel surface temperature rose with increasing burnup. (Author) 16 refs

Automotive Chassis; Automotive Mechanics-Basic: 9043.02.

Science.gov (United States)

Dade County Public Schools, Miami, FL.

This automotive chassis course is designed to familiarize the beginning student of the history and development of the automobile with basic concepts common to the automobile industry, and general information that is required for successful advancement in the automotive mechanics field. It is one quinmester in a series of quinmester outlines…

The development of fuel cell systems for mobile applications

Energy Technology Data Exchange (ETDEWEB)

Van den Oosterkamp, P.F.; Kraaij, G.J.; Van der Laag, P.C.; Stobbe, E.R.; Wouters, D.A.J.

2006-09-15

The ECN fuel cell related R and D program on fuel cells is linked to the stationary market and the automotive market. This paper will summarize our R and D activities for the automotive market. The role of fuels cells in two transport application area's will be described: the development of dedicated hydrogen based platforms in combination with advanced electricity storage for special logistic applications and the APU (auxiliary power unit) market for passenger cars and trucks, as well as for ships and airplanes. The associated aspects of hydrogen transport and storage, as well as the reforming of logistic fuels and bio-fuels to hydrogen will be described with some illustrative examples. These examples show that an integrated approach using applied catalysis, chemical reactor design and engineering, process simulation, control modelling and electrical engineering is required to address all aspects of the development of fuel cell technology for automotive applications. The paper concludes with a summary of the important environmental and economic drivers that influence the fuel cell market application.

Evaluation of the pedal artery: comparison of three-dimensional gadolinium-enhanced MR angiography with digital subtraction angiography

Energy Technology Data Exchange (ETDEWEB)

Lee, Jeong Min; Kang, Sung Gwon; Byun, Joo Nam; Kim, Young Cheol; Choi, Jeong Yeol; Kim, Dong Hyun [College of Medicine, Chosun Univ., Kwangju (Korea, Republic of)

2002-07-01

To compare the three-dimensional gadolinium-enhanced MR angiography with digital subtraction angiography (DSA) for evaluation of the pedal artery. In 12 extremities of 11 patients, both digital subtraction angiography (DSA) and contrast-enhanced MR angiography (CE-MR angiography) were performed during the same week. Among ten of the 11 patients, the following conditions were present: atherosclerosis (n=4), diabetic foot (n=3), Buerger's disease (n=1), calciphylactic arteriopathy (n=1) and arteriovenous malformation of the foot (n=1). The remaining patient underwent angiography prior to flap surgery. For MR angiography, a 1.5T system using an extremity or head coil was used. A three-dimensional FISP (fast imaging with steady state precession) sequence was obtained before enhancement, followed by four sequential acquisitions (scan time, 20 secs, scan interval time, 10 secs) 10 seconds after intravenous bolus injection of normal saline (total 10 cc), following intravenous administration of gadolinium (0.02 mmol/kg, 3 ml/sec). Arterial segments of the ankle and foot were classified as the anterior or posterior tibial artery, the distal peroneal artery, the medial or lateral plantar artery, the pedal arch, and the dorsalis pedis artery. Two radiologists independently analysed visualization of each arteraial segment and the mean of visible arterial segments in one extreminty using CE-MR angiography and DSA. Among 84 arterial segments, 16 were invisible at both CE-MR angiography and DSA, while 39 were demonstrated by both modalities. Twenty-six segments were visible only at CE-MR angiography and three only at DSA. CE-MR angiography displayed a higher number of arterial segments than DSA (mean, 5.42 vs. mean 3.50, respectively), a difference which was statistically significant (p<0.000). The difference between each arterial segment was not statistically significant, except for the dorsalis pedis artery (t test, p<0.000). In that it provides additional information for

Interview with Mr. Albert A. Shishkin and Mr. Boris V. Nikipelov of the Soviet Union's Ministry of Atomic Energy and Industry

International Nuclear Information System (INIS)

Anon.

1991-01-01

NUEXCO first interviewed Mr. Nikipelov in the fall of 1989 on the subject of V/O Techsnabexport (TENEX) and its growing commercial presence in the international nuclear fuel market. In that interview, Mr. Nikipelov, First Deputy Minister of the Ministry of Atomic Energy and Industry (MAEI), concluded with a discussion of the non-nuclear production capability within the Ministry. He also emphasized the mutual benefits that might be derived from increased international trade in these areas. In this follow-up interview, Mr. Albert A. Shishkin, General Director of TENEX, joins Mr. Nikipelov in giving us more detail on the state-sponsored program of converting the production capacity of the Soviet nuclear fuel cycle and its supporting infrastructure from defense and power generation to commercial purposes

78 FR 49121 - Changes in Flood Elevation Determinations

Science.gov (United States)

2013-08-13

..., 2011; June Mr. Raymond E. Sines, July 01, 2011 390771 of Lake County (10- 21, 2011; The News President.... Sines, December 16, 2011 390771 of Lake County (11- August 18, 2011; President, Lake County 05-2150P...

Automotive emission standards. (Latest citations from Pollution Abstracts). Published Search

International Nuclear Information System (INIS)

1993-07-01

The bibliography contains citations concerning emission standards and air quality standards applied to automobile emissions. Included are federal and state regulations and policies regarding these emission standards. Techniques to meet emission standards are also addressed, involving fuel injection, catalysts, alternate engines, and automotive fuel refinery operations. Studies concerning implementation of automobile emission standards explore economic and environmental effects, testing and inspection procedures, and the automobile industry point of view. Most of the citations refer to gasoline engines, but a few pertain to diesel and other fuels. (Contains 250 citations and includes a subject term index and title list.)

Lightweight Steel Solutions for Automotive Industry

International Nuclear Information System (INIS)

Lee, Hong Woo; Kim, Gyosung; Park, Sung Ho

2010-01-01

Recently, improvement in fuel efficiency and safety has become the biggest issue in worldwide automotive industry. Although the regulation of environment and safety has been tightened up more and more, the majority of vehicle bodies are still manufactured from stamped steel components. This means that the optimized steel solutions enable to demonstrate its ability to reduce body weight with high crashworthiness performance instead of expensive light weight materials such as Al, Mg and composites. To provide the innovative steel solutions for automotive industry, POSCO has developed AHSS and its application technologies, which is directly connected to EVI activities. EVI is a technical cooperation program with customer covering all stages of new car project from design to mass production. Integrated light weight solutions through new forming technologies such as TWB, hydroforming and HPF are continuously developed and provided for EVI activities. This paper will discuss the detailed status of these technologies especially light weight steel solutions based on innovative technologies.

Electrostatic discharge risks in electronics used in automotive application / Otomotiv Uygulamalarında Kullanılan Elektronik Donanımda Elektrostatik Boşalma Riskleri

OpenAIRE

Thirunavukkarasu, P.; Sethupathi, N.; S, Tamilarasu

2014-01-01

The automotive industry pays special attention to knowledge-based specification, design, manufacturing and qualification of components and other integrated circuits (ICs). As a result, there is the demand for ICs to be fit-for-application rather than any consideration of fit-for-standard. Thus when the ESD specs are stated, the rationale for the requirements needs to be understood. Therefore, we first need to consider if the ESD requirements for the automotive environment are any different fr...

Natural gas as an alternative to crude oil in automotive fuel chains well-to-wheel analysis and transition strategy development

International Nuclear Information System (INIS)

Hekkert, M.P.; Hendriks, F.H.J.F.; Faaij, A.P.C.; Neelis, M.L.

2005-01-01

Road transport produces significant amounts of CO 2 by using crude oil as primary energy source. A reduction of CO 2 emissions can be achieved by implementing alternative fuel chains. This article studies CO 2 emissions and energy efficiencies by means of a well to wheel analysis of alternative automotive fuel chains, using natural gas (NG) as an alternative primary energy source to replace crude oil. The results indicate that NG-based hydrogen applied in fuel cell vehicles (FCVs) lead to largest CO 2 emission reductions (up to 40% compared to current practice). However, large implementation barriers for this option are foreseen, both technically and in terms of network change. Two different transition strategies are discussed to gradually make the transition to these preferred fuel chains. Important transition technologies that are the backbone of these routes are traditional engine technology fuelled by compressed NG and a FCV fuelled by gasoline. The first is preferred in terms of carbon emissions. The results furthermore indicate that an innovation in the conventional chain, the diesel hybrid vehicle, is more efficient than many NG-based chains. This option scores well in terms of carbon emissions and implementation barriers and is a very strong option for the future

Comparisons of MR findings of the spinal metastasis and the spinal tuberculosis

International Nuclear Information System (INIS)

Hong, Myung Sun; Lee, Kil Woo; Kang, Ik Won; Yun, Ku Sub; Choi, Chul Sun; Bae, Sang Hoon

1994-01-01

MR findings of the spinal metastasis and the tuberculosis are well known, but sometimes it might be difficult to differentiate these lesions. Therefore we reviewed and analyzed the MR findings which would be useful for the differentiation. T1- and T2- weighted spin echo images and gadolinium-enhanced T1- weighted images were obtained with 1.5 T and 1.0 T superconductive MR imager. We reviewed MR findings in 16 cases of spinal metastases and 24 cases of spinal tuberculosis in terms of signal intensity, contrast enhancement pattern, disc space involvement, spinal canal compressing feature and paraspinal soft tissue mass. The signal intensities of both lesions were hypointense on T1WI and hyperintense on T2WI except those of the metastatic lesions from the prostatic carcinoma. Heterogeneous enhancement was noted in 63% of metastasis, whereas peripheral rim enhancement was noted 83% of spinal tuberculosis(p < .001). Spinal canal compression by collapsed vertebra was only noted in spinal metastasis, and that by paraspinal soft tissue was noted in both spinal metastasis and tuberculosis(p<.001). Disc space invasion was noted in 19% of spinal metastasis and 88% of spinal tuberculosis. Spinal tuberculosis was common at lower thoracic spine(T10) and typically involved two or more adjacent vertebral bodies(96%). The important differential point between spinal metastasis and tuberculosis was the enhancement pattern, involvement of two or more contiguous vertebral bodies and the feature of spinal canal compressing. The secondary importance was the disc space involvement pattern

MR study of acute myocardial infarction with injection of Gd-DOTA (Fifteen patients)

International Nuclear Information System (INIS)

Richoz, B.; Delcour, C.; Depelchin, P.; Lenaers, A.; Jacquemin, C.; Gusella, P.; Struyven, J.; Richoz, B.

1990-01-01

We studied 15 patients 4 to 8 days after myocardial infarction by using ECG gated MR before and after administration of 0.2 mmol/kg Gd-DOTA. The diagnosis in each patient was confirmed by electrocardiographic criteria, elevated levels of fractionated creatine kinase (CK) isoenzyme, thallium scintigraphy, ventriculography and coronarography. T1-weighted, spin-echo images, were obtained before and immediately after injection of Gd-DOTA and were repeated 15 min later. The site of infarction was visualized in 10 patients as an area of high signal intensity after the injection of Gd-DOTA. Contrast between normal and infarcted myocardium was greatest 15 min after injection. Three patients were excluded because of failure to acquire adequate MR studies. In 2 other patients, the infarct were not detected. Before injection of Gd-DOTA, only 2 infarcts were detected. These results suggest that Gd-DOTA can improve MR visualization and detection of acute myocardial infarction [fr

{sup 31}P MR spectroscopic measurement of intracellular pH in normal human hearts

Energy Technology Data Exchange (ETDEWEB)

Kwon, Jae Hyun; Lee, Hui Joong; Jang, Yong Min [Kyungpook National Univ., Taegu (Korea, Republic of)] [and others

2002-05-01

To assess the usefulness of intracellular pH (pHi), calculated by determining the shift of a high-energy metabolite such as inorganic phosphate (Pi) of {gamma}-ATP after performing MRS with ECG-gated two-dimensional {sup 31}P CSI (chemical shift imaging), as a parameter for the overall state of the intracellular milieu. Proto decoupled {sup 31}P CSI was performed on a 1.5-T scanner using a {sup 1}H{sup 31}P dual-tuned surface coil. Cardiac MRS data were obtained from eight normal volunteers aged 24-32 years with no history of heart disease. From the spectra obtained from several regions of the heart, peack position and peak area were estimated. The metabolic ratios of {alpha}-, {beta}-, {gamma}-ATP, PCr, Pi, phosphodiester and diphosphoglycerate were calculated, and pHi was estimated from the chemical shift of Pi and {gamma}-ATP resonance. We then compared the data for the anterior myocardium with those previously published. The major phosphorous metabolites identified in these human hearts were as follows: PCr, at -0.1 to +0.1 ppm; three phosphate peaks from ATP, with a chemical shift centered at about -2.7 ppm ({gamma}-ATP), -7.8 ppm ({alpha}-ATP), and -16.3 ppm ({beta}-ATP); and phosphodiester (PDE) at 2-3 ppm, inorganic phosphate (Pi) at 4.5-5.4 ppm, and diphosphoglycerate (DPG) at 5.4-6.3 ppm. The PCr/{beta}-ATP ratio was 2.20{+-}0.17 and the PDE/{beta}-ATP ratio, 1.04{+-}0.09 pHi readings were 7.31{+-}0.23 (calculated by the shift of Pi) and 6.81{+-}0.20 (calculated by the shift of {gamma}-ATP). Pi/PCR was 0.539, a ratio higher than that mentioned in previously published reports. The measurement of intracellular metabolism was affected by various kinds of factors. We believe, however, that pHi readings indicate the overall state of the cardiac intracellular milieu. An unexpected pHi readings, seen at MRS, may reflect errors in the MR procedure itself and, or in the analytical method.

Common variants on 2p16.1, 6p22.1 and 10q24.32 are associated with schizophrenia in Han Chinese population.

Science.gov (United States)

Yu, H; Yan, H; Li, J; Li, Z; Zhang, X; Ma, Y; Mei, L; Liu, C; Cai, L; Wang, Q; Zhang, F; Iwata, N; Ikeda, M; Wang, L; Lu, T; Li, M; Xu, H; Wu, X; Liu, B; Yang, J; Li, K; Lv, L; Ma, X; Wang, C; Li, L; Yang, F; Jiang, T; Shi, Y; Li, T; Zhang, D; Yue, W

2017-07-01

Many schizophrenia susceptibility loci have been identified through genome-wide association studies (GWASs) in European populations. However, until recently, schizophrenia GWASs in non-European populations were limited to small sample sizes and have yielded few loci associated with schizophrenia. To identify genetic risk variations for schizophrenia in the Han Chinese population, we performed a two-stage GWAS of schizophrenia comprising 4384 cases and 5770 controls, followed by independent replications of 13 single-nucleotide polymorphisms in an additional 4339 schizophrenia cases and 7043 controls of Han Chinese ancestry. Furthermore, we conducted additional analyses based on the results in the discovery stage. The combined analysis confirmed evidence of genome-wide significant associations in the Han Chinese population for three loci, at 2p16.1 (rs1051061, in an exon of VRK2, P=1.14 × 10 -12 , odds ratio (OR)=1.17), 6p22.1 (rs115070292 in an intron of GABBR1, P=4.96 × 10 -10 , OR=0.77) and 10q24.32 (rs10883795 in an intron of AS3MT, P=7.94 × 10 -10 , OR=0.87; rs10883765 at an intron of ARL3, P=3.06 × 10 -9 , OR=0.87). The polygenic risk score based on Psychiatric Genomics Consortium schizophrenia GWAS data modestly predicted case-control status in the Chinese population (Nagelkerke R 2 : 1.7% ~5.7%). Our pathway analysis suggested that neurological biological pathways such as GABAergic signaling, dopaminergic signaling, cell adhesion molecules and myelination pathways are involved in schizophrenia. These findings provide new insights into the pathogenesis of schizophrenia in the Han Chinese population. Further studies are needed to establish the biological context and potential clinical utility of these findings.

Prostate cancer: a comparative study of {sup 11}C-choline PET and MR imaging combined with proton MR spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Yamaguchi, Takako; Lee, Jin; Takahashi, Nobukazu; Oka, Takashi; Shizukuishi, Kazuya; Inoue, Tomio [Yokohama City University School of Medicine, Department of Radiology, Yokohama (Japan); Uemura, Hiroji; Kubota, Yoshinobu [Yokohama City University School of Medicine, Department of Urology, Kanagawa (Japan); Sasaki, Takeshi [Yokohama City University School of Medicine, Department of Pathology, Kanagawa (Japan); Endou, Hisashi [Yokohama City University School of Medicine, Department of Pharmacy, Kanagawa (Japan)

2005-07-01

Prostate cancer is difficult to visualise in its early stages using current imaging technology. The present study aimed to clarify the utility of {sup 11}C-choline PET for localising and evaluating cancer lesions in patients with prostate cancer by conducting a prospective comparison with magnetic resonance (MR) imaging combined with proton MR spectroscopy. PET and MR imaging combined with proton MR spectroscopy were performed in 20 patients with prostate cancer. Correlations among the metabolite ratio of choline + creatine to citrate (Cho+Cr/Ci) on MR spectroscopy, serum PSA and maximum standardised uptake value (SUV{sub max}) of {sup 11}C-choline were assessed. The location of the primary lesion was assessed by the site of SUV{sub max} and the laterality of the highest Cho+Cr/Ci ratio and confirmed by examination of surgical pathology specimens (n=16). PET exhibited a diagnostic sensitivity of 100% (20/20) for primary lesions, while the sensitivities of MR imaging and MR spectroscopy were 60% (12/20) and 65% (13/20), respectively. Weak linear correlations were observed between SUV{sub max} and serum PSA (r=0.52, p<0.05), and between SUV{sub max} and Cho+Cr/Ci ratio (r=0.49, p<0.05). Regarding the localisation of main primary lesions, PET results agreed with pathological findings in 13 patients (81%) ({kappa}=0.59), while MR spectroscopy results were in accordance with pathological findings in eight patients (50%) ({kappa}=0.11). This preliminary study suggests that {sup 11}C-choline PET may provide more accurate information regarding the localisation of main primary prostate cancer lesions than MR imaging/MR spectroscopy. A further clinical study of {sup 11}C-choline PET in a large number of patients suspected of prostate cancer will be necessary to determine the clinical utility of {sup 11}C-choline PET in patients who clinically require biopsy. (orig.)

Automobile Buyer Decisions about Fuel Economy and Fuel Efficiency

OpenAIRE

Kurani, Ken; Turrentine, Thomas

2004-01-01

Much prior research into consumer automotive and fuel purchase behaviors and fuel economy has been shaped by the normative assumptions of economics. Among these assumptions are that consumers should pay attention to costs of fuel and that they are aware of their options to save on fuel over long periods of time, i.e., the life of a vehicle or at least their period of ownership. For example, researchers have analyzed in some depth consumer choices for more fuel economical vehicles in the 1980s...

Gain-enhanced LTCC system-on-package for automotive UMRR applications

KAUST Repository

Ghaffar, Farhan A.

2012-07-28

A novel Low Temperature Co-fired Ceramic (LTCC) based SoP for automotive radar applications is presented. For the first time a combination of a relatively low dielectric constant LTCC substrate and a high dielectric constant LTCC superstrate has been incorporated to enhance the overall gain of the module. The superstrate can provide additional protection to the integrated circuits (IC) in the harsh automotive environment. A custom cavity in the LTCC substrate can accommodate the IC, which feeds an aperture coupled patch antenna array. The cavity is embedded below the ground plane that acts as a shield for the IC from antenna radiation. It is estimated that with mere 10 dBm of transmitted RF power the miniature SoP module (sized 2.0 cm × 2.0 cm × 0.22 cm) can communicate up to 67 m. The design\\'s compactness, robustness, transmission power and resultant communication range are highly suitable for Universal Medium Range Radar (UMRR) applications. © 2010 IEEE.

In vivo P-31 MR spectroscopic studies of liver in normal adults and cirrhotic patients

International Nuclear Information System (INIS)

Ban, N.; Moriyasu, F.; Tamada, T.

1986-01-01

The author performed in vivo P-31 MR spectroscopic studies of normal and diseased human liver using an experimental 2.0-T whole-body MR imager. Then normal adults and ten cirrhotic patients in the fasting state were studied. Spatially localized in vivo P-31 MR spectra of human liver were obtained in combination with the use of a surface coil and gradient magnetic field. Six spectral peaks were observed in both groups and were assigned, from left to right, to phosphomonoester, inorganic phosphate, phosophodiester, γ-ATP, α-ATP, and β-ATP, on the basis of the chemical shifts. There were no definite differences between the spectral patterns of normal adults and those of cirrhotic patients in the fasting state

Ankle ligamints : comparison of MR arthrography with conventional MR imaging in amputated feet

International Nuclear Information System (INIS)

Yoo, Jae Sung; Lee, Sang Yong; Lee, Jeong Min; Han, Young Min; Chung, Kyung Ho; Kim, CHong Soo

2001-01-01

To compare magnetic resonance (MR) arthrography with conventional MR imaging in the evaluation of ankle ligaments. Eight freshly amputated human feet underwent conventional MR imaging and MR arthrography. For the former, 1.5-T magnets in the axial, coronal and sagittal planes were used, and T1-weighted sequences were obtained. Following the injection of 6-10 ml of diluted contrast media (Gd-DTPA 1:250), T1-weighted images were obtained in the same positions as conventional MR images. Paired conventional MR imaging and MR arthrography of each ankle ligament were rated on a five-point scale, and to reflect inter-group differences a Wilcoxon singed-rank test was used to compare the different measurements (p<0.05). In two ankles, MR images of the ligaments were correlated with ankle dissection. Anterior and posterior talofibular ligaments were more clearly revealed by MR arthrography than by conventional MR imaging, while calcaneofibular ligaments showed no difference between these two modalities. With regard to deltoid ligaments, visualization of the anterior and posterior tibiotalar ligament was much improved when contrast material was used to outline the ligament's articular aspect. Visualization of the posterior inferior tibiofibular ligament and inferior transverse ligament were also improved when the use of contrast material provided delineation of the articular side of the ligaments and separated them from adjacent bone. In addition, MR arthography was very useful for indentification of the posterior intermalleolar ligament, though its use did not enhance visualization of the calcaneofibular, tibiocalcaneal, spring or tibiospring ligaments. MR arthrography accurately revealed the anatomic details of ankle ligaments, and may therefore be more useful than conventional Mr imaging for evaluation of these structures

Analysis of human papilloma virus in oral squamous cell carcinoma using p16: An immunohistochemical study

Science.gov (United States)

Patil, S.; Rao, R. S.; Amrutha, N.; Sanketh, D. S.

2014-01-01

Aims: The aim of this study is to evaluate the expression of human papilloma virus (HPV) in oral squamous cell carcinoma (OSCC) and to correlate the association of HPV in histological grades of OSCC using p16 (p16INK4a) immunohistochemistry (IHC). Subjects and Methods: This study consists of 30 histological diagnosed cases of OSCC (10-well-differentiated oral squamous cell carcinoma [WDOSCC], 10-moderately differentiated oral squamous cell carcinoma [MDOSCC] and 10-poorly differentiated oral squamous cell carcinoma [PDOSCC]). The sections were subjected to IHC procedure using p16. Two parameters in immunohistochemical p16 expression were evaluated by 3 observers based on the criteria by Galgano M. Tetal (2010) (a) percentage of p16 positive cases (b) pattern of p16 staining in various grades of OSCC. Statistical Analysis Used: Kappa test. Results: Totally, 30 samples of 0SCC, p16 positivity was noted in 26/30 (86.66%). Of 26 positive cases, p16 staining was positive in 7/10 (70%) of WDOSCC, 9/10 (90%) in MDOSCC and, 10/10 (100%) PDOSCC. Incidentally, we also found single dispersed cell staining in WDOSCC, patchy staining in MDOSCC and more diffuse staining pattern predominant in PDOSCC. Conclusions: Our study revealed an association between HPV and OSCC. Diffuse staining pattern was noted in PDOSCC, which in turn depicts the increase viral overload, which might have an influence on its aggressive behavior. PMID:24818098

Effect of Fuel on Performance of a Single Combustor of an I-16 Turbojet Engine at Simulated Altitude Conditions

Science.gov (United States)

Zettle, Eugene V; Bolz, Ray E; Dittrich, R T

1947-01-01

As part of a study of the effects of fuel composition on the combustor performance of a turbojet engine, an investigation was made in a single I-16 combustor with the standard I-16 injection nozzle, supplied by the engine manufacturer, at simulated altitude conditions. The 10 fuels investigated included hydrocarbons of the paraffin olefin, naphthene, and aromatic classes having a boiling range from 113 degrees to 655 degrees F. They were hot-acid octane, diisobutylene, methylcyclohexane, benzene, xylene, 62-octane gasoline, kerosene, solvent 2, and Diesel fuel oil. The fuels were tested at combustor conditions simulating I-16 turbojet operation at an altitude of 45,000 feet and at a rotor speed of 12,200 rpm. At these conditions the combustor-inlet air temperature, static pressure, and velocity were 60 degrees F., 12.3 inches of mercury absolute, and 112 feet per second respectively, and were held approximately constant for the investigation. The reproducibility of the data is shown by check runs taken each day during the investigation. The combustion in the exhaust elbow was visually observed for each fuel investigated.

Polymer matrix nanocomposites for automotive structural components

Science.gov (United States)

Naskar, Amit K.; Keum, Jong K.; Boeman, Raymond G.

2016-12-01

Over the past several decades, the automotive industry has expended significant effort to develop lightweight parts from new easy-to-process polymeric nanocomposites. These materials have been particularly attractive because they can increase fuel efficiency and reduce greenhouse gas emissions. However, attempts to reinforce soft matrices by nanoscale reinforcing agents at commercially deployable scales have been only sporadically successful to date. This situation is due primarily to the lack of fundamental understanding of how multiscale interfacial interactions and the resultant structures affect the properties of polymer nanocomposites. In this Perspective, we critically evaluate the state of the art in the field and propose a possible path that may help to overcome these barriers. Only once we achieve a deeper understanding of the structure-properties relationship of polymer matrix nanocomposites will we be able to develop novel structural nanocomposites with enhanced mechanical properties for automotive applications.

Minimizing of the boundary friction coefficient in automotive engines using Al{sub 2}O{sub 3} and TiO{sub 2} nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Ali, Mohamed Kamal Ahmed, E-mail: eng.m.kamal@mu.edu.eg; Xianjun, Hou, E-mail: houxj@whut.edu.cn; Elagouz, Ahmed [Wuhan University of Technology, Hubei Key Laboratory of Advanced Technology for Automotive Components (China); Essa, F.A. [Kafrelsheikh University, Mechanical Engineering Department, Faculty of Engineering (Egypt); Abdelkareem, Mohamed A. A. [Wuhan University of Technology, Hubei Key Laboratory of Advanced Technology for Automotive Components (China)

2016-12-15

Minimizing of the boundary friction coefficient is critical for engine efficiency improvement. It is known that the tribological behavior has a major role in controlling the performance of automotive engines in terms of the fuel consumption. The purpose of this research is an experimental study to minimize the boundary friction coefficient via nano-lubricant additives. The tribological characteristics of Al{sub 2}O{sub 3} and TiO{sub 2} nano-lubricants were evaluated under reciprocating test conditions to simulate a piston ring/cylinder liner interface in automotive engines. The nanoparticles were suspended in a commercially available lubricant in a concentration of 0.25 wt.% to formulate the nano-lubricants. The Al{sub 2}O{sub 3} and TiO{sub 2} nanoparticles had sizes of 8–12 and 10 nm, respectively. The experimental results have shown that the boundary friction coefficient reduced by 35–51% near the top and bottom dead center of the stroke (TDC and BDC) for the Al{sub 2}O{sub 3} and TiO{sub 2} nano-lubricants, respectively. The anti-wear mechanism was generated via the formation of protective films on the worn surfaces of the ring and liner. These results will be a promising approach for improving fuel economy in automotive.

19 CFR 10.62 - Bunker fuel oil.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Bunker fuel oil. 10.62 Section 10.62 Customs... Equipment for Vessels § 10.62 Bunker fuel oil. (a) Withdrawal under section 309, Tariff Act of 1930, as... section 309, Tariff Act of 1930, as amended (19 U.S.C. 1309), when all the bunker fuel oil in a Customs...

Analysis of the potential for new automotive uses of wrought magnesium

Energy Technology Data Exchange (ETDEWEB)

Gaines, L.; Cuenca, R.; Wu, S. [Argonne National Lab., IL (United States); Stodolsky, F. [Argonne National Lab., IL (United States)]|[Argonne National Lab., Washington, DC (United States)

1996-02-01

The Center for Transportation Research at Argonne National Laboratory has performed a study for the Lightweight Materials Program within the US Department of Energy`s Office of Transportation Materials to evaluate the suitability of wrought magnesium and its alloys to replace steel or aluminum for automotive structural and sheet applications. Vehicle weight reduction is one of the major means available for improving automotive fuel efficiency. Although high-strength steels, Al, and polymers are already being used to achieve significant weight reductions, substantial additional weight reductions could be achieved by increased use of Mg (whose density is less than one-fourth that of steel and only two-thirds that of Al). This study shows that Mg sheet could be used in automotive body nonstructural and semistructural applications, whereas extrusions could be used in such structural applications as spaceframes. The primary barrier to such uses of wrought Mg is high cost.

Expression of cdk4 and p16 in Oral Lichen Planus.

Science.gov (United States)

Goel, Sinny; Khurana, Nita; Marwah, Akanksha; Gupta, Sunita

2015-01-01

The purpose of this study was to evaluate the expression of cdk4 and p16, the proteins implicated in hyperproliferation and arrest in oral lichen planus and to compare their expression in erosive and non-erosive oral lichen planus and with normal mucosa and oral squamous cell carcinoma. Analysis of cdk4 and p16 expression was done in 43 erosive oral lichen planus (EOLP) and 17 non-erosive oral lichen planus (NOLP) cases, 10 normal mucosa and 10 oral squamous cell carcinoma (OSCC) cases with immunohistochemistry. This study demonstrated a significantly increased expression of cytoplasmic cdk4 (80% cases, cells stained - 19.6%), and cytoplasmic p16 (68.3% cases, cells stained - 16.4%) in oral lichen planus (OLP) compared to normal mucosa. cdk4 was much higher in OSCC in both cytoplasm and nuclei compared to normal mucosa. Also, while comparing OLP with positive control, significant difference was noted for cdk4 and p16, with expression being more in OSCC. While comparing EOLP with NOLP; significant differences were seen for cdk4 cytoplasmic staining only, for number of cases with positive staining as well as number of cells stained. Overexpression of cytoplasmic cdk4 and p16 was registered in oral lichen planus, however considerably lower than in squamous cell carcinoma. Erosive oral lichen planus demonstrated overexpression of cytoplasmic cdk4 and premalignant nature compared to non-erosive lesion. Therefore there is an obvious possibility for cytoplasmic expression of cdk4 and p16 to predict malignant potential of oral lichen planus lesions.

Meiotic and pedigree segregation analyses in carriers of t(4;8)(p16;p23.1) differing in localization of breakpoint positions at 4p subband 4p16.3 and 4p16.1.

Science.gov (United States)

Midro, Alina T; Zollino, Marcella; Wiland, Ewa; Panasiuk, Barbara; Iwanowski, Piotr S; Murdolo, Marina; Śmigiel, Robert; Sąsiadek, Maria; Pilch, Jacek; Kurpisz, Maciej

2016-02-01

The purpose of this study was to compare meiotic segregation in sperm cells from two carriers with t(4;8)(p16;p23.1) reciprocal chromosome translocations (RCTs), differing in localization of the breakpoint positions at the 4p subband-namely, 4p16.3 (carrier 1) and 4p16.1 (carrier 2)-and to compare data of the pedigree analyses performed by direct method. Three-color fluorescent in situ hybridization (FISH) on sperm cells and FISH mapping for the evaluation of the breakpoint positions, data from pedigrees, and direct segregation analysis of the pedigrees were performed. Similar proportions of normal/balanced and unbalanced sperm cells were found in both carriers. The most common was an alternate type of segregation (about 52 % and about 48 %, respectively). Unbalanced adjacent I and adjacent II karyotypes were found in similar proportions about 15 %. The direct segregation analysis (following Stengel-Rutkowski) of the pedigree of carriers of t(4;8)(p16.1;p23.1) was performed and results were compared with the data of the pedigree segregation analysis obtained earlier through the indirect method. The probability of live-born progeny with unbalanced karyotype for carriers of t(4;8)(p16.1;p23.1) was moderately high at 18.8 %-comparable to the value obtained using the indirect method for the same carriership, which was 12 %. This was, however, markedly lower than the value of 41.2 % obtained through the pedigree segregation indirect analysis estimated for carriers of t(4;8)(p16.3;p23.1), perhaps due to the unique composition of genes present within the 4p16.1-4p 16.3 region. Revealed differences in pedigree segregation analysis did not correspond to the very similar profile of meiotic segregation patterns presented by carrier 1 and carrier 2. Most probably, such discordances may be due to differences in embryo survival rates arising from different genetic backgrounds.

SINTESIS 4,10,16,22-TETRAMETOKSIKALIKS[4] ARENA DARI MINYAK ADAS (SYNTHESIS OF 4,10,16,22-TETRAMETHOXYCALIX [4] ARENE FROM ANISE OIL

Directory of Open Access Journals (Sweden)

Ratna Ningsih S

2015-01-01

Full Text Available One kind of calixarenes, i.e. 4,10,16,22-tetramethoxycalix[4]arene (4, has been synthesized from anethole (1, which was isolated from anise oil. The synthesis of 4 was carried out via acid-catalyzed procedure. The reaction route consists of three stages, i.e. (i oxidation of 1 with KMnO4 at 40oC for 15 minutes, (ii reduction p-anisaldehyde (2 with NaBH4 at 76oC for 3 hours, and  (iii cyclotetramerization of p-anisilalcohol (3 with AlCl3 at 20oC for 2 hours. Oxidation of 1 produced 2 in 77%, whereas reduction of 2 gave 3 in 55 %. The cyclotetramerization of 3 yielded 4 in 95 %.  Key Words: 4,10,16,22-tetramethoxycalix[4]arene, Anise Oil, Anethole

Gadolinium-enhanced excretory MR urography: comparison with MR urography using HASTE technique

International Nuclear Information System (INIS)

Jin, Gong Yong; Lee, Jeong Min; Han, Young Min; Cheong, Gyung Ho; Oh, Hee Sul; Kim, Chong Soo; Park, Sung Kwang; Kim, Young Gon

2000-01-01

To compare the feasibility of gadolinium-enhanced excretory MR urography (GEMRU) and conventional MR urography using the half-Fourier acquisition single-shot turbo spin-echo (HASTE) sequence in patients with hydronephrosis or non-visualized kidney. Fifteen patients with hydronephrosis or non-visualized kidney, as demonstrated by ultrasonography or intravenous urography, were enrolled in this study. Nine were men and six were women, and their age ranged from 18 to 77 (mean, 60.6) years. For all MR examinations, a 1.5T MR unit was employed. For breath-hold MR urography, the HASTE technique (MRU) was used, and reconstruction involved the use of a maximum intensity-projection (MIP) algorithm. For gadolinium-enhanced excretory MR urography, the fast low angle shot (FLASH) 3-D method was used and images were obtained at 5, 10, 20, and 30 minutes, and reconstruction again involved the use of MIP algorithm. In some cases, additional GEMRU was obtained 24 hour after contrast material injection, and an MIP algorithm was used for reconstruction. MRU and GEMRU were independently interpreted by two radiologists who for quantitative analysis compared SNR with CNR, and at each anatomic level qualitatively analyzed morphologic accuracy and diagnostic value of the lesions. In quantitative analysis, SNR and CNR differences between the two sequences at the renal pelvis and the level of the ureter were not significant (p greater than 0.05). In qualitative analysis, GEMRU was superior to MRU for the assessment of evaluated ureter at each level (p less than 0.05), anatomic anomaly and intrinsic tumor. Ureteral stones, however, were more easily diagnosed with MRU. For assessment of the ureter GEMRU is superior to MRU and has the advantage of evaluating renal function. We believe that for evaluation of the urinary tract, especially the distal ureter, GEMRU may be a valuable adjunct to routine MR urography. (author)

75 FR 27463 - List of Approved Spent Fuel Storage Casks: NUHOMS® HD System Revision 1; Correction

Science.gov (United States)

2010-05-17

... Fuel Storage Casks: NUHOMS[supreg] HD System Revision 1; Correction AGENCY: Nuclear Regulatory... fuel storage casks to add revision 1 to the NUHOMS HD spent fuel storage cask system. This action is... Federal Register on May 7, 2010 (75 FR 25120), that proposes to amend the regulations that govern storage...

Trisomy 10p and translocation of 10q to 4p associated with selective dysgenesis of IgA-producing cells in lymphoid tissue.

Science.gov (United States)

Saiga, Tatsuyoshi; Hashimoto, Kazuhiro; Kimura, Nobusuke; Ono, Hisako; Hiai, Hiroshi

2007-01-01

A combined chromosomal abberation trisomy of the short arm of chromosome 10 associated with translocation of 10q to chromosome 4p was found in a 14-month-old boy, who died after repeated bouts of pneumonia. The translocation involved the target region 4p16.3 of Wolf-Hirschhorn syndrome and/or Pitt-Rogers-Danks syndrome. The karyotype was 46,XY,der(4)t(4;10)(p16;q11.2),i(10)(p10),ish der(4)t(4;10)(p16.3;q11.2) (D4S96+,D4Z1+),i(10) (pter ++). In addition to growth retardation and external as well as internal dysmorphism, the patient had abnormalities of the immune system, such as thymic involution, generalized lymph node enlargement, unusual distribution of T cells in lymphoid follicles, and selective IgA deficiency. The IgA-producing cells were rarely found in lymph nodes but normally in intestinal mucosa. In contrast, in the lymph nodes, the paracortical T-lymphocytes were hyperplastic, but they rarely entered the primary follicles. It is assumed that the chromosomal abnormality may lead to the dysfunction of T lymphocytes and, further, to the dysgenesis of IgA-producing cells in lymph nodes but not in intestinal mucosa. This suggests that the thymus may differentially control the subsets of IgA-producing cells in lymph nodes and intestinal mucosa.

Environmental sustainability: plastic's evolving role in the automotive life cycle

International Nuclear Information System (INIS)

Jekel, L.; Tam, E.K.L.

2002-01-01

One method of assessing the sustainability of manufactured products involves performing a life cycle analysis for a product and comparing it to alternative ones, or else examining if individual stages of the product can be modified. LCA applications are being used more extensively, especially in the automotive and related industries. Automotive plastics in particular are being scrutinized with much greater care. Plastic components have replaced metal ones in vehicle manufacturing to improve vehicle fuel efficiency and aesthetics. However, at the end of a vehicle's life, recycling rates for plastic are negligible when compared to those of steel. In order to gain the full environmental benefits of using plastic as a vehicle material, plastics must be recycled at the end of a vehicle's life, especially given their increasing use. While a variety of processes have been developed for the recycling of automotive plastics, the challenges of sorting, processing, and finally recycling a heterogeneous mixture of used plastics have yet to be effectively solved. A preliminary life cycle assessment of a plastic automotive fascia demonstrates the usefulness of this eco-balance technique in evaluating potential improvements to manufacturing and end-of-life processes. Improving the manufacturing process may reduce environmental burdens to a larger extent than just recycling the plastic. (author)

Is a long term work in automotive industry a risk factor for renal dysfunction?

Science.gov (United States)

Assadi, Seyedeh Negar

2015-01-01

Disorders of renal system can cause renal failure; therefore screening is necessary especially in workers who are exposed to harmful materials. Hypertension, diabetes mellitus, and hazardous exposures are non-occupational and occupational risk factors for renal diseases. The objective of this study was to determine the effects of working in automotive industry on renal function in Iran. In a historical cohort study, workers of automotive industry who worked in production and had low exposure to metal fumes were selected and divided to three groups with 5-10, 11-20, and 21-30 years work duration. risk factors for renal diseases were collected and analyzed with SPSS using one-way ANOVA, correlation coefficient and with P automotive Industry with low exposure to toxic metals and solvents has no significant effect on GFR, creatinine clearance, uric acid, and mean blood pressure.

Storing electricity, the technological challenge of the automotive sector

International Nuclear Information System (INIS)

Moulet, C.

2010-01-01

The search for alternatives to the internal combustion engine for motor vehicles may be nothing new, but the present focus on environmental issues (dwindling fossil fuel reserves, growing awareness of the environmental impact of the internal combustion engine, etc.) makes it more topical than ever. It is no coincidence that most manufacturers and OEMs on the automotive market, and many research centers, are studying the use of batteries and fuel cells as a means of developing greener, sustainable transport solutions for the future. The European Union is considering ways of compelling manufacturers to market vehicles that are more fuel-efficient at a time when the members of the European Automobile Manufacturers Association, unlike their counterparts in Japan, are failing to meet the targets defined in voluntary agreements. Through their sales of hybrid vehicles, Japanese manufacturers have lent credibility to the notion of a market for electrified vehicles. In this way, market constraints (environmental impact of the internal combustion engine, the cost of fossil fuel, consumers, and national or European lawmakers) will push the automotive industry into marketing 'low-carbon' vehicles in the very short term. Manufacturers' product plans reveal that a wave of electrified products can be expected on the market in 2015. That implies a significant R and D effort between now and 2012, with demonstrator vehicles up and running by 2013-2014 at the latest. So now is a crucial time for research organisations to position themselves in preparation for this emerging market. Industry is hoping for technological progress in areas that cut across these varying degrees of hybridisation and electrification, namely the storage and management of electrical energy and power electronics. It is these areas that will be at the heart of research programs. In these highly competitive times, efforts should focus on: - Lowering costs (by a factor of 5 to 10 for fuel cells and 2 to 4 for

The expression of cyclin-dependent kinase inhibitors p15, p16, p21, and p27 during ovarian follicle growth initiation in the mouse

Directory of Open Access Journals (Sweden)

Bayrak Aykut

2003-05-01

Full Text Available Abstract Background Cyclins regulate the cell cycle in association with cyclin dependent kinases (CDKs. CDKs are under inhibitory control of cyclin dependent kinase inhibitors (CDKIs. Method In this study we tested the expression of CDKIs p15, p16, p21 and p27 by immunohistochemistry to determine the role of CDKIs in the initiation of primordial follicle growth. Ovaries were collected from 60-day-old cycling B6D2F1/J mice (n = 16. Results Expression of p15, p16, p21 and p27 did not vary in granulosa and theca cells by the follicle stage. However, p16 staining was stronger (++ in the oocytes of all primordial, and 57.4 ± 3.1% of primary follicles compared to the remaining primary and more advanced follicles (+. Interestingly, primary follicles with weaker (+ oocyte staining for p16 had significantly larger mean follicle diameter compared to the primary and primordial follicles with stronger (++ oocyte staining (55.6 ± 2.1 vs. 32.0 ± 1.0 and 26.5 ± 0.7 μm, respectively, p Conclusions These preliminary findings suggest that the initiation of oocyte growth, which seems to lead follicle growth, is associated with diminished p16 expression in the mouse ovary. Further studies are needed to investigate the factors that regulate the expression of p16 in the oocyte, which might also govern the initiation of primordial follicle growth.

MR imaging in chronic epicondylitis humeri radialis at 1.0 T: is Gd-DTPA administration useful?

International Nuclear Information System (INIS)

Herber, S.; Kalden, P.; Kreitner, K.-F.; Thelen, M.

2001-01-01

Purpose: Evaluation of the diagnostic value and confidence of contrast-enhanced MR imaging in patients with lateral epicondylitis in comparison to clinical diagnosis. Material and Methods: 42 consecutive patients with clinically proven chronic lateral epicondylitis and 10 elbow joints of healthy controls have been examined on a 1.0 T MR-unit. Criteria for inclusion in the prospective study were: persistant pain and a failed conservative therapy. The MR protocol included STIR sequence, a native, T 2 -weighted, fat-supressed TSE sequence, and a flash-2-D sequence. Also, fat-supressed, T 1 -weighted SE sequences before and after administration of Gd-DTPA contrast media have been recorded. Results: In 39/42 patients the STIR sequence showed an increased SI of the common extensor tendom. Increased MR signal of the lateral collateral ligament combined with a thickening and a partial rupture or a full thickness tear have been observed in 15/42 cases. A bone marrow edema at the lateral epicondylus was noticed in 6 of the studied patients and a joint effusion in 18/42 patients. After administration of contrast media we noticed an average increase of SI by about 150%. However, enhanced MR imaging did not provide additional information. Conclusion: In MR imaging of chronic epicondylitis administration of gadolinium-DTPA does not provide additional information. (orig.) [de

Hybrid Automotive Engine Using Ethanol-Burning Miller Cycle

Science.gov (United States)

Weinstein, Leonard

2004-01-01

A proposed hybrid (internal-combustion/ electric) automotive engine system would include as its internal-combustion subsystem, a modified Miller-cycle engine with regenerative air preheating and with autoignition like that of a Diesel engine. The fuel would be ethanol and would be burned lean to ensure complete combustion. Although the proposed engine would have a relatively low power-to-weight ratio compared to most present engines, this would not be the problem encountered if this engine were used in a non-hybrid system since hybrid systems require significantly lower power and thus smaller engines than purely internal-combustion-engine-driven vehicles. The disadvantage would be offset by the advantages of high fuel efficiency, low emission of nitrogen oxides and particulate pollutants, and the fact that ethanol is a renewable fuel. The original Miller-cycle engine, named after its inventor, was patented in the 1940s and is the basis of engines used in some modern automobiles, but is not widely known. In somewhat oversimplified terms, the main difference between a Miller-cycle engine and a common (Otto-cycle) automobile engine is that the Miller-cycle engine has a longer expansion stroke while retaining the shorter compression stroke. This is accomplished by leaving the intake valve open for part of the compression stroke, whereas in the Otto cycle engine, the intake valve is kept closed during the entire compression stroke. This greater expansion ratio makes it possible to extract more energy from the combustion process without expending more energy for compression. The net result is greater efficiency. In the proposed engine, the regenerative preheating would be effected by running the intake air through a heat exchanger connected to the engine block. The regenerative preheating would offer two advantages: It would ensure reliable autoignition during operation at low ambient temperature and would help to cool the engine, thereby reducing the remainder of the

The effect of impact duration on the axial fracture tolerance of the isolated tibia during automotive and military impacts.

Science.gov (United States)

Martinez, Alberto A; Chakravarty, Avery B; Quenneville, Cheryl E

2018-02-01

Axial impacts to the lower leg during debilitating events such as frontal automotive collisions and military underbody blasts can cause significant injuries to the tibia. Several studies have conducted axial impact tests to determine the injury limits of the lower leg, mostly focused on automotive intrusions, resulting in an established force criterion for injury assessments. Due to the viscoelastic properties of bone, it remains unclear whether results from automotive experiments can be applied to higher-rate military blasts. Twelve male isolated cadaveric tibias (from six pairs, mean age: 62 ± 8 years) were subjected to axial impact loads using a custom-built pneumatic impactor, with one specimen from each pair tested at velocity and impact durations representative of a military blast condition, and the contralateral under conditions representing an automotive collision. Impacts were applied in increasing levels of intensity (defined using energy levels) until fracture occurred. Fracture risk was influenced by projectile velocity, kinetic energy, impulse, and load rate, and there was a significant difference in peak force (p = 0.023), impulse (p = 0.09), and load rate (p = 0.025) between the automotive and military test conditions causing fracture. A 10% risk of fracture corresponded to an impact force of 9.0kN for the automotive condition and 12.2kN for the military condition. These results suggest that fracture tolerances developed in studies that simulate automotive impacts cannot be directly applied to military impacts of shorter duration. The number of factors identified to predict injury also suggests that fracture is not controlled by a single variable. Copyright © 2017 Elsevier Ltd. All rights reserved.

Thoracic staging in lung cancer: prospective comparison of 18F-FDG PET/MR imaging and 18F-FDG PET/CT.

Science.gov (United States)

Heusch, Philipp; Buchbender, Christian; Köhler, Jens; Nensa, Felix; Gauler, Thomas; Gomez, Benedikt; Reis, Henning; Stamatis, Georgios; Kühl, Hilmar; Hartung, Verena; Heusner, Till A

2014-03-01

Therapeutic decisions in non-small cell lung cancer (NSCLC) patients depend on the tumor stage. PET/CT with (18)F-FDG is widely accepted as the diagnostic standard of care. The purpose of this study was to compare a dedicated pulmonary (18)F-FDG PET/MR imaging protocol with (18)F-FDG PET/CT for primary and locoregional lymph node staging in NSCLC patients using histopathology as the reference. Twenty-two patients (12 men, 10 women; mean age ± SD, 65.1 ± 9.1 y) with histopathologically confirmed NSCLC underwent (18)F-FDG PET/CT, followed by (18)F-FDG PET/MR imaging, including a dedicated pulmonary MR imaging protocol. T and N staging according to the seventh edition of the American Joint Committee on Cancer staging manual was performed by 2 readers in separate sessions for (18)F-FDG PET/CT and PET/MR imaging, respectively. Results from histopathology were used as the standard of reference. The mean and maximum standardized uptake value (SUV(mean) and SUV(max), respectively) and maximum diameter of the primary tumor was measured and compared in (18)F-FDG PET/CT and PET/MR imaging. PET/MR imaging and (18)F-FDG PET/CT agreed on T stages in 16 of 16 of patients (100%). All patients were correctly staged by (18)F-FDG PET/CT and PET/MR (100%), compared with histopathology. There was no statistically significant difference between (18)F-FDG PET/CT and (18)F-FDG PET/MR imaging for lymph node metastases detection (P = 0.48). For definition of thoracic N stages, PET/MR imaging and (18)F-FDG PET/CT were concordant in 20 of 22 patients (91%). PET/MR imaging determined the N stage correctly in 20 of 22 patients (91%). (18)F-FDG PET/CT determined the N stage correctly in 18 of 22 patients (82%). The mean differences for SUV(mean) and SUV(max) of NSCLC in (18)F-FDG PET/MR imaging and (18)F-FDG PET/CT were 0.21 and -5.06. These differences were not statistically significant (P > 0.05). The SUV(mean) and SUV(max) measurements derived from (18)F-FDG PET/CT and (18)F-FDG PET/MR

78 FR 70278 - Automotive Trade Mission to New Delhi, Pune and Chennai, India

Science.gov (United States)

2013-11-25

... expanding automotive market. Many global automotive manufacturing companies such as Ford, GM, BMW, AUDI... India for over five decades. Also known as the Detroit of India, Pune today is one of India's largest... and finished goods, and ease of setting up business have been key drivers of the growth of the auto...

Differentiation between benign phyllodes tumors and fibroadenomas of the breast on MR imaging

International Nuclear Information System (INIS)

Kamitani, Takeshi; Matsuo, Yoshio; Yabuuchi, Hidetake; Fujita, Nobuhiro; Nagao, Michinobu; Kawanami, Satoshi; Yonezawa, Masato; Yamasaki, Yuzo; Tokunaga, Eriko

2014-01-01

Purpose: The purpose of this study was to determine the factors that contribute to the differentiation between phyllodes tumors (PTs) and fibroadenomas (FAs) on MR imaging. Materials and methods: This retrospective study included 19 PTs and 18 FAs with ≥2 cm diameter. The presence or absence of a capsule and internal septum, the extent of lobulation, and the apparent diffusion coefficient (ADC) values were determined. The presence or absence of a cystic component, the time–intensity curve, and the signal intensity on delayed-phase contrast-enhanced T1WI were also evaluated in 31 patients (16 PTs and 17 FAs) who underwent a contrast-enhanced study. Results: Cystic components were seen in 10 of the 16 PTs (63%) and in 4 of the 17 FAs (24%; P = 0.03). The PTs showed strong lobulation more frequently compared to the FAs (14/19 [74%] vs. 7/18 [39%], respectively; P = 0.04). Though there was no significant difference, PT tended to be heterogeneous more frequently on the delayed phase of the contrast-enhanced T1WI compared to the FA (11/16 [69%] vs. 7/17 [41%], respectively). No significant difference was found in the other findings. Conclusions: Although PTs and FAs show similar MR findings, the presence of a cystic component, strong lobulation, and heterogeneity on delayed-phase contrast-enhanced T1WI suggests a PT

Differentiation between benign phyllodes tumors and fibroadenomas of the breast on MR imaging

Energy Technology Data Exchange (ETDEWEB)

Kamitani, Takeshi, E-mail: kamitani@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Matsuo, Yoshio, E-mail: yymatsuo@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Yabuuchi, Hidetake, E-mail: yabuuchi@shs.kyushu-u.ac.jp [Department of Health Sciences, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Fujita, Nobuhiro, E-mail: n-fujita@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Nagao, Michinobu, E-mail: minagao@radiol.med.kyushu-u.ac.jp [Department of Molecular Imaging and Diagnostic Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Kawanami, Satoshi, E-mail: kawanami_01@mac.com [Department of Molecular Imaging and Diagnostic Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Yonezawa, Masato, E-mail: ymasato@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Yamasaki, Yuzo, E-mail: yyama@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Tokunaga, Eriko, E-mail: eriko@surg2.med.kyushu-u.ac.jp [Department of Surgery and Science, Graduate School of Medical Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); and others

2014-08-15

Purpose: The purpose of this study was to determine the factors that contribute to the differentiation between phyllodes tumors (PTs) and fibroadenomas (FAs) on MR imaging. Materials and methods: This retrospective study included 19 PTs and 18 FAs with ≥2 cm diameter. The presence or absence of a capsule and internal septum, the extent of lobulation, and the apparent diffusion coefficient (ADC) values were determined. The presence or absence of a cystic component, the time–intensity curve, and the signal intensity on delayed-phase contrast-enhanced T1WI were also evaluated in 31 patients (16 PTs and 17 FAs) who underwent a contrast-enhanced study. Results: Cystic components were seen in 10 of the 16 PTs (63%) and in 4 of the 17 FAs (24%; P = 0.03). The PTs showed strong lobulation more frequently compared to the FAs (14/19 [74%] vs. 7/18 [39%], respectively; P = 0.04). Though there was no significant difference, PT tended to be heterogeneous more frequently on the delayed phase of the contrast-enhanced T1WI compared to the FA (11/16 [69%] vs. 7/17 [41%], respectively). No significant difference was found in the other findings. Conclusions: Although PTs and FAs show similar MR findings, the presence of a cystic component, strong lobulation, and heterogeneity on delayed-phase contrast-enhanced T1WI suggests a PT.

MR Imaging in symptomatic osteochondromas

Energy Technology Data Exchange (ETDEWEB)

Kim, Soo Young; Kim, Jee Young; Kim, Sang Heum; Chun, Kyung Ah; Park, Young Ha [Catholic University of Korea, Seoul (Korea, Republic of)

1998-06-01

The purpose of this study is to assess the MR findings of symptomatic osteochondromas. We evaluated 31 patients who between July, 1994 and May, 1997 underwent MR imaging for symptomatic osteochondroma. Fourteen were males and 17 were females, and their ages ranged from 8 to 49 (mean, 23) years. Using T1WI, T2WI and gadolinium-DTPA-enhanced T1WI, images were analysed according to signal intensity in the osseous component of the osteochondroma, thickness of the cartilage cap, and associated change in surrounding soft tissue. Clinical manifestation included a palpable mass or tendency to grow (n=22) and pain on movement (n=9). Complications were of three types : that which followed change in the osseous component of the tumor, associated change in surrounding soft tissue, and malignant transformation. In the osseous component, bone marrow edema or contusion was seen in 21 cases (67.7%), and in two (65%), fracture was observed. In surrounding soft tissue, muscle impingement was seen in 21 cases (67.7%), bursitis was in 7 cases (22.6 %), tenosynovitis in seven (22.6 %), and vascular compression in five (16.1 %). In three cases (9.7%), transformation to chondrosarcoma had occurred; two of these were derived from osteochondromatosis and one from a single osteochondroma. The thickness of the cartilage cap was as follow : < 5 mm (n=16), 5-10 mm (n=12), and > 10 mm (n=3). In patients with symptomatic osteochondroma, MR imaging is useful for detecting both complications and malignant transformation. (author). 21 refs., 1 tab., 6 figs.

INTEGRATED AUTOMOTIVE MANUFACTURING SUPPLY

Directory of Open Access Journals (Sweden)

P.J.S. Van Dyk

2012-01-01

Full Text Available <p>ENGLISH ABSTRACT: Supply planning and traffic flow planning are major activities in the automotive manufacturing environment worldwide. Traditionally, the impact of supply planning strategies on plant traffic is rarely considered. This paper describes the development of a Decision Support System (DSS that will assist automotive manufacturers to analyse the effect of supply planning decisions on plant traffic during the supply planning phase of their logistics planning process. In essence, this DSS consists of a Supply Medium Decision Support Tool (SMDST (an interactive MS-Excel model with Visual Basic interfacing and a traffic flow simulation model tool (using eMPlant simulation software.p>>AFRIKAANSE OPSOMMING: Verskaffingsbeplanning en verkeersvloeibeplanning is belangrike aktiwiteite in die motorvervaardigingsbedryf wêreldwyd. Tradisioneel word die uitwerking van verskaffings-beplanningsstrategië op aanlegverkeer selde in ag geneem. Hierdie artikel beskryf die ontwikkeling van ’n Besluitnemings Ondersteuningstelsel (DSS wat motorvervaardigers sal ondersteun in die analise van die effek van verskaffingsbeplanningbesluite op aanlegverkeer tydens die verskaffingsbeplanningsfase van hulle logistieke beplanningsproses. Hierdie DSS bestaan hoofsaaklik uit ’n Verskaffings-vervoermiddel Besluitnemingshulpmiddel (SMDST (’n interaktiewe MS-Excel model met “Visual Basic” koppelling asook ’n simulasiemodel van verkeersvloei (met eM-Plant simulasiesagteware.p>

Factors affecting variability in the urinary biomarker 1,6-hexamethylene diamine in workers exposed to 1,6-hexamethylene diisocyanate.

Science.gov (United States)

Gaines, Linda G T; Fent, Kenneth W; Flack, Sheila L; Thomasen, Jennifer M; Whittaker, Stephen G; Nylander-French, Leena A

2011-01-01

Although urinary 1,6-hexamethylene diamine (HDA) is a useful biomarker of exposure to 1,6-hexamethylene diisocyanate (HDI), a large degree of unexplained intra- and inter-individual variability exists between estimated HDI exposure and urine HDA levels. We investigated the effect of individual and workplace factors on urine HDA levels using quantitative dermal and inhalation exposure data derived from a survey of automotive spray painters exposed to HDI. Painters' dermal and breathing-zone HDI-exposures were monitored over an entire workday for up to three separate workdays, spaced approximately one month apart. One urine sample was collected before the start of work with HDI-containing paints, and multiple samples were collected throughout the workday. Using mixed effects multiple linear regression modeling, coverall use resulted in significantly lower HDA levels (p = 0.12), and weekday contributed to significant variability in HDA levels (p = 0.056). We also investigated differences in urine HDA levels stratified by dichotomous and classification covariates using analysis of variance. Use of coveralls (p = 0.05), respirator type worn (p = 0.06), smoker status (p = 0.12), paint-booth type (p = 0.02), and more than one painter at the shop (p = 0.10) were all found to significantly affect urine HDA levels adjusted for creatinine concentration. Coverall use remained significant (p = 0.10), even after adjusting for respirator type. These results indicate that the variation in urine HDA level is mainly due to workplace factors and that appropriate dermal and inhalation protection is required to prevent HDI exposure.

Space qualification of an automotive microcontroller for the DREAMS-P/H pressure and humidity instrument on board the ExoMars 2016 Schiaparelli lander

Science.gov (United States)

Nikkanen, T.; Schmidt, W.; Harri, A.-M.; Genzer, M.; Hieta, M.; Haukka, H.; Kemppinen, O.

2015-10-01

Finnish Meteorological Institute (FMI) has developed a novel kind of pressure and humidity instrument for the Schiaparelli Mars lander, which is a part of the ExoMars 2016 mission of the European Space Agency (ESA) [1]. The DREAMS-P pressure instrument and DREAMS-H humidity instrument are part of the DREAMS science package on board the lander. DREAMS-P (seen in Fig. 1 and DREAMS-H were evolved from earlier planetary pressure and humidity instrument designs by FMI with a completely redesigned control and data unit. Instead of using the conventional approach of utilizing a space grade processor component, a commercial off the shelf microcontroller was selected for handling the pressure and humidity measurements. The new controller is based on the Freescale MC9S12XEP100 16-bit automotive microcontroller. Coordinated by FMI, a batch of these microcontroller units (MCUs) went through a custom qualification process in order to accept the component for spaceflight on board a Mars lander.

Design of lightweight multi-material automotive bodies using new material performance indices of thin-walled beams for the material selection with crashworthiness consideration

International Nuclear Information System (INIS)

Cui, Xintao; Zhang, Hongwei; Wang, Shuxin; Zhang, Lianhong; Ko, Jeonghan

2011-01-01

Currently, automotive bodies are constructed usually using a single material, e.g. steel or aluminum. Compared to single-material automotive bodies, multi-material automotive bodies allow optimal material selection in each structural component for higher product performance and lower cost. This paper presents novel material performance indices and procedures developed to guide systematic material selection for multi-material automotive bodies. These new indices enable to characterize the crashworthiness performance of complex-shaped thin-walled beams in multi-material automotive bodies according to material types. This paper also illustrates the application of these performance indices and procedures by designing a lightweight multi-material automotive body. These procedures will help to design a lightweight and affordable body favored by the automotive industry, thus to reduce fuel consumption and greenhouse gas emissions.

Body diffusion-weighted MR imaging of uterine endometrial cancer: Is it helpful in the detection of cancer in nonenhanced MR imaging?

International Nuclear Information System (INIS)

Inada, Yuki; Matsuki, Mitsuru; Nakai, Go; Tatsugami, Fuminari; Tanikake, Masato; Narabayashi, Isamu; Yamada, Takashi; Tsuji, Motomu

2009-01-01

Objective: In this study, the authors discussed the feasibility and value of diffusion-weighted (DW) MR imaging in the detection of uterine endometrial cancer in addition to conventional nonenhanced MR images. Methods and materials: DW images of endometrial cancer in 23 patients were examined by using a 1.5-T MR scanner. This study investigated whether or not DW images offer additional incremental value to conventional nonenhanced MR imaging in comparison with histopathological results. Moreover, the apparent diffusion coefficient (ADC) values were measured in the regions of interest within the endometrial cancer and compared with those of normal endometrium and myometrium in 31 volunteers, leiomyoma in 14 patients and adenomyosis in 10 patients. The Wilcoxon rank sum test was used, with a p -3 mm 2 /s, which was significantly lower than those of the normal endometrium, myometrium, leiomyoma and adenomyosis (p < 0.05). Conclusion: DW imaging can be helpful in the detection of uterine endometrial cancer in nonenhanced MR imaging.

Supply chain management problems at South African automotive ...

African Journals Online (AJOL)

competition in global markets, the introduction of products with shorter life cycles, ... employees in the domestic automotive industry has declined, with 16 000 job .... integrates supply and demand management across companies” (Council for .... across the supply chain so that the enterprise can improve performance by ...

46 CFR 90.10-16 - Industrial vessel.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Industrial vessel. 90.10-16 Section 90.10-16 Shipping... PROVISIONS Definition of Terms Used in This Subchapter § 90.10-16 Industrial vessel. This term means every vessel which by reason of its special outfit, purpose, design, or function engages in certain industrial...

{sup 31}P-MR spectroscopy of the brain in patients with anorexia nervosa: characteristic differences in the spectra between patients and healthy control subjects; {sup 31}P-MRS des Hirns bei Anorexia nervosa: charakteristische Unterschiede in den Spektren von Patienten und gesunden Vergleichspersonen

Energy Technology Data Exchange (ETDEWEB)

Rzanny, R.; Reichenbach, J.R.; Mentzel, H.J.; Pfleiderer, S.O.R.; Kaiser, W.A. [Inst. fuer Diagnostische und Interventionelle Radiologie, Klinikum der Friedrich-Schiller-Univ. Jena (Germany); Freesmeyer, D.; Klemm, S.; Gerhard, U.J.; Blanz, B. [Klinik fuer Kinder- und Jugendpsychiatrie, Klinikum der Friedrich-Schiller-Univ. Jena (Germany)

2003-01-01

Purpose: To investigate whether {sup 31}P-MR spectroscopy can detect reduced concentrations of high-energy phosphates, like PCr and NTP, caused by decreased metabolic activity in the brain of patients with anorexia nervosa (AN) and, furthermore, whether any impairment of the cerebral membrane metabolism can be derived from the spectra. Material and Methods: 10 female patients, age range 12 - 20 years and mean BMI (body mass index) of 14.8 {+-} 1.6 kg/m{sup 2}, with clinically diagnosed AN (ICD-10, F50.0) and 10 healthy control subjects, age range 12 - 21 years and mean BMI 19.0 {+-} 2.1 kg/m{sup 2}, without nutritional disturbances: were investigated. {sup 31}P-MR spectroscopy was performed with a 1.5 T MRI unit using single volume selection in the frontal/prefrontal region of brain. Relative metabolic concentrations were quantified by normalizing the peak areas of the metabolites with the total area of the complete phosphorous spectrum, P{sub tot}, as well as with the peak area of β-NTP. Results: Significant differences between the two groups were observed for the metabolic ratios PDE/P{sub tot}, PDE/β-NTP and {alpha}-NTP/P{sub tot} which were lower in the patient group except for {alpha}-NTP/P{sub tot}. These ratios also revealed a statistically significant correlation with the BMI (r{sub PDE/Ptot} = 0.747, r{sub PDE/β-NTP} = 0.57, r{sub {alpha}}{sub -NTP/Ptot} = -0.56; p {<=} 0.1). Reduced relative concentrations of PCr/P{sub tot}, β-NTP/P{sub tot} or Pi/P{sub tot} were not encountered. Conclusion: The lowered PDE/P{sub tot} ratio for patients with AN and its correlation with BMI suggests that decreased BMI induces compositional changes of the phospholipids in the brain, which decrease the fraction of mobile phospholipids. (orig.) [German] Problemstellung: Das Ziel dieser Studie war es zu untersuchen, ob mit Hilfe der {sup 31}P-MR-Spektroskopie ({sup 31}P-MRS) im Gehirn von Patienten mit Anorexia nervosa (AN) verringerte Konzentrationen an

The experimental reactor Osiris and the nuclear fuel technology for the P.W.R. reactors

International Nuclear Information System (INIS)

Lestiboudois, G.; Contenson, G. de; Genthon, J.P.; Molvault, M.; Roche, M.

1977-01-01

The possibility of employing research reactors to study and to improve the nuclear fuel of the power reactors is presented. Measurements of temperature, pressure, stresses, thermal balance, gamma spectrometry and neutron radiography, allow the study of fuel densification, the influence of the initial filling pressure on the fission gas release and the gadolinium efficiency evolution. The solutions of the problems of failed element detection, power increase, remote handling, are presented [fr

Comparison of MR-based attenuation correction and CT-based attenuation correction of whole-body PET/MR imaging

Energy Technology Data Exchange (ETDEWEB)

Izquierdo-Garcia, David [Mount Sinai School of Medicine, Translational and Molecular Imaging Institute, New York, NY (United States); Department of Radiology, Massachusetts General Hospital and Harvard Medical School, Athinoula A. Martinos Center for Biomedical Imaging, Charlestown, MA (United States); Sawiak, Stephen J. [University of Cambridge, Wolfson Brain Imaging Centre, Cambridge (United Kingdom); Knesaurek, Karin; Machac, Joseph [Mount Sinai School of Medicine, Division of Nuclear Medicine, Department of Radiology, New York, NY (United States); Narula, Jagat [Mount Sinai School of Medicine, Department of Cardiology, Zena and Michael A. Weiner Cardiovascular Institute and Marie-Josee and Henry R. Kravis Cardiovascular Health Center, New York, NY (United States); Fuster, Valentin [Mount Sinai School of Medicine, Department of Cardiology, Zena and Michael A. Weiner Cardiovascular Institute and Marie-Josee and Henry R. Kravis Cardiovascular Health Center, New York, NY (United States); The Centro Nacional de Investigaciones Cardiovasculares (CNIC), Madrid (Spain); Fayad, Zahi A. [Mount Sinai School of Medicine, Translational and Molecular Imaging Institute, New York, NY (United States); Mount Sinai School of Medicine, Department of Cardiology, Zena and Michael A. Weiner Cardiovascular Institute and Marie-Josee and Henry R. Kravis Cardiovascular Health Center, New York, NY (United States); Mount Sinai School of Medicine, Department of Radiology, New York, NY (United States)

2014-08-15

The objective of this study was to evaluate the performance of the built-in MR-based attenuation correction (MRAC) included in the combined whole-body Ingenuity TF PET/MR scanner and compare it to the performance of CT-based attenuation correction (CTAC) as the gold standard. Included in the study were 26 patients who underwent clinical whole-body FDG PET/CT imaging and subsequently PET/MR imaging (mean delay 100 min). Patients were separated into two groups: the alpha group (14 patients) without MR coils during PET/MR imaging and the beta group (12 patients) with MR coils present (neurovascular, spine, cardiac and torso coils). All images were coregistered to the same space (PET/MR). The two PET images from PET/MR reconstructed using MRAC and CTAC were compared by voxel-based and region-based methods (with ten regions of interest, ROIs). Lesions were also compared by an experienced clinician. Body mass index and lung density showed significant differences between the alpha and beta groups. Right and left lung densities were also significantly different within each group. The percentage differences in uptake values using MRAC in relation to those using CTAC were greater in the beta group than in the alpha group (alpha group -0.2 ± 33.6 %, R{sup 2} = 0.98, p < 0.001; beta group 10.31 ± 69.86 %, R{sup 2} = 0.97, p < 0.001). In comparison to CTAC, MRAC led to underestimation of the PET values by less than 10 % on average, although some ROIs and lesions did differ by more (including the spine, lung and heart). The beta group (imaged with coils present) showed increased overall PET quantification as well as increased variability compared to the alpha group (imaged without coils). PET data reconstructed with MRAC and CTAC showed some differences, mostly in relation to air pockets, metallic implants and attenuation differences in large bone areas (such as the pelvis and spine) due to the segmentation limitation of the MRAC method. (orig.)

Pratol, an O-Methylated Flavone, Induces Melanogenesis in B16F10 Melanoma Cells via p-p38 and p-JNK Upregulation

Directory of Open Access Journals (Sweden)

You Chul Chung

2017-10-01

Full Text Available Tyrosinase is the rate-limiting enzyme critical for melanin synthesis. It controls pigmentation in the skin. Activation of tyrosinase is currently the most common approach in the development of tanning and haircare products. Pratol is a 7-hydroxy-4-methoxyflavone found in Trifolium pratense. In this study, we investigated the effects of pratol on melanogenesis. We also studied the mechanism of action of pratol in B16F10 mouse melanoma cells. The cells were treated with various concentrations (6.25, 12.5, 25, and 50 μM of pratol to observe its effects. The results showed that pratol significantly increased melanin content and tyrosinase activity in the cells without being cytotoxic. In addition, pratol strongly increased the expression of tyrosinase and tyrosinase-related protein-1 and 2 by enhancing the expression of microphthalmia-associated transcription factor. Furthermore, pratol stimulated melanogenesis via the phosphorylation of p38, c-Jun N-terminal kinases (JNK, and extracellular signal–regulated kinase (ERK. The findings from an assay searching for the inhibitor revealed that SB203580 (a specific p38 inhibitor or SP600125 (a p-JNK inhibitor attenuated pratol-induced cellular tyrosinase activity whereas PD98059 (an ERK inhibitor did not. Additionally, pratol interfered with the phosphorylation of p-AKT. We also found that pratol-induced melanogenesis was reversed by H89, which is a specific protein kinase A inhibitor. The results suggest that, owing to its multi-functional properties, pratol may be a potential tanning agent or a therapeutic agent for hair depigmentation in the cosmetic industry.

MR-guided facet joint injection therapy using an open 1.0-T MRI system: an outcome study

International Nuclear Information System (INIS)

Freyhardt, Patrick; Bucourt, Maximilian de; Maurer, Martin; Renz, Diane; Gebauer, Bernhard; Hamm, Bernd; Streitparth, Florian; Hartwig, Tony; Teichgraeber, Ulf K.M.

2013-01-01

To evaluate the accuracy, safety and efficacy of magnetic resonance imaging (MRI)-guided facet joint injection therapy using a 1.0-T open MRI. One hundred and sixty-six facet joint blocks in 45 patients with lower back pain were performed under MR fluoroscopic guidance using a proton-density-weighted turbo-spin-echo sequence. An in-room monitor, wireless MR-mouse for operator-controlled multiplanar navigation, a flexible surface coil and MR-compatible 20-G needle were used. Clinical outcome was evaluated by questionnaire before intervention and after 1 week, 3, 6 and 12 months using a numerical visual analogue scale (VAS). All facet joint blocks were considered technically successful with distribution of the injectant within and/or around the targeted facet joint. No major complications occurred. The final outcome analysis included 38 patients. An immediate effect was reported by 63 % of the patients. A positive mid-/long-term effect was seen in 13 patients (34 %) after 6 months and in 9 patients (24 %) after 12 months. Mean VAS was reduced from 7.1 ± 1.7 (baseline) to 3.5 ± 2.2, 4.1 ± 3.0, 3.8 ± 2.9 and 4.6 ± 2.9 at 1 week, 3, 6 and 12 months (P < 0.01). MR-guided facet joint injection therapy of the lumbosacral spine is accurate, safe and efficient in the symptomatic treatment of lower back pain. (orig.)

MR angiography, MR imaging and proton MR spectroscopy in-vivo assessment of skeletal muscle ischemia in diabetic rats.

Directory of Open Access Journals (Sweden)

Stefano Delli Pizzi

Full Text Available To prospectively evaluate the feasibility of using magnetic resonance (MR techniques for in-vivo assessing a rat diabetic model of limb ischemia. Unilateral hind limb ischemia was induced by ligation of the iliac-femoral artery in male streptozotocin-treated and non-diabetic control rats. Four weeks after ligation, rats underwent MR Angiography (MRA, T(1-weighted and Short Time Inversion Recovery (STIR sequences and muscle Proton MR Spectroscopy ((1H-MRS on both hind limbs. After MR examinations, immunoblotting and immunofluorescence analysis were performed. MRA showed a signal void due to flow discontinuation distal to the artery ligation. T(1-weighted and STIR images showed, respectively, the presence of tissue swelling (p = 0.018 for non-diabetic; p = 0.027 for diabetic rats and signal hyperintensity in tissue affected by occlusion. Mean total creatine/water for the occluded limb was significantly lower than for the non-occluded limbs in both non-diabetic (5.46×10(-4 vs 1.14×10(-3, p = 0.028 and diabetic rats (1.37×10(-4 vs 1.10×10(-3; p = 0.018. MR Imaging and (1H-MRS changes were more pronounced in diabetic than in non-diabetic occluded limbs (p = 0.032. MR findings were confirmed by using histological findings. Combined MR techniques can be used to demonstrate the presence of structural and metabolic changes produced by iliac-femoral artery occlusion in rat diabetic model of limb ischemia.

MR images of rupture and leakage of breast implants

International Nuclear Information System (INIS)

Fang Ling; Liu Pengcheng; Huang Rong; Hu Huaxin; Chen Zaizhong; Du Duanming; Liu Hanqiao; Feng Fei

2002-01-01

Objective: To investigate the diagnostic value of magnetic resonance imaging in detecting rupture and leakage of breast implants. Methods: Seventeen cases with breast implants were imaged by MR scanner. 1 normal silicone breast implant outside the body was scanned by MR as an consultative standard. MR images of silicone implants and polypropylene acyl amine implants were classified and analyzed. Results: In 7 cases, 12 single lumen silicone implants were intact, among them 8 were silicone gel-filled implants, 4 were physiological saline-filled implants. 2 physiological saline-filled implants ruptured, among them 1 belonged to intracapsular silicone implant rupture with subsided silicone gel capsule which presented as long T 1 signal and short T 2 signal on MR images; The other belonged to extracapsular silicone implant rapture with physiological saline granule outside breast on MR images. 20 breast implants in 10 cases were injected by polypropylene acyl amine, among them 2 breast implants were intact, 16 breast implants ruptured completely with pieces and nodes of long T 1 signal and long T 2 signal on MR images, 14 of 16 also presented polypropylene acyl amine granule outside breast; 2 breast implants splited inside with linguine sign. Conclusion: The magnetic resonance imaging can make clear the type and the seat of breast implants, the type of rupture of breast implants, and the distribution of leakage material. Therefore magnetic resonance imaging can be an effective guidance for clinical operation and can be an consultative standard for follow-up

T2-weighted MR imaging of the liver: Qualitative and quantitative comparison of SPACE MR imaging with turbo spin-echo MR imaging

Energy Technology Data Exchange (ETDEWEB)

Dohan, Anthony, E-mail: anthony.dohan@lrb.aphp.fr [Department of Body and Interventional Imaging, Hôpital Lariboisière, AP-HP, 2 Rue Ambroise Paré, 75475 Paris Cedex 10 (France); Université Paris-Diderot, Sorbonne Paris Cité, 10 Rue de Verdun, 75010 Paris (France); UMR INSERM 965, Hôpital Lariboisière, 2 Rue Amboise Paré, 75010 Paris (France); Gavini, Jean-Philippe, E-mail: jpgavini@gmail.com [Department of Body and Interventional Imaging, Hôpital Lariboisière, AP-HP, 2 Rue Ambroise Paré, 75475 Paris Cedex 10 (France); Université Paris-Diderot, Sorbonne Paris Cité, 10 Rue de Verdun, 75010 Paris (France); Placé, Vinciane, E-mail: vinciane.place@gmail.com [Department of Body and Interventional Imaging, Hôpital Lariboisière, AP-HP, 2 Rue Ambroise Paré, 75475 Paris Cedex 10 (France); Sebbag, Delphine, E-mail: delphinesebbag@gmail.com [Department of Body and Interventional Imaging, Hôpital Lariboisière, AP-HP, 2 Rue Ambroise Paré, 75475 Paris Cedex 10 (France); Université Paris-Diderot, Sorbonne Paris Cité, 10 Rue de Verdun, 75010 Paris (France); Vignaud, Alexandre, E-mail: alexandre.vignaud@cea.fr [LRMN, Neurospin, CEA-SACLAY, Bâtiment 145, 91 191 Gif-sur-Yvette Cedex (France); and others

2013-11-01

Objective: To qualitatively and quantitatively compare T2-weighted MR imaging of the liver using volumetric spin-echo with sampling perfection with application-optimized contrast using different flip angle evolutions (SPACE) with conventional turbo spin-echo (TSE) sequence for fat-suppressed T2-weighted MR imaging of the liver. Materials and methods: Thirty-three patients with suspected focal liver lesions had SPACE MR imaging and conventional fat-suppressed TSE MR imaging. Images were analyzed quantitatively by measuring the lesion-to-liver contrast-to-noise ratio (CNR), and the signal-to-noise ratio (SNR) of main focal hepatic lesions, hepatic and splenic parenchyma and qualitatively by evaluating the presence of vascular, respiratory motion and cardiac artifacts. Wilcoxon signed rank test was used to search for differences between the two sequences. Results: SPACE MR imaging showed significantly greater CNR for focal liver lesions (median = 22.82) than TSE MR imaging (median = 14.15) (P < .001). No differences were found for SNR of hepatic parenchyma (P = .097), main focal hepatic lesions (P = .35), and splenic parenchyma (P = .25). SPACE sequence showed less artifacts than TSE sequence (vascular, P < .001; respiratory motion, P < .001; cardiac, P < .001) but needed a longer acquisition time (228.4 vs. 162.1 s; P < .001). Conclusion: SPACE MR imaging provides a significantly increased CNR for focal liver lesions and less artifacts by comparison with the conventional TSE sequence. These results should stimulate further clinical studies with a surgical standard of reference to compare the two techniques in terms of sensitivity for malignant lesions.

High CpG island methylation of p16 gene and loss of p16 protein ...

Indian Academy of Sciences (India)

SI-JU GAO

The study subjects consisted of 75 healthy controls and 63 ToF ... Additionally, our analysis suggested that CpG island methylation in p16 promoters in ToF ..... reduced p16 protein expression in lung cancer (Kondo et al. 2006). In this context ..... promoter methylation in gastric carcinogenesis: a meta-analysis. Mol. Biol. Rep.

Reducing greenhouse gas emissions from the Ontario automotive sector

International Nuclear Information System (INIS)

Anon.

1995-11-01

A variety of options to reduce greenhouse gas emissions from the automotive sector in Ontario over the next decade were discussed. Each option was assessed in terms of practicality and implications for implementation. I was concluded that improvements in fuel economy anticipated from advancing technology, with or without new mandated standards, will not be enough to offset the impact of growth in vehicle fleet size and kilometres driven. If the goal is to stabilize greenhouse gas emissions, other measures such as reducing the fleet size and vehicle kilometres travelled and accelerated vehicle retirement (scrappage) programs must be considered. Key constraints on expansion of the alternative fuel fleet were identified. These include: (1) limited availability of an adequate range of alternative fuel vehicles at competitive prices, (2) limited refuelling facility infrastructure in the case of natural gas, limited range and fuel storage capacity for natural gas; (3)current limited fuel ethanol production capacity, and (4) market perceptions of performance, reliability and safety. tabs

Nonsuppressing normal thymus on chemical-shift MR imaging and anterior mediastinal lymphoma. Differentiation with diffusion-weighted MR imaging by using the apparent diffusion coefficient

International Nuclear Information System (INIS)

Priola, Adriano Massimiliano; Priola, Sandro Massimo; Gned, Dario; Veltri, Andrea; Giraudo, Maria Teresa

2018-01-01

To prospectively evaluate usefulness of the apparent diffusion coefficient (ADC) in differentiating anterior mediastinal lymphoma from nonsuppressing normal thymus on chemical-shift MR, and to look at the relationship between patient age and ADC. Seventy-three young subjects (25 men, 48 women; age range, 9-29 years), who underwent chemical-shift MR and diffusion-weighted MR were divided into a normal thymus group (group A, 40 subjects), and a lymphoma group (group B, 33 patients). For group A, all subjects had normal thymus with no suppression on opposed-phase chemical-shift MR. Two readers measured the signal intensity index (SII) and ADC. Differences in SII and ADC between groups were tested using t-test. ADC was correlated with age using Pearson correlation coefficient. Mean SII±standard deviation was 2.7±1.8% for group A and 2.2±2.4% for group B, with no significant difference between groups (P=.270). Mean ADC was 2.48±0.38 x 10 -3 mm 2 /s for group A and 1.24±0.23 x 10 -3 mm 2 /s for group B. A significant difference between groups was found (P<.001), with no overlap in range. Lastly, significant correlation was found between age and ADC (r=0.935, P<.001) in group A. ADC of diffusion-weighted MR is a noninvasive and accurate parameter for differentiating lymphoma from nonsuppressing thymus on chemical-shift MR in young subjects. (orig.)

Automotive mechatronics operational and practical issues

CERN Document Server

Fijalkowski, B T

2011-01-01

This book presents operational and practical issues of automotive mechatronics with special emphasis on the heterogeneous automotive vehicle systems approach, and is intended as a graduate text as well as a reference for scientists and engineers involved in the design of automotive mechatronic control systems. As the complexity of automotive vehicles increases, so does the dearth of high competence, multi-disciplined automotive scientists and engineers. This book provides a discussion into the type of mechatronic control systems found in modern vehicles and the skills required by automotive scientists and engineers working in this environment. Divided into two volumes and five parts, Automotive Mechatronics aims at improving automotive mechatronics education and emphasises the training of students' experimental hands-on abilities, stimulating and promoting experience among high education institutes and produce more automotive mechatronics and automation engineers. The main subject that are treated are: VOLUME...

Preliminary clinical experience using the method of 31P MR spectroscopy in investigations of neuromuscular diseases in children

International Nuclear Information System (INIS)

Hajek, M.; Horska, A.; Grosmanova, A.; Urban, P.; Suchanek, M.; Jirasek, A.

1990-01-01

31 P MR spectroscopy was used to investigate neuromuscular diseases of various origin in 35 patients, mostly children. In devising the procedure of MR examination and of evaluation of results, pattern recognition analysis was used. According to the results of 31 P MR spectroscopy, the patients can be divided into three groups. Group A comprises patients with severe muscular lesions such as Duchenne dystrophy. The second, B group is characterized by milder atrophic changes of muscle fibres. The third group comprises dubious cases. The 31 P MRS method was also used for investigating the development of the disease in time - a decrease in parameter P CR /P i (P CR is an indicator of phosphocreatinine and P i an indicator of inorganic phosphate) corresponds to a deterioration of the clinical condition of patients from group one. In group B fairly stable values of the parameter were observed. An increase in P CR /P i was also observed during administration of Prednisone in a patient with child polymyositis. 3 figs., 3 tabs., 23 refs

In vivo 31P MR spectroscopy of breast tumors: preliminary results

International Nuclear Information System (INIS)

Choe, Bo Young; Kim, Hak Hee; Suh, Tae Suk; Shinn, Kyung Sub; Jung, Sang Seol

1995-01-01

To evaluate the various phosphorus metabolism of breast tumors with use of in vivo phosphorus-31 ( 31 P) MR spectroscopy (MRS). Five patients with breast tumor (benign in two, malignant in three) and three normal healthy volunteers participated in this study. All in vivo 31 P MRS examinations were performed on 1.5T whole-body MRI/MRS system by using a Free Induction Decay (FID) pulse sequence. T1-weighted MR images were used for localization of tumors. Peak areas for each phosphorus metabolite were measured using a Marquart algorithm. Breast carcinoma had a substantially larger phosphomonoester (PME) and a smaller phosphocreatine (PCr) peak intensity than normal breast tissue. This was reflected in the relatively higher PME/PCr ratio of breast carcinomas as well as phosphodiester (PDE)/PCr, inorganic phosphate (Pi)/PCr, and adenosine triphosphate (ATP)/PCr ratios, compared with normal controls. The mean pH value of breast tumor demonstrating the alkaline nature was higher than that of normal controls. Spectral patterns between benign breast disease and normal breast tissue were quite similar, and differentiation was not established. Our preliminary study suggests that in vivo 31 P MRS is a noninvasive examination which may be useful in the early differentiation of malignant breast tumors from normal and benign conditions. However, normal control and benign conditions could not be characterized on the basis of the phosphorus metabolite ratios

75 FR 37733 - Regulation of Fuels and Fuel Additives: Modifications to Renewable Fuel Standard Program

Science.gov (United States)

2010-06-30

... Regulation of Fuels and Fuel Additives: Modifications to Renewable Fuel Standard Program AGENCY... direct final rule to amend the Renewable Fuel Standard program requirements on May 10, 2010. Because EPA... Fuel Standard program requirements, published on May 10, 2010. We stated in that direct final rule that...

Acute interstitial edematous pancreatitis: Findings on non-enhanced MR imaging

Science.gov (United States)

Zhang, Xiao-Ming; Feng, Zhi-Song; Zhao, Qiong-Hui; Xiao, Chun-Ming; Mitchell, Donald G; Shu, Jian; Zeng, Nan-Lin; Xu, Xiao-Xue; Lei, Jun-Yang; Tian, Xiao-Bing

2006-01-01

AIM: To study the appearances of acute interstitial edematous pancreatitis (IEP) on non-enhanced MR imaging. METHODS: A total of 53 patients with IEP diagnosed by clinical features and laboratory findings were underwent MR imaging. MR imaging sequences included fast spoiled gradient echo (FSPGR) fat saturation axial T1-weighted imaging, gradient echo T1-weighted (in phase), single shot fast spin echo (SSFSE) T2-weighted, respiratory triggered (R-T) T2-weighted with fat saturation, and MR cholangiopancreatography. Using the MR severity score index, pancreatitis was graded as mild (0-2 points), moderate (3-6 points) and severe (7-10 points). RESULTS: Among the 53 patients, IEP was graded as mild in 37 patients and as moderate in 16 patients. Forty-seven of 53 (89%) patients had at least one abnormality on MR images. Pancreas was hypointense relative to liver on FSPGR T1-weighted images in 18.9% of patients, and hyperintense in 25% and 30% on SSFSE T2-weighted and R-T T2-weighted images, respectively. The prevalences of the findings of IEP on R-T T2-weighted images were, respectively, 85% for pancreatic fascial plane, 77% for left renal fascial plane, 55% for peripancreatic fat stranding, 42% for right renal fascial plane, 45% for perivascular fluid, 40% for thickened pancreatic lobular septum and 25% for peripancreatic fluid, which were markedly higher than those on in-phase or SSFSE T2-weighted images (P fluid. R-T T2-weighted imaging is more sensitive than in-phase and SSFSE T2-weighted imaging for depicting IEP. PMID:17007053

Automotive electronics design fundamentals

CERN Document Server

Zaman, Najamuz

2015-01-01

This book explains the topology behind automotive electronics architectures and examines how they can be profoundly augmented with embedded controllers. These controllers serve as the core building blocks of today’s vehicle electronics. Rather than simply teaching electrical basics, this unique resource focuses on the fundamental concepts of vehicle electronics architecture, and details the wide variety of Electronic Control Modules (ECMs) that enable the increasingly sophisticated "bells & whistles" of modern designs.  A must-have for automotive design engineers, technicians working in automotive electronics repair centers and students taking automotive electronics courses, this guide bridges the gap between academic instruction and industry practice with clear, concise advice on how to design and optimize automotive electronics with embedded controllers.

10 CFR 16.9 - Hearing.

Science.gov (United States)

2010-01-01

... 10 Energy 1 2010-01-01 2010-01-01 false Hearing. 16.9 Section 16.9 Energy NUCLEAR REGULATORY... § 16.9 Hearing. (a) Request for hearing. (1) An employee shall file a petition for a hearing in... creditor agency, a hearing may be requested by filing a written petition stating why the employee disputes...

The plantar fasciotomy: MR imaging findings in asymptomatic volunteers

Energy Technology Data Exchange (ETDEWEB)

Yu, J.S.; Ashman, C. [Ohio State Univ. Medical Center, Department of Radiology, Columbus, OH (United States); Smith, G.; Kaeding, C. [Ohio State Univ. Medical Center, Department of Surgery, Columbus, OH (United States)

1999-08-01

Objective. To determine the postoperative appearance of the plantar fascia on MR imaging after a fasciotomy has been performed, and to compare the postsurgical appearance of the fascia after an open and endoscopic procedure.< rate at head-abs-p1.lf>Design and patients. Fifteen asymptomatic volunteers (12 women, 3 men; age range 22-49 years, mean age 33 years) with prior fasciotomies for treatment of longstanding plantar fasciitis were studied. Fourteen volunteers had a unilateral release and one volunteer had bilateral releases, allowing for assessment of 16 ankles. Eight fasciotomies were performed through an open incision and eight were performed endoscopically. The average time between surgery and imaging was 24 months (range 11-46 months). The site of surgery was established from the operative reports. Proton density (PD)-weighted and T2-weighted images in three orthogonal planes were obtained on a 1.5-T magnet. In eight studies, T1-weighted sagittal and STIR sagittal images were included. The fascia in each ankle was assessed for morphology and signal intensity. Perifascial soft tissues and bone marrow were assessed for edema. Preoperative MR studies were available in five volunteers.< rate at head-abs-p1.lf>Results. There was no apparent difference in the postoperative appearance of the ankle after an open or endoscopic procedure except for scar formation in the subcutaneous fat which was common after an open procedure (P<0.05). Three ankles had a gap in the fascia (one open, two endoscopic). The plantar fascia measured a mean of 7.0 mm (range 5-10 mm) at the fasciotomy, and 8.3 mm (range 6-12 mm) at the enthesis. At the fasciotomy, 11 of 13 ankles had an indistinct deep contour and 9 of 13 had an indistinct superficial contour. At the enthesis, 13 of 16 ankles had an indistinct deep contour and 6 of 16 had an indistinct superficial contour. Compared with preoperative MR studies there was an average reduction in the fascial thickness at the enthesis of 14

Advanced Automotive Fuels Research, Development, and Commercialization Cluster (OH)

Energy Technology Data Exchange (ETDEWEB)

Linkous, Clovis; Hripko, Michael; Abraham, Martin; Balendiran, Ganesaratnam; Hunter, Allen; Lovelace-Cameron, Sherri; Mette, Howard; Price, Douglas; Walker, Gary; Wang, Ruigang

2013-08-31

Technical aspects of producing alternative fuels that may eventually supplement or replace conventional the petroleum-derived fuels that are presently used in vehicular transportation have been investigated. The work was centered around three projects: 1) deriving butanol as a fuel additive from bacterial action on sugars produced from decomposition of aqueous suspensions of wood cellulose under elevated temperature and pressure; 2) using highly ordered, openly structured molecules known as metal-organic framework (MOF) compounds as adsorbents for gas separations in fuel processing operations; and 3) developing a photocatalytic membrane for solar-driven water decomposition to generate pure hydrogen fuel. Several departments within the STEM College at YSU contributed to the effort: Chemistry, Biology, and Chemical Engineering. In the butanol project, sawdust was blended with water at variable pH and temperature (150 – 250{degrees}C), and heated inside a pressure vessel for specified periods of time. Analysis of the extracts showed a wide variety of compounds, including simple sugars that bacteria are known to thrive upon. Samples of the cellulose hydrolysate were fed to colonies of Clostridium beijerinckii, which are known to convert sugars to a mixture of compounds, principally butanol. While the bacteria were active toward additions of pure sugar solutions, the cellulose extract appeared to inhibit butanol production, and furthermore encouraged the Clostridium to become dormant. Proteomic analysis showed that the bacteria had changed their genetic code to where it was becoming sporulated, i.e., the bacteria were trying to go dormant. This finding may be an opportunity, as it may be possible to genetically engineer bacteria that resist the butanol-driven triggering mechanism to stop further fuel production. Another way of handling the cellulosic hydrolysates was to simply add the enzymes responsible for butanol synthesis to the hydrolytic extract ex-vivo. These

Application of Hybrid IC's to the Automotive Electronics Market in Europe

OpenAIRE

Eckart von Roda

1981-01-01

In the last few years hybrids have been increasingly used in automotive electronics in Europe. With examples from the BOSCH and BLAUPUNKT production range their application in regulators, breakerless ignition modules, electronically-controlled fuel injection systems and car radios is illustrated. The elements and techniques used to assemble the hybrids, and the advantages which can be gained are discussed.

Pattern analysis in MR imaging of muscle diseases

International Nuclear Information System (INIS)

Kaiser, W.A.; Schalke, B.C.G.

1987-01-01

Between March 1984 and March 1987, 161 patients with muscle diseases underwent MR imaging performed with a 1.0-T superconductive magnet. Forty-four had progressive muscular dystrophies, 25 had different types of myositis, 19 had spinal or neural muscular atrophies, 16 had myotonic dystrophy, 22 had metabolic disorders, and 35 had other muscle disease, including muscle tumors, posttraumatic muscular atrophies, and postradiation effects. The advantages of MR imaging are the high sensitivity and soft-tissue contrast, as well as the depiction of typical distribution patterns of affected muscle groups, which can be used in diagnosis, biopsy planning, and design of therapy

Analysis of functional MR imaging patterns in adrenoleukodystrophy

International Nuclear Information System (INIS)

Lou Haiyan; Qi Jianpin; Xia Liming; Wei Hong; Wang Chengyuan; Luo Xiaoping

2005-01-01

Objective: To discuss the parallelism of signals in MR diffusion-weighted imaging (DWI) and metabolic abnormity in proton MR spectroscopy ( 1 HMRS) with pathologic and biochemical changes in adrenoleukodystrophy (ALD). Methods: DWI and 1 HMRS examination were performed in 6 cases with ALD proven by serum VLCFA, comparing ADC and relative ratio values of each metabolite in different regions of lesion with normal white matter. Results: Initial lesions in occipital-parietal lobes showed very low signals on DWI and the highest ADC values (2.400 x 10 -3 mm 2 /s, F=7.31, P=0.003), the ratios of NAA/Cr and NAA/Cho were lower (0.62 ±0.24, F=4.00, P=0.02; 0.32±0.16, F=6.75, P=0.02), and Cho/Cr and Lac/Cr were higher than normal white matter (1.96±0.53, F=3.53, P=0.03; 0.28±0.24, F=3.22, P=0.04). On expanding regions to frontal lobe, the signal became highest and ADC values was lowest [(0.749- 0.752) x 10 -3 mm 2 /s, F=7.31, P=0.003]. The depressed tendency of NAA/Cr and NAA/Cho in adjacent lesion was distinct than that of remote lesion (q 2 =-0.23, P 2 =0.047; q 2 =-0.23, P 2 =0.02). There was no significant difference in the increase of Cho/Cr and Lac/Cr ratios (q 2 =0.34, P 2 =0.19; q 2 =0.11, P 2 =0.17). Conclusion: MRS offers a useful method for dynamic observation of spatio-temporal changes in ALD. ADC values and choline, lactic acid levels increase in obsolete lesions whereas NAA levels decrease distinctly. In expanding lesion, ADC values decrease markedly, while the elevation of Choline and Lactic acid is not significant in adjacent region. NAA levels decrease moderately because of remnant neuron and axon. (authors)

Requirements for future automotive batteries - a snapshot

Science.gov (United States)

Karden, Eckhard; Shinn, Paul; Bostock, Paul; Cunningham, James; Schoultz, Evan; Kok, Daniel

Introduction of new fuel economy, performance, safety, and comfort features in future automobiles will bring up many new, power-hungry electrical systems. As a consequence, demands on automotive batteries will grow substantially, e.g. regarding reliability, energy throughput (shallow-cycle life), charge acceptance, and high-rate partial state-of-charge (HRPSOC) operation. As higher voltage levels are mostly not an economically feasible alternative for the short term, the existing 14 V electrical system will have to fulfil these new demands, utilizing advanced 12 V energy storage devices. The well-established lead-acid battery technology is expected to keep playing a key role in this application. Compared to traditional starting-lighting-ignition (SLI) batteries, significant technological progress has been achieved or can be expected, which improve both performance and service life. System integration of the storage device into the vehicle will become increasingly important. Battery monitoring systems (BMS) are expected to become a commodity, penetrating the automotive volume market from both highly equipped premium cars and dedicated fuel-economy vehicles (e.g. stop/start). Battery monitoring systems will allow for more aggressive battery operating strategies, at the same time improving the reliability of the power supply system. Where a single lead-acid battery cannot fulfil the increasing demands, dual-storage systems may form a cost-efficient extension. They consist either of two lead-acid batteries or of a lead-acid battery plus another storage device.

76 FR 40591 - Coordinating Policies on Automotive Communities and Workers

Science.gov (United States)

2011-07-11

... automakers in 2010 gained market share for the first time since 1995. The automotive supply chain, which... Department of Labor set aside funds for green jobs and job training for high- growth sectors of the economy...

The use of methanol as a fuel for transportation

Energy Technology Data Exchange (ETDEWEB)

Egebaeck, K E [Luleaa Univ. of Technology (Sweden); Walsh, M P [Arlington, VA (United States); Westerholm, R [Stockholm Univ. (Sweden)

1997-06-01

The aim of the project was to collect and report international experiences concerning the use of methanol as an automotive fuel. The method has been to study the literature which covers the subject and most of the information has been collected that way. The project started with a participation in a conference and a visit to people who have been involved in activities concerning the use of automotive alcohols. Car manufacturers, environmental authorities and users of alcohol fuels i.e. representatives of bus companies, were interviewed. The different applications for the use of methanol as an automotive fuel has been described in the report as well as the production of methanol. Some results, mostly in form of emission data and other experiences derived from the use of alcohol fuels, have also been presented. The use of ethanol and methanol has been compared and based on information from engine manufacturers and users of alcohol fueled vehicles there seems to be a preference for the use of ethanol. However, the question `methanol or ethanol` has not been answered as the decision which of the two is to be used seems to depend more on economic factors, such as cost of the production of the fuel etc., than on other factors. 165 refs, 15 figs, 14 tabs

Integrated fuel processor development

International Nuclear Information System (INIS)

Ahmed, S.; Pereira, C.; Lee, S. H. D.; Krumpelt, M.

2001-01-01

The Department of Energy's Office of Advanced Automotive Technologies has been supporting the development of fuel-flexible fuel processors at Argonne National Laboratory. These fuel processors will enable fuel cell vehicles to operate on fuels available through the existing infrastructure. The constraints of on-board space and weight require that these fuel processors be designed to be compact and lightweight, while meeting the performance targets for efficiency and gas quality needed for the fuel cell. This paper discusses the performance of a prototype fuel processor that has been designed and fabricated to operate with liquid fuels, such as gasoline, ethanol, methanol, etc. Rated for a capacity of 10 kWe (one-fifth of that needed for a car), the prototype fuel processor integrates the unit operations (vaporization, heat exchange, etc.) and processes (reforming, water-gas shift, preferential oxidation reactions, etc.) necessary to produce the hydrogen-rich gas (reformate) that will fuel the polymer electrolyte fuel cell stacks. The fuel processor work is being complemented by analytical and fundamental research. With the ultimate objective of meeting on-board fuel processor goals, these studies include: modeling fuel cell systems to identify design and operating features; evaluating alternative fuel processing options; and developing appropriate catalysts and materials. Issues and outstanding challenges that need to be overcome in order to develop practical, on-board devices are discussed

75 FR 27401 - List of Approved Spent Fuel Storage Casks: NUHOMS® HD System Revision 1; Correction

Science.gov (United States)

2010-05-17

... Storage Casks: NUHOMS[reg] HD System Revision 1; Correction AGENCY: Nuclear Regulatory Commission. ACTION... HD spent fuel storage cask system. This action is necessary to correctly specify the effective date... on May 6, 2010 (75 FR 24786), that amends the regulations that govern storage of spent nuclear fuel...

Proton range shift analysis on brain pseudo-CT generated from T1 and T2 MR.

Science.gov (United States)

Pileggi, Giampaolo; Speier, Christoph; Sharp, Gregory C; Izquierdo Garcia, David; Catana, Ciprian; Pursley, Jennifer; Amato, Francesco; Seco, Joao; Spadea, Maria Francesca

2018-05-29

In radiotherapy, MR imaging is only used because it has significantly better soft tissue contrast than CT, but it lacks electron density information needed for dose calculation. This work assesses the feasibility of using pseudo-CT (pCT) generated from T1w/T2w MR for proton treatment planning, where proton range comparisons are performed between standard CT and pCT. MR and CT data from 14 glioblastoma patients were used in this study. The pCT was generated by using conversion libraries obtained from tissue segmentation and anatomical regioning of the T1w/T2w MR. For each patient, a plan consisting of three 18 Gy beams was designed on the pCT, for a total of 42 analyzed beams. The plan was then transferred onto the CT that represented the ground truth. Range shift (RS) between pCT and CT was computed at R 80 over 10 slices. The acceptance threshold for RS was according to clinical guidelines of two institutions. A γ-index test was also performed on the total dose for each patient. Mean absolute error and bias for the pCT were 124 ± 10 and -16 ± 26 Hounsfield Units (HU), respectively. The median and interquartile range of RS was 0.5 and 1.4 mm, with highest absolute value being 4.4 mm. Of the 42 beams, 40 showed RS less than the clinical range margin. The two beams with larger RS were both in the cranio-caudal direction and had segmentation errors due to the partial volume effect, leading to misassignment of the HU. This study showed the feasibility of using T1w and T2w MRI to generate a pCT for proton therapy treatment, thus avoiding the use of a planning CT and allowing better target definition and possibilities for online adaptive therapies. Further improvements of the methodology are still required to improve the conversion from MRI intensities to HUs.

Efficiency Improvement Opportunities for Light-Duty Natural-Gas-Fueled Vehicles

Energy Technology Data Exchange (ETDEWEB)

Staunton, R.H.; Thomas, J.F.

1998-12-01

The purpose of this report is to evaluate and make recommendations concerning technologies that promise to improve the efilciency of compressed natural gas (CNG) light-duty vehicles. Technical targets for CNG automotive technology given in the March 1998 OffIce of Advanced Automotive Technologies research and development plan were used as guidance for this effort. The technical target that necessitates this current study is to validate technologies that enable CNG light vehicles to have at least 10% greater - fuel economy (on a miles per gallon equivalent basis) than equivalent gasoline vehicles by 2006. Other tar- gets important to natural gas (NG) automotive technology and this study are to: (1) increase CNG vehicle range to 380 miles, (2) reduce the incremental vehicle cost (CNG vs gasoline) to $1500, and (3) meet the California ultra low-emission vehicle (ULEV) and Federal Tier 2 emission standards expected to be in effect in 2004.

Status of solid polymer electrolyte fuel cell technology and potential for transportation applications

Science.gov (United States)

McElroy, J. F.; Nuttall, L. J.

The solid polymer electrolyte (SPE) fuel cell represents the first fuel cell technology known to be used operationally. Current activities are mainly related to the development of a space regenerative fuel cell system for energy storage on board space stations, or other large orbiting vehicles and platforms. During 1981, a study was performed to determine the feasibility of using SPE fuel cells for automotive or other vehicular applications, using methanol as the fuel. The results of this study were very encouraging. Details concerning a conceptual automotive fuel cell power plant study are discussed, taking into account also a layout of major components for compact passenger car installation.

MEMS for automotive and aerospace applications

CERN Document Server

Kraft, Michael

2013-01-01

MEMS for automotive and aerospace applications reviews the use of Micro-Electro-Mechanical-Systems (MEMS) in developing solutions to the unique challenges presented by the automotive and aerospace industries.Part one explores MEMS for a variety of automotive applications. The role of MEMS in passenger safety and comfort, sensors for automotive vehicle stability control applications and automotive tire pressure monitoring systems are considered, along with pressure and flow sensors for engine management, and RF MEMS for automotive radar sensors. Part two then goes on to explore MEMS for

Numerical Investigation on the Performance of an Automotive Thermoelectric Generator with Exhaust-Module-Coolant Direct Contact

Science.gov (United States)

Wang, Yiping; Tang, Yulin; Deng, Yadong; Su, Chuqi

2018-06-01

Energy conservation and environmental protection have typically been a concern of research. Researchers have confirmed that in automotive engines, just 12-25% of the fuel energy converts into effective work and 30-40% gets wasted in the form of exhaust. Saidur et al. (Energy Policy 37:3650, 2009) and Hasanuzzaman et al. (Energy 36:233, 2011). It will be significant to enhance fuel availability and decrease environmental pollution if the waste heat in the exhaust could be recovered. Thermoelectric generators (TEGs), which can translate heat into electricity, have become a topic of interest for vehicle exhaust waste heat recovery. In conventional automotive TEGs, the thermoelectric modules (TEMs) are arranged between the exhaust tank and the coolant tank. The TEMs do not contact the hot exhaust and coolant, which leads to low heat transfer efficiency. Moreover, to provide enough packing force to keep good contact with the exhaust tank and the coolant tank, the framework required is so robust that the TEGs become too heavy. Therefore, in current study, an automotive TEG was designed which included one exhaust channel, one coolant channel and several TEMs. In the TEG, the TEMs which contacted the exhaust and coolant directly were inserted into the walls of each coolant channel. To evaluate the performance of the automotive TEG, the flow field and temperature field were computed by computational fluid dynamics (CFD). Based on the temperature distribution obtained by CFD and the performance parameters of the modules, the total power generation was obtained by some proved empirical formulas. Compared with conventional automotive TEGs, the power generation per unit volume exhaust was boosted.

Numerical Investigation on the Performance of an Automotive Thermoelectric Generator with Exhaust-Module-Coolant Direct Contact

Science.gov (United States)

Wang, Yiping; Tang, Yulin; Deng, Yadong; Su, Chuqi

2017-12-01

Energy conservation and environmental protection have typically been a concern of research. Researchers have confirmed that in automotive engines, just 12-25% of the fuel energy converts into effective work and 30-40% gets wasted in the form of exhaust. Saidur et al. (Energy Policy 37:3650, 2009) and Hasanuzzaman et al. (Energy 36:233, 2011). It will be significant to enhance fuel availability and decrease environmental pollution if the waste heat in the exhaust could be recovered. Thermoelectric generators (TEGs), which can translate heat into electricity, have become a topic of interest for vehicle exhaust waste heat recovery. In conventional automotive TEGs, the thermoelectric modules (TEMs) are arranged between the exhaust tank and the coolant tank. The TEMs do not contact the hot exhaust and coolant, which leads to low heat transfer efficiency. Moreover, to provide enough packing force to keep good contact with the exhaust tank and the coolant tank, the framework required is so robust that the TEGs become too heavy. Therefore, in current study, an automotive TEG was designed which included one exhaust channel, one coolant channel and several TEMs. In the TEG, the TEMs which contacted the exhaust and coolant directly were inserted into the walls of each coolant channel. To evaluate the performance of the automotive TEG, the flow field and temperature field were computed by computational fluid dynamics (CFD). Based on the temperature distribution obtained by CFD and the performance parameters of the modules, the total power generation was obtained by some proved empirical formulas. Compared with conventional automotive TEGs, the power generation per unit volume exhaust was boosted.

75 FR 9441 - Lucas-Smith Automotive, Inc.: Potosi, MO; Notice of Negative Determination Regarding Application...

Science.gov (United States)

2010-03-02

... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-71,388] Lucas-Smith Automotive, Inc.: Potosi, MO; Notice of Negative Determination Regarding Application for Reconsideration By...), applicable to workers and former workers of Lucas- Smith Automotive, Inc., Potosi, Missouri (subject firm...

Automotive Control Systems: For Engine, Driveline, and Vehicle

Science.gov (United States)

Kiencke, Uwe; Nielsen, Lars

Advances in automotive control systems continue to enhance safety and comfort and to reduce fuel consumption and emissions. Reflecting the trend to optimization through integrative approaches for engine, driveline, and vehicle control, this valuable book enables control engineers to understand engine and vehicle models necessary for controller design, and also introduces mechanical engineers to vehicle-specific signal processing and automatic control. The emphasis on measurement, comparisons between performance and modeling, and realistic examples derive from the authors' unique industrial experience

MR-guided MR arthrography of the shoulder

International Nuclear Information System (INIS)

Tratting, S.; Breitenseher, M.; Pretterklieber, M.; Kontaxis, G.; Rand, T.; Imhof, H.

1996-01-01

Purpose: To develop an MR-guided technique for joint puncture in MR arthrography of the shoulder and to confirm the intracapsular position of the needle tip by visualization of the flow of contrast media into the joint. Materials and methods: Three unfixed human shoulder joint specimens were examined on a 1.0 T unit. The optimal point of entrance and depth for joint puncture were estimated by means of MR-compatible markers on the skin. Needle orientation and localization of the needle tip (MR-compatible 22-gauge needle) in the shoulder joint were monitored by rapid localizer gradient-echo sequences in two orthogonal planes. To confirm the intracapsular position of the needle tip, diluted gadolinium-DTPA was administered via a long connecting tube and the flow of contrast media into the joint was viewed directly on an LCD screen using real-time MR imaging (local look technique). Results: The MR-compatible markers on the skin allowed determination of the optimal point of entrance and estimation of the depth for joint puncture. Passive visualization of the MR-compatible needle due to spin dephasing and signal loss provided adequate localization of the intra-articular needle tip position in all specimens, although significant artefacts were present on rapid localizer gradient-echo sequences with an increase in width of the apparent needle shaft. Real-time MR imaging of the flow of contrast media was possible using the local look technique and the LCD screen of the MR unit and allowed confirmation of the intracapsular position. Conclusion: MR-guided joint puncture and real-time MR-assisted contrast media application results in improved MR arthrography and may replace conventional fluoroscopic guidance. (orig.) [de

AREVA 10x10 BWR fuel experience feedback and on going upgrading

International Nuclear Information System (INIS)

Lippert, Hans Joachim; Rentmeister, Thomas; Garner, Norman; Tandy, Jay; Mollard, Pierre

2008-01-01

Established with engineering and manufacturing operations in the US and Europe, AREVA NP has been and is supplying nuclear fuel assemblies and associated core components to boiling water reactors worldwide, representing today more than 63 000 fuel assemblies. The evolution of BWR fuel rod arrays from early 6x6 designs to the 10x10 designs first introduced in the mid 1990's yielded significant improvements in thermal mechanical operating limits, critical power level, cold shutdown margin, discharge burnup, as well as other key operational capabilities. Since first delivered in 1992, ATRIUM T M 1 0 fuel assemblies have now been supplied to a total of 32 BWR plants in the US, Europe, and Asia resulting in an operating experience over 20 000 fuel assemblies. This article presents in detail the operational experience consolidated by these more than 20 000 ATRIUM T M 1 0 BWR assemblies already supplied to utilities. Within the different 10x10 fuel assemblies available, the Fuel Assembly design is chosen and tailored to the operating strategies of each reactor. Among them, the latest versions of ATRIUM T M a re ATRIUM T M 1 0XP and ATRIUM T M 1 0XM fuel assemblies which have been delivered to several utilities worldwide. The article details key aspects of ATRIUM T M 1 0 fuel assemblies in terms of reliability and performance. Special attention is paid to key proven features, ULTRAFLOW T M s pacer grids, the use of part length fuel rods (PLFRs) and their geometrical optimization, water channel and load chain, upgraded features available for inclusion with most advanced designs. Regular upgrading of the product has been made possible thanks to a continuous improvement process with the aim of further upgrading BWR fuel assembly performance and reliability. Regarding thermal mechanical behavior of fuel rods, chromia (Cr2O3) doped fuel pellets, described in Reference 1, well illustrate this improvement strategy to reduce fission gas release, increase power thresholds for PCI

Motor fuel demand analysis - applied modelling in the European union

International Nuclear Information System (INIS)

Chorazewiez, S.

1998-01-01

Motor fuel demand in Europe amounts to almost half of petroleum products consumption and to thirty percent of total final energy consumption. This study considers, Firstly, the energy policies of different European countries and the ways in which the consumption of motor gasoline and automotive gas oil has developed. Secondly it provides an abstract of demand models in the energy sector, illustrating their specific characteristics. Then it proposes an economic model of automotive fuel consumption, showing motor gasoline and automotive gas oil separately over a period of thirty years (1960-1993) for five main countries in the European Union. Finally, forecasts of consumption of gasoline and diesel up to the year 2020 are given for different scenarios. (author)

Quantification of hepatic steatosis with T1-independent, T2-corrected MR imaging with spectral modeling of fat: blinded comparison with MR spectroscopy.

Science.gov (United States)

Meisamy, Sina; Hines, Catherine D G; Hamilton, Gavin; Sirlin, Claude B; McKenzie, Charles A; Yu, Huanzhou; Brittain, Jean H; Reeder, Scott B

2011-03-01

To prospectively compare an investigational version of a complex-based chemical shift-based fat fraction magnetic resonance (MR) imaging method with MR spectroscopy for the quantification of hepatic steatosis. This study was approved by the institutional review board and was HIPAA compliant. Written informed consent was obtained before all studies. Fifty-five patients (31 women, 24 men; age range, 24-71 years) were prospectively imaged at 1.5 T with quantitative MR imaging and single-voxel MR spectroscopy, each within a single breath hold. The effects of T2 correction, spectral modeling of fat, and magnitude fitting for eddy current correction on fat quantification with MR imaging were investigated by reconstructing fat fraction images from the same source data with different combinations of error correction. Single-voxel T2-corrected MR spectroscopy was used to measure fat fraction and served as the reference standard. All MR spectroscopy data were postprocessed at a separate institution by an MR physicist who was blinded to MR imaging results. Fat fractions measured with MR imaging and MR spectroscopy were compared statistically to determine the correlation (r(2)), and the slope and intercept as measures of agreement between MR imaging and MR spectroscopy fat fraction measurements, to determine whether MR imaging can help quantify fat, and examine the importance of T2 correction, spectral modeling of fat, and eddy current correction. Two-sided t tests (significance level, P = .05) were used to determine whether estimated slopes and intercepts were significantly different from 1.0 and 0.0, respectively. Sensitivity and specificity for the classification of clinically significant steatosis were evaluated. Overall, there was excellent correlation between MR imaging and MR spectroscopy for all reconstruction combinations. However, agreement was only achieved when T2 correction, spectral modeling of fat, and magnitude fitting for eddy current correction were used (r(2

A de-novo interstitial microduplication involving 2p16.1-p15 and mirroring 2p16.1-p15 microdeletion syndrome: Clinical and molecular analysis.

Science.gov (United States)

Mimouni-Bloch, Aviva; Yeshaya, Josepha; Kahana, Sarit; Maya, Idit; Basel-Vanagaite, Lina

2015-11-01

Microdeletions of various sizes in the 2p16.1-p15 chromosomal region have been grouped together under the 2p16.1-p15 microdeletion syndrome. Children with this syndrome generally share certain features including microcephaly, developmental delay, facial dysmorphism, urogenital and skeletal abnormalities. We present a child with a de-novo interstitial 1665 kb duplication of 2p16.1-p15. Clinical features of this child are distinct from those of children with the 2p16.1-p15 microdeletion syndrome, specifically the head circumference which is within the normal range and mild intellectual disability with absence of autistic behaviors. Microduplications many times bear milder clinical phenotypes in comparison with corresponding microdeletion syndromes. Indeed, as compared to the microdeletion syndrome patients, the 2p16.1-p15 microduplication seems to have a milder cognitive effect and no effect on other body systems. Limited information available in genetic databases about cases with overlapping duplications indicates that they all have abnormal developmental phenotypes. The involvement of genes in this location including BCL11A, USP34 and PEX13, affecting fundamental developmental processes both within and outside the nervous system may explain the clinical features of the individual described in this report. Copyright © 2015 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.

Contrast enhancement pattern in MR imaging of acute cerebral infarction

International Nuclear Information System (INIS)

Kim, Jong Deok; Cho, Mee Young; Lee, Chae Guk; Song, Dong Hoon

1994-01-01

To present the enhancement pattern of acute cerebral or cerebellar cortical infarctions aged 1-3 days on MR. Contrast-enhanced MR images of 26 patients with acute cerebral or cerebellar ischemic events were retrospectively reviewed. MR was performed within 3 days after ictus. Contrast enhancement in the area of infarction was observed in 61.5% (16/26) on MR. Of these 50% (13/26) showed non-parenchymal enhancement (NPE) representing either vascular or leptomeningeal enhancement, 7.7% (2/26) showed parenchymal enhancement (PE), and 2.8% (1/26) showed both NPE and PE. The earliest enhancement was seen in images obtained 12 hours after the onset of symptoms and appeared as NPE. One patient showed NPE without apparent high signal intensity at the corresponding area on T2-weighted images. In 38.5% (10/26), there was no enhancement. Contrast-enhanced MR imaging may be needed in acute ischemic infarction, because NPE may be seen as the earliest MR finding of acute cortical infraction aged 1-3 days

Contrast enhancement pattern in MR imaging of acute cerebral infarction

Energy Technology Data Exchange (ETDEWEB)

Kim, Jong Deok; Cho, Mee Young; Lee, Chae Guk; Song, Dong Hoon [Inje University College of Medicine, Pusan (Korea, Republic of)

1994-08-15

To present the enhancement pattern of acute cerebral or cerebellar cortical infarctions aged 1-3 days on MR. Contrast-enhanced MR images of 26 patients with acute cerebral or cerebellar ischemic events were retrospectively reviewed. MR was performed within 3 days after ictus. Contrast enhancement in the area of infarction was observed in 61.5% (16/26) on MR. Of these 50% (13/26) showed non-parenchymal enhancement (NPE) representing either vascular or leptomeningeal enhancement, 7.7% (2/26) showed parenchymal enhancement (PE), and 2.8% (1/26) showed both NPE and PE. The earliest enhancement was seen in images obtained 12 hours after the onset of symptoms and appeared as NPE. One patient showed NPE without apparent high signal intensity at the corresponding area on T2-weighted images. In 38.5% (10/26), there was no enhancement. Contrast-enhanced MR imaging may be needed in acute ischemic infarction, because NPE may be seen as the earliest MR finding of acute cortical infraction aged 1-3 days.

MR of experimental cerebral ischemia

International Nuclear Information System (INIS)

DeLaPaz, R.; Steinberg, G.; Rocklage, S.; Glover, G.H.

1990-01-01

This paper reports on MR imaging of cerebral ischemia and treatment with N-methyl-D-aspartate (NMDA) antagonists in an animal model. Forty-four New Zealand white rabbits underwent 1-hour transorbital ICA-MCA-ACA occlusion and pretreatment or immediate posttreatment with systemic dextromethorphan (DM, n = 14), dextrorphan (DX, n = 14), or normal saline (NS, n = 16). Serial MR studies (1.5 T) were performed 1--6 hours after occlusion with T1- and T2-weighted spinecho, IVIM (b = 1,352), gradient recalled acquisition in a steady-state, and chemical shift sequences (for magnetic susceptibility, T2* and T2') and DyDTPA-BMA intravenous contrast material (Salutar). Spatial correlation between MR findings, histologic findings (ischemic neuronal damage), and regional cerebral blood flow (microspheres) was done

A life-cycle perspective on automotive fuel cells

International Nuclear Information System (INIS)

Simons, Andrew; Bauer, Christian

2015-01-01

Highlights: • Individual inventories for each fuel cell system component, current and future. • Environmental and human health burdens from fuel cell production and end-of-life. • Comparison passenger transport in fuel cell and conventional vehicles. • Fuel cell can be more critical to overall burdens than hydrogen production. • Fuel cell developments require radical but possible changes to reduce burdens. - Abstract: The production and end-of-life (EoL) processes for current and future proton exchange membrane fuel cell (PEMFC) systems for road passenger vehicle applications were analysed and quantified in the form of life cycle inventories. The current PEMFC technology is characterised by highly sensitive operating conditions and a high system mass. For each core component of PEMFC there are a range of materials under development and the research aimed to identify those considered realistic for a 2020 future scenario and according to commercial goals of achieving higher performance, increased power density, greater stability and a marked reduction of costs. End-of-life scenarios were developed in consideration of the materials at the focus of recovery efforts. The life cycle impact assessment (LCIA) addressed the production and EoL of the fuel cell systems with inclusion of a sensitivity analysis to assess influences on the results from the key fuel cell parameters. The second part to the LCIA assessed the environmental and human health burdens from passenger transport in a fuel cell vehicle (FCV) with comparison between the 2012 and 2020 fuel cell scenarios and referenced to an internal combustion engine vehicle (ICEV) of Euro5 emission standard. It was seen that whilst the drivetrain (and therefore the fuel cell system) is a major contributor to the emissions in all the indicators shown, the hydrogen use (and therefore the efficiency of the fuel cell system and the method of hydrogen production) can have a far greater influence on the environmental

Dual-fuelling of a direct-injection automotive diesel engine by diesel and compressed natural gas

International Nuclear Information System (INIS)

Pirouzpanah, V.; Mohammadi Kosha, A.; Mosseibi, A.; Moshirabadi, J.; Gangi, A.; Moghadaspour, M.

2000-01-01

Application of Compressed Natural Gas in diesel engines has always been important, especially in the field of automotive engineering. This is due to easy accessibility, better mixing quality and good combustion characteristics of the Compressed Natural Gas fuel. In this study the application of Compressed Natural Gas fuel along with diesel oil in a heavy duty direct-injection automotive diesel engine is experimentally investigated. In order to convert a diesel engine into a diesel-gas one, the so called m ixed diesel-gas a pproach has been used and for this purpose a carbureted Compressed Natural Gas fuel system has been designed and manufactured. For controlling quantity of Compressed Natural Gas, the gas valve is linked to the diesel fuel injection system by means of a set of rods. Then, the dual-fuel system is adjusted so that, at full load conditions, the quantity of diesel fuel is reduced to 20% and 80% of its equivalent energy is substituted by Compressed Natural Gas fuel. Also injection pressure of pilot jet is increased by 11.4%. Performance and emission tests are conducted under variation of load and speed on both diesel and diesel-gas engines. Results show that, with equal power and torque, the diesel-gas engine has the potential to improve overall engine performance and emission. For example, at rated power and speed, fuel economy increases by 5.48%, the amount of smoke decreases by 78%, amount of CO decreases by 64.3% and mean exhaust gas temperature decreases by 6.4%

The fuel cell; La pile a combustible

Energy Technology Data Exchange (ETDEWEB)

Boursin, P.

2005-07-01

This document is an exhaustive review of the history of fuel cells from 1802 to 2004. It focusses mainly on the automotive applications and supplies many technical details about each prototype of fuel cell and/or vehicle. (J.S.)

Usefulness of breath-hold cardiac cine MR imaging with a middle field MRI system

Energy Technology Data Exchange (ETDEWEB)

Matsumura, Kentaro; Sato, Kiyoto; Aono, Masaki; Inoshita, Kenji; Utsumi, Naoko [Kagawa Inoshita Hospital, Ohnohara (Japan)

1999-07-01

To assess the accuracy of contrast-enhanced, single breath-hold cine MR imaging in calculating left ventricular volume and ejection fraction, we compared MR measurements with those obtained by using cine ventriculography in 60 patients. Fast cine MR images were acquired with a middle field MR system (0.5 T). A breath-hold single slice multi-phase fast gradient-echo (Fast Card) sequence was used to obtain fast cine MR images with the following parameters; TR of 16 ms, TE of 3 ms, flip angle of 30 degree, matrix elements of 256 x 128, view per segment of 6, field of view of 350 x 260 mm and one excitation. Left ventricular end-diastolic volume and ejection fraction obtained with contrast-enhanced Fast Card correlated well with those obtained with cine ventriculography (end-diastolic volume, y=1.00x+14.0, r=0.904, p<0.001; ejection fraction, y=0.961x+2.8, r=0.936, p<0.001). Our results show that contrast enhanced breath-hold cardiac cine MR imaging on horizontal long-axis view using a middle field MR system is an accurate method for evaluating left ventricular volume and ejection fraction. (author)

The role of human papillomavirus in p16-positive oral cancers.

Science.gov (United States)

Belobrov, Simone; Cornall, Alyssa M; Young, Richard J; Koo, Kendrick; Angel, Christopher; Wiesenfeld, David; Rischin, Danny; Garland, Suzanne M; McCullough, Michael

2018-01-01

The aim of this study was to identify the presence and frequency of human papillomavirus (HPV) nucleic acid in p16-positive oral squamous cell carcinomas (OSCCs), to assess whether the virus was transcriptionally active and to assess the utility of p16 overexpression as a surrogate marker for HPV in OSCC. Forty-six OSCC patients treated between 2007 and 2011 with available formalin-fixed paraffin-embedded (FFPE) specimens were included. Twenty-three patients were positive for p16 by immunohistochemistry (IHC) and these were matched with 23 patients with p16-negative tumours. Laser capture microdissection of the FFPE OSCC tissues was undertaken to isolate invasive tumour tissue. DNA was extracted and tested for high-risk HPV types using a PCR-ELISA method based on the L1 SPF10 consensus primers, and a real-time PCR method targeting HPV-16 and HPV-18 E6 region. Genotyping of HPV-positive cases was performed using a reverse line blot hybridization assay (Inno-LiPA). RNAScope ® (a chromogenic RNA in situ hybridization assay) was utilized to detect E6/E7 mRNA of known high-risk HPV types for detection of transcriptionally active virus. HPV DNA was found in 3 OSCC cases, all of which were p16 IHC-positive. Two cases were genotyped as HPV-16 and one as HPV-33. Only one of the HPV-16 cases was confirmed to harbour transcriptionally active virus via HPV RNA ISH. We have shown that the presence of transcriptionally active HPV rarely occurs in OSCC and that p16 is not an appropriate surrogate marker for HPV in OSCC cases. We propose that non-viral mechanisms are responsible for the majority of IHC p16 overexpression in OSCC. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Fast automotive diesel exhaust measurement using quantum cascade lasers

Science.gov (United States)

Herbst, J.; Brunner, R.; Lambrecht, A.

2013-12-01

Step by step, US and European legislations enforce the further reduction of atmospheric pollution caused by automotive exhaust emissions. This is pushing automotive development worldwide. Fuel efficient diesel engines with SCRtechnology can impede NO2-emission by reduction with NH3 down to the ppm range. To meet the very low emission limits of the Euro6 resp. US NLEV (National Low Emission Vehicle) regulations, automotive manufacturers have to optimize continuously all phases of engine operation and corresponding catalytic converters. Especially nonstationary operation holds a high potential for optimizing gasoline consumption and further reducing of pollutant emissions. Test equipment has to cope with demanding sensitivity and speed requirements. In the past Fraunhofer IPM has developed a fast emission analyzer called DEGAS (Dynamic Exhaust Gas Analyzer System), based on cryogenically cooled lead salt lasers. These systems have been used at Volkswagen AG`s test benches for a decade. Recently, IPM has developed DEGAS-Next which is based on cw quantum cascade lasers and thermoelectrically cooled detectors. The system is capable to measure three gas components (i.e. NO, NO2, NH3) in two channels with a time resolution of 20 ms and 1 ppm detection limits. We shall present test data and a comparison with fast FTIR measurements.

Hydrogen system (hydrogen fuels feasibility)

International Nuclear Information System (INIS)

Guarna, S.

1991-07-01

This feasibility study on the production and use of hydrogen fuels for industry and domestic purposes includes the following aspects: physical and chemical properties of hydrogen; production methods steam reforming of natural gas, hydrolysis of water; liquid and gaseous hydrogen transportation and storage (hydrogen-hydride technology); environmental impacts, safety and economics of hydrogen fuel cells for power generation and hydrogen automotive fuels; relevant international research programs

FISITA 2012 World Automotive Congress

CERN Document Server

2013-01-01

Proceedings of the FISITA 2012 World Automotive Congress are selected from nearly 2,000 papers submitted to the 34th FISITA World Automotive Congress, which is held by Society of Automotive Engineers of China (SAE-China ) and the International Federation of Automotive Engineering Societies (FISITA). This proceedings focus on solutions for sustainable mobility in all areas of passenger car, truck and bus transportation. Volume 8: Vehicle Design and Testing (II) focuses on: •Automotive Reliability Technology •Lightweight Design Technology •Design for Recycling •Dynamic Modeling •Simulation and Experimental Validation •Virtual Design, Testing and Validation •Testing of Components, Systems and Full Vehicle Above all researchers, professional engineers and graduates in fields of automotive engineering, mechanical engineering and electronic engineering will benefit from this book.   SAE-China is a national academic organization composed of enterprises and professionals who focus on research, design a...

IPI tax relief policy and its impact on automotive and related sectors

Directory of Open Access Journals (Sweden)

Luiz Antônio Abrantes

2017-09-01

Full Text Available The policy of IPI tax relief in the automotive industry came from the need of answers to the Global Financial Crisis of 2008, which affected Brazil. This way, Brazilian Government set the reduction of the percentages of rates applied to automotive products and related sectors, according to several factors such as engine power, fuel type and production site, in order to restore the sector demand and stimulate the economy. In this context, this work aims to evaluate the implications of IPI tax relief policy, since 2009, on the turnover of joint-stock companies of the automotive and related sectors. The methodology was a multiple regression analysis model with Dynamic Panel data, in order to explain the variations of companies' turnover in the sector, regarding IPI tax relief. The data used were of 84 companies of this sector, for the period from 1998 to 2015, based on the software Economática. The results showed a decrease of IPI tax collection in the periods of relief, both in general and specific scope. In addition, we verified that the adoption of the policy had a negative influence on the turnover of the evaluated companies. Thus, we concluded that the tax policy under analysis did not contribute to an increase of automotive sector companies' turnover.

Envelope composition of Salmonella typhimurium 395 MS and 395 MR10 assesses by X-ray photoelectron spectroscopy (ESCA)

International Nuclear Information System (INIS)

Magnusson, K.F.; Johansson, L.

1977-01-01

The Salmonella typhimurium 395 MS and MR10 bacteria and lipopolysaccharide (LPS) were studied by X-ray photoelectron spectroscopy with the aid of the ESCA technique for the in situ analysis of chemical elements (C, O and N) at the surface. The nitrogen peak was large in both bacteria implying the presence of protein in the very outer part of the bacterial envelope due to the surface-sensitive measurement. The nitrogen peak was larger in the MR10 than in the MS bacteria, presumably reflecting an increased exposure of proteins concomitantly with the reduction of the LPS in MR10. After corrections for background and sensitivity of detection the relative intensities of the peaks agreed appreciably well with the proposed chemical structure of the LPS, indicating that at least semiquantitative relationships between the elements were obtained. (author)

Cost Savings of Nuclear Power with Total Fuel Reprocessing

International Nuclear Information System (INIS)

Solbrig, Charles W.; Benedict, Robert W.

2006-01-01

The cost of fast reactor (FR) generated electricity with pyro-processing is estimated in this article. It compares favorably with other forms of energy and is shown to be less than that produced by light water reactors (LWR's). FR's use all the energy in natural uranium whereas LWR's utilize only 0.7% of it. Because of high radioactivity, pyro-processing is not open to weapon material diversion. This technology is ready now. Nuclear power has the same advantage as coal power in that it is not dependent upon a scarce foreign fuel and has the significant additional advantage of not contributing to global warming or air pollution. A jump start on new nuclear plants could rapidly allow electric furnaces to replace home heating oil furnaces and utilize high capacity batteries for hybrid automobiles: both would reduce US reliance on oil. If these were fast reactors fueled by reprocessed fuel, the spent fuel storage problem could also be solved. Costs are derived from assumptions on the LWR's and FR's five cost components: 1) Capital costs: LWR plants cost $106/MWe. FR's cost 25% more. Forty year amortization is used. 2) The annual O and M costs for both plants are 9% of the Capital Costs. 3) LWR fuel costs about 0.0035 $/kWh. Producing FR fuel from spent fuel by pyro-processing must be done in highly shielded hot cells which is costly. However, the five foot thick concrete walls have the advantage of prohibiting diversion. LWR spent fuel must be used as feedstock for the FR initial core load and first two reloads so this FR fuel costs more than LWR fuel. FR fuel costs much less for subsequent core reloads ( 6 /MWe. The annual cost for a 40 year licensed plant would be 2.5 % of this or less if interest is taken into account. All plants will eventually have to replace those components which become radiation damaged. FR's should be designed to replace parts rather than decommission. The LWR costs are estimated to be 2.65 cents/kWh. FR costs are 2.99 cents/kWh for the first

Whole body MR in patients with multiple myeloma

International Nuclear Information System (INIS)

Piekarek, A.; Sosnowski, P.; Nowicki, A.; Komarnicki, M.

2009-01-01

Background: Multiple myeloma is a cancer of plasma cells which leads to bone marrow infiltration. Aim: Whole-body MR is the most sensitive imaging method available to detect multiple myeloma lesions. Ma terial and methods: MR scans were performed in 100 patients with multiple myeloma who were receiving treatment in the Haematology Clinic in Poznan in the years 2005 - 2006. Whole-body MR scans were performed with general coil 1.0 T in STIR sequences and T1 sequences, in coronal and sagittal planes with scanning area covering the head, neck, trunk and the limbs (FOV for specific regions was 36 -48 cm). The bone lesions were classified as focal (monofocal/multifocal lesions), infiltrative, mixed and 'salt and pepper' type. Depending on the size of the lesions the patients were included in one of three groups according to Salmon-Durie Plus classification. Results: Four main types of multiple myeloma were distinguished based on MR scans: focal (48 patients; monofocal in 10 patients), infiltrative (17 patients), mixed type (19 patients) and 'salt and pepper' type (4 patients). The remaining 12 patients had no multiple myeloma lesions in the bone marrow. Additionally, in 18% of patients a soft tissue mass could be observed. According to Salmon-Durie Plus categorisation 27 subjects were classified as having stage I, 16 patients stage and 57 patients stage III disease. In 12% of patients MR data changed the disease staging. Conclusions: WB MR is a sensitive and effective diagnostic method with an important impact on staging and further treatment of multiple myeloma. (authors)

High CpG island methylation ofp16 gene and loss of p16 protein ...

Indian Academy of Sciences (India)

Navya

employed to detect CpG island methylation in p16 promoter region and ... of Fallot;p16 gene;p16 protein;CpG islands;Methylation;Promoter regions ..... Our findings that p16 has a role in heart development is ... Asian Pac J Cancer Prev 15, 75-84. .... phenotype in colorectal cancer using a large population-based sample.

Valuation of dynamic MR imaging for diagnosis of pituitary microadenomas

International Nuclear Information System (INIS)

Lu Wu; Zhou Shengli; Liu Yusheng

2003-01-01

Objective: To evaluate the use of keyhole dynamic magnetic resonance (MR) imaging in evaluation of pituitary microadenomas. Methods: Fifty-three patients with pituitary microadenomas proved by operation or clinical findings such as headache, amenorrhea, lactating, fat or acromegaly were retrospectively studied on dynamic MR, conventional contrast enhanced MR, and unenhanced MR. Then the image data were analyzed by two experienced doctors who didn't know the details and three degrees were made as follows: grade 0, no evidence of the tumor; grade I, asymmetry signals in the pituitary; and grade II, nodulated or sheets signals in the pituitary. The grading data were compared with statistical methods. Results: In dynamic MR grading system: grade 0 was revealed in 1 patient, grade I in 29 patients and grade II in 23 patients. In conventional enhanced MR: grade 0 in 26 patients, grade I in 17 patients and grade II in 10 patients. In conventional unenhanced MR: grade 0 in 39 patients, grade I in 10 patients and grade II in 4 patients. The diagnostic rate of dynamic MR, conventional enhanced MR, and unenhanced MR was 98.1%, 51.9%, and 26.4%, respectively. (P < 0.005). Dynamic MR can increase the grade of tumor compared to the other two, which is significant statistically. Conclusion: Keyhole dynamic MR can increase the diagnostic accuracy of pituitary microadenomas while decreasing the uncertainty. So dynamic MR should become a routine examination for pituitary microadenoma when suspected by clinical findings but negative in conventional MR

Les élastomères dans les industries pétrolière et parapétrolière Elastomers in the Oil and Automotive Industries

Directory of Open Access Journals (Sweden)

Lesage J.

2006-11-01

Full Text Available L'accroissement des contraintes subies par les matériaux utilisés dans les techniques pétrolières et parapétrolières et liées aux températures et pressions élevées ainsi qu'aux agressions chimiques, fait que l'on exige de ces matériaux qu'ils soient de plus en plus performants. Ceci implique, pour les concepteurs et utilisateurs de matériel comportant des élastomères en contact avec les hydrocarbures, une connaissance actualisée des produits existants, lesquels sont en constante évolution. On commence donc par décrire les principales familles d'élastomères résistant en milieu pétrolier actuellement disponibles sur le marché. Puis, après avoir évoqué les problèmes que rencontrent les industries pétrolière et automobile dans l'utilisation des élastomères et présenté sommairement les résultats de travaux réalisés à l'Institut Français du Pétrole (IFP, on définira quelques axes de recherches dont la finalité est de participer à l'amélioration des techniques pétrolières dans le sens d'une meilleure fiabilité et d'une réduction des coûts. The materials used in the oil and automotive industries are being subjected to higher and higher mechanical, thermal and chemical stresses, so these materials, and especially elastomers, have to be more and more resistant. For designers and users of equipment containing elastomers in contact with hydrocarbons, this requires an updated understanding of existing products. The aim of this article is thus to describe, first of all, the leading families of resistant elastomers now available for use in a petroleum environment, with particular emphasis on chlorinated, fluorinated, acrylic and nitrile rubbers and their derivatives, which have evolved greatly in recent years with the appearance of new varieties and new types of elastomers, such as Atlas, Vamac, Eypel, etc. For each family of elastomer, the structure is described along with the vulcanization method, its properties

75 FR 69470 - JL French Automotive Castings, LLC, Including On-Site Leased Workers From Labor Ready and Seek...

Science.gov (United States)

2010-11-12

... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-70,143] JL French Automotive... workers of JL French Automotive Castings LLC, including on-site leased workers Labor Ready, Sheboygan... Sheboygan, Wisconsin location of JL French Automotive Castings LLC. The Department has determined that these...

Current and Future Uses of Aluminum in the Automotive Industry

Science.gov (United States)

Long, R. S.; Boettcher, E.; Crawford, D.

2017-12-01

Aluminum use is growing in automotive closures and body in white applications to improve vehicle performance and fuel economy. The auto industry is looking for higher-strength aluminum materials needed for strength-driven safety-critical parts. Through cooperation with industrial partners and support from the Department of Energy (DOE), multiple experimental 7xxx alloys were developed for automotive applications. The objective is to enable complex shapes to be formed at temperatures below 225°C. A demonstration part has been developed that is representative of the forming challenges within a current hot-stamped door ring component. This part tooling has been built and installed into a press line which includes blank heating and robotic transfer. Forming trials of these alloys are currently underway and the formability, strength and corrosion performance of these materials are being evaluated.

Fuel cells - from the laboratory to the road

Energy Technology Data Exchange (ETDEWEB)

Fronk, M.H. [Delphi Energy and Engine Management Systems, Rochester, NY (United States)

1996-12-31

The polymer electrolyte membrane (PEM) Fuel Cell faces stiff competition from existing automotive powerplants and other Hybrid APUs. To be successful, the Fuel Cell will have to demonstrate real customer advantages such as fuel economy and emissions. The PEM technology has an inherent advantage over other powerplants in both thermal efficiency and emission performance, and as such fits in very well with the future regulations that strive to clean up the environment. In addition, it will need to be cost competitive and provide acceptable performance. The majority of development activity on PEM Fuel Cells to date has concentrated primarily in the area of Stack refinement and optimization with improvements coming in higher power densities and higher specific power. To make the Fuel Cell compatible with an automotive environment the entire system will need to be analyzed, understood, and then engineered to work together in an efficient manner.

An Analysis of the Thermal and Structure Behaviour of the UO{sub 2}-PuO{sub 2}-Fuel in the Irradiation Experiment of the UO{sub 2}-PuO{sub 2}-Fuel in the Irradiation Experiment FR2 Capsule Test Series 5a; Analisis termico y estructural del combustible UO{sub 2}-PuO{sub 2} irradiado en el reactor FR2 dentro del experimento KVE-Vg.5a

Energy Technology Data Exchange (ETDEWEB)

Lopez Jimenez, J.; Helmut, E.

1981-07-01

In the Karlsruhe research reactor FR2 nine fuel pins were irradiated within three irradiation capsules in the course of the test series 5a. The pins contained UO{sub 2}-PuO{sub 2} fuel pellets. They reached bump values of about 6, 17 and 47 Mwd/Kg Me with linear rod powers of 400 to 600 W/cm and clad surface temperature between 500 and 700 degree centigree. A detailed analysis of the fuel structuration data (columnar-grain and equiaxed- -grain growth regions) have allowed to determine, with the help of physic-mathematical models, the radii of these regions and the heat transfer through the contact zone between fuel and clad depending on the bump. The results of the analysis showed that the fuel surface temperature rose with increasing burnup. (Author) 16 refs.

Rotordynamics of automotive turbochargers

CERN Document Server

Nguyen-Schäfer, Hung

2015-01-01

Rotordynamics of automotive turbochargers is dealt with in this book encompassing the widely working field of small turbomachines under real operating conditions at the very high rotor speeds up to 300000 rpm. The broadly interdisciplinary field of turbocharger rotordynamics involves 1) Thermodynamics and Turbo-Matching of Turbochargers 2) Dynamics of Turbomachinery 3) Stability Analysis of Linear Rotordynamics with the Eigenvalue Theory 4) Stability Analysis of Nonlinear Rotordynamics with the Bifurcation Theory 5) Bearing Dynamics of the Oil Film using the Two-Phase Reynolds Equation 6) Computation of Nonlinear Responses of a Turbocharger Rotor 7) Aero and Vibroacoustics of Turbochargers 8) Shop and Trim Balancing at Two Planes of the Rotor 9) Tribology of the Bearing Surface Roughness 10) Design of Turbocharger Platforms using the Similarity Laws The rotor response of an automotive turbocharger at high rotor speeds is studied analytically, computationally, and experimentally. Due to the nonlinear character...

Accuracy and interobserver agreement between MR-non-expert radiologists and MR-experts in reading MRI for suspected appendicitis

Energy Technology Data Exchange (ETDEWEB)

Leeuwenburgh, Marjolein M.N., E-mail: m.m.leeuwenburgh@amc.uva.nl [Department of Surgery, Academic Medical Center, University of Amsterdam (Netherlands); Department of Radiology, Academic Medical Center, University of Amsterdam (Netherlands); Wiarda, Bart M. [Department of Radiology, Alkmaar Medical Center, Alkmaar (Netherlands); Jensch, Sebastiaan [Department of Radiology, Sint Lucas Andreas Hospital, Amsterdam (Netherlands); Wouter van Es, H. [Department of Radiology, Sint Antonius Hospital, Nieuwegein (Netherlands); Stockmann, Hein B.A.C. [Department of Surgery, Kennemer Gasthuis, Haarlem (Netherlands); Gratama, Jan Willem C. [Department of Radiology, Gelre Hospitals, Apeldoorn (Netherlands); Cobben, Lodewijk P.J. [Department of Radiology, Haaglanden Medical Center, Leidschendam (Netherlands); Bossuyt, Patrick M.M. [Department of Clinical Epidemiology, Academic Medical Center, University of Amsterdam (Netherlands); Boermeester, Marja A. [Department of Surgery, Academic Medical Center, University of Amsterdam (Netherlands); Stoker, Jaap [Department of Radiology, Academic Medical Center, University of Amsterdam (Netherlands)

2014-01-15

Objective: To compare accuracy and interobserver agreement between radiologists with limited experience in the evaluation of abdominal MRI (non-experts), and radiologists with longer MR reading experience (experts), in reading MRI in patients with suspected appendicitis. Methods: MR imaging was performed in 223 adult patients with suspected appendicitis and read independently by two members of a team of eight MR-inexperienced radiologists, who were trained with 100 MR examinations previous to this study (non-expert reading). Expert reading was performed by two radiologists with a larger abdominal MR experience (>500 examinations) in consensus. A final diagnosis was assigned after three months based on all available information, except MRI findings. We estimated MRI sensitivity and specificity for appendicitis and for all urgent diagnoses separately. Interobserver agreement was evaluated using kappa statistics. Results: Urgent diagnoses were assigned to 147 of 223 patients; 117 had appendicitis. Sensitivity for appendicitis was 0.89 by MR-non-expert radiologists and 0.97 in MR-expert reading (p = 0.01). Specificity was 0.83 for MR-non-experts versus 0.93 for MR-expert reading (p = 0.002). MR-experts and MR-non-experts agreed on appendicitis in 89% of cases (kappa 0.78). Accuracy in detecting urgent diagnoses was significantly lower in MR-non-experts compared to MR-expert reading: sensitivity 0.84 versus 0.95 (p < 0.001) and specificity 0.71 versus 0.82 (p = 0.03), respectively. Agreement on urgent diagnoses was 83% (kappa 0.63). Conclusion: MR-non-experts have sufficient sensitivity in reading MRI in patients with suspected appendicitis, with good agreement with MR-expert reading, but accuracy of MR-expert reading was higher.

Accuracy and interobserver agreement between MR-non-expert radiologists and MR-experts in reading MRI for suspected appendicitis

International Nuclear Information System (INIS)

Leeuwenburgh, Marjolein M.N.; Wiarda, Bart M.; Jensch, Sebastiaan; Wouter van Es, H.; Stockmann, Hein B.A.C.; Gratama, Jan Willem C.; Cobben, Lodewijk P.J.; Bossuyt, Patrick M.M.; Boermeester, Marja A.; Stoker, Jaap

2014-01-01

Objective: To compare accuracy and interobserver agreement between radiologists with limited experience in the evaluation of abdominal MRI (non-experts), and radiologists with longer MR reading experience (experts), in reading MRI in patients with suspected appendicitis. Methods: MR imaging was performed in 223 adult patients with suspected appendicitis and read independently by two members of a team of eight MR-inexperienced radiologists, who were trained with 100 MR examinations previous to this study (non-expert reading). Expert reading was performed by two radiologists with a larger abdominal MR experience (>500 examinations) in consensus. A final diagnosis was assigned after three months based on all available information, except MRI findings. We estimated MRI sensitivity and specificity for appendicitis and for all urgent diagnoses separately. Interobserver agreement was evaluated using kappa statistics. Results: Urgent diagnoses were assigned to 147 of 223 patients; 117 had appendicitis. Sensitivity for appendicitis was 0.89 by MR-non-expert radiologists and 0.97 in MR-expert reading (p = 0.01). Specificity was 0.83 for MR-non-experts versus 0.93 for MR-expert reading (p = 0.002). MR-experts and MR-non-experts agreed on appendicitis in 89% of cases (kappa 0.78). Accuracy in detecting urgent diagnoses was significantly lower in MR-non-experts compared to MR-expert reading: sensitivity 0.84 versus 0.95 (p < 0.001) and specificity 0.71 versus 0.82 (p = 0.03), respectively. Agreement on urgent diagnoses was 83% (kappa 0.63). Conclusion: MR-non-experts have sufficient sensitivity in reading MRI in patients with suspected appendicitis, with good agreement with MR-expert reading, but accuracy of MR-expert reading was higher

Reprocessing of fast neutron reactor fuel

International Nuclear Information System (INIS)

Bourgeois, M.

1981-05-01

A PUREX process specially adapted to fast neutron reactor fuels is employed. The results obtained indicate that the aqueous process can be applied to this type of fuel: almost 10 years operation at the AT 1 plant which processes fuel from RAPSODIE; the good results obtained at the MARCOULE pilot plant on large batches of reference fuels. The CEA is continuing its work to transfer this technology onto an industrial scale. Industrial prototypes and the launching of the TOR (traitement d'oxydes rapides) project will facilitate this transfer. In 1984, it is expected that fast fuels will be able to be processed on a significant scale and that supplementary R and D facilities will be available [fr

Prenatal MR imaging of congenital diaphragmatic hernias: association of MR fetal lung volume with the need for postnatal prosthetic patch repair

Energy Technology Data Exchange (ETDEWEB)

Hagelstein, Claudia; Weidner, Meike; Schoenberg, Stefan O.; Buesing, Karen A.; Neff, K.W. [University of Heidelberg, Institute of Clinical Radiology and Nuclear Medicine, University Medical Center Mannheim, Mannheim (Germany); Zahn, Katrin [University of Heidelberg, Department of Pediatric Surgery, University Medical Center Mannheim, Mannheim (Germany); Weiss, Christel [University of Heidelberg, Department of Medical Statistics and Biomathematics, University Medical Center Mannheim, Mannheim (Germany); Schaible, Thomas [University of Heidelberg, Department of Pediatrics, University Medical Center Mannheim, Mannheim (Germany)

2015-01-15

To assess whether the need for postnatal prosthetic patch repair of the diaphragmatic defect in neonates with a congenital diaphragmatic hernia (CDH) is associated with the antenatal measured observed-to-expected magnetic resonance fetal lung volume (o/e MR-FLV). The o/e MR-FLV was calculated in 247 fetuses with isolated CDH. Logistic regression analysis was used to assess the prognostic value of the individual o/e MR-FLV for association with the need for postnatal patch repair. Seventy-seven percent (77 %) of patients with a CDH (190/247) required prosthetic patch repair and the defect was closed primarily in 23 % (57/247). Patients requiring a patch had a significantly lower o/e MR-FLV (27.7 ± 10.2 %) than patients with primary repair (40.8 ± 13.8 %, p < 0.001, AUC = 0.786). With an o/e MR-FLV of 20 %, 92 % of the patients required patch repair, compared to only 24 % with an o/e MR-FLV of 60 %. The need for a prosthetic patch was further influenced by the fetal liver position (herniation/no herniation) as determined by magnetic resonance imaging (MRI; p < 0.001). Fetal liver position, in addition to the o/e MR-FLV, improves prognostic accuracy (AUC = 0.827). Logistic regression analysis based on the o/e MR-FLV is useful for prenatal estimation of the prosthetic patch requirement in patients with a CDH. In addition to the o/e MR-FLV, the position of the liver as determined by fetal MRI helps improve prognostic accuracy. (orig.)

MR arthrographic findings in tenosynovitis of the long bicipital tendon of the shoulder

International Nuclear Information System (INIS)

Gueckel, C.; Nidecker, A.

1998-01-01

Purpose. To assess the MR arthrographic findings of bicipital tenosynovitis in correlation with arthroscopy. Design and patients. The shoulder MR arthrographies of 500 consecutive patients were retrospectively analyzed for signs of bicipital tenosynovitis and associated pathologies. Forty patients (8%) had MR evidence of bicipital tenosynovitis, but only 17 (3%) with arthroscopic confirmation were included in the study. The MR findings in these patients were compared with those of 10 patients with rotator cuff lesions but arthroscopically normal long biceps tendons. MR arthrography was performed with 10-15 ml of a 250 mmol/l gadoterate meglumine (Gd-DOTA) solution injected under fluoroscopic guidance, and transaxial, oblique coronal and sagittal MR sequences were obtained. Results. All 17 patients showed one or more abnormal findings: signal increase in the tendon with or without fusiform distension was seen in 12, surface irregularities in six, adhesions in 11 and noncommunicating effusions of the tendon sheath in six. Associated abnormalities of the rotator cuff were present in 16 while the seventeenth patient had glenohumeral synovitis without rotator cuff pathology. MR arthrograms correlated with arthroscopic findings in the joint but comparison was not possible in the intertubercular groove portion of the biceps tendon. None of the 10 patients with an arthroscopically normal biceps tendon showed any of the MR findings of bicipital tenosynovitis. Conclusion. Bicipital tenosynovitis is detectable by MR arthrography. In most cases it is an associated finding of rotator cuff abnormalities and likely to have a similar etiology. When lesions of the anterior rotator cuff are recognized, the biceps tendon should be scrutinized for inflammatory changes. (orig.)

Influence of the fuel operational parameters on the aluminium cladding quality of discharged fuel

Energy Technology Data Exchange (ETDEWEB)

Chwaszczewski, S.; Czajkowski, W.; Borek-Kruszewska, E. [Institute of Atomic Energy, Otwock Swierk (POLAND)

2002-07-01

In the last two years, the new MR6 type fuel containing 1550 g of U with 36% enrichment has been loaded into MARIA reactor core. Its aluminium cladding thickness is 0,6 mm and typical burnup -about 4080 MWh (as compared to 2880 MWh for the 80% enriched fuel used). However, increased fission product release from these assemblies was observed near the end of its operational time. The results presented earlier [1] show that the corrosion behaviour of aluminium cladding depends on the conditions of fuel operation in the reactor. The corrosion process in the aluminum of fuel cladding proceeds faster then in the aluminum of constructional elements. This tendency was also observed in MR-6/80% and in WWR- SM fuel assemblies. Therefore the visual tests of discharged MR-6/36% fuel elements were performed. Some change of appearance of aluminum cladding was observed, especially in the regions with large energy generation i.e. in the centre of reactor core and in the strong horizontal gradient of neutron flux. In the present paper, the results of visual investigation of discharged fuel assemblies are presented. The results of the investigation are correlated with the operational parameters. (author)

Elastase production by B16-F10 melanoma cells

International Nuclear Information System (INIS)

Shrager, J.B.; Yusa, T.; Netland, P.A.; Zetter, B.R.

1986-01-01

Elastolytic activity was found in sonicates of mouse B16-F10 melanoma cells and in medium conditioned by these cells. Degradation of elastin was determined by measuring the release of soluble 3 H-peptides from labelled insoluble elastin. The activity secreted from B16-F10 cells was soluble and was not associated with membrane vesicles. The secreted activity was partially inhibited by incubation with phenymethylsulfonylfluoride (PMSF) and was abolished by incubation with the alpha-1-protease inhibitor, with pepstatin A or with L-1-tosylamide-2-phenylethyl chloromethyl ketone (TPCK). In contrast, the activity was unaffected by incubation with elastatinal, with the plasmin inhibitor Σ-aminocaproic acid (EACA), the metalloproteinase inhibitor ethylenediamine-tetra-acetic acid (EDTA), the soybean trypsin inhibitor or the trypsin inhibitor N proportional to-p-tosyl-L-lysine chloromethyl ketone (TLCK). These results suggest that the majority of the tumor cell-derived elastolytic activity is attributable to a serine protease that differs in specificity from the well characterized elastases previously isolated from neutrophils, macrophages or from mammalian pancreas. The authors postulate that the release of elastase from lung-colonizing B16-F10 cells may facilitate their invasion of elastin-rich lung tissue

Used Fuel Disposition in Crystalline Rocks: FY16 Progress Report

Energy Technology Data Exchange (ETDEWEB)

Wang, Y. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hadgu, Teklu [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kalinina, Elena Arkadievna [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jerden, James L. [Argonne National Lab. (ANL), Argonne, IL (United States); Copple, Jacqueline M. [Argonne National Lab. (ANL), Argonne, IL (United States); Cruse, T. [Argonne National Lab. (ANL), Argonne, IL (United States); Ebert, W. [Argonne National Lab. (ANL), Argonne, IL (United States); Buck, E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Eittman, R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Tinnacher, R. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Tournassat, Christophe [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Davis, J. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Viswanathan, H. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Chu, S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dittrich, T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hyman, F. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Karra, S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Makedonska, N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Reimus, P. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Zavarin, Mavrik [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Joseph, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2016-09-21

The objective of the Crystalline Disposal R&D Work Package is to advance our understanding of long-term disposal of used fuel in crystalline rocks and to develop necessary experimental and computational capabilities to evaluate various disposal concepts in such media. FY16 continued to be a successful year in both experimental and modeling arenas in evaluation of used fuel disposal in crystalline rocks. The work covers a wide range of research topics identified in the R&D plan.

Performance evaluation of an automotive thermoelectric generator

Science.gov (United States)

Dubitsky, Andrei O.

Around 40% of the total fuel energy in typical internal combustion engines (ICEs) is rejected to the environment in the form of exhaust gas waste heat. Efficient recovery of this waste heat in automobiles can promise a fuel economy improvement of 5%. The thermal energy can be harvested through thermoelectric generators (TEGs) utilizing the Seebeck effect. In the present work, a versatile test bench has been designed and built in order to simulate conditions found on test vehicles. This allows experimental performance evaluation and model validation of automotive thermoelectric generators. An electrically heated exhaust gas circuit and a circulator based coolant loop enable integrated system testing of hot and cold side heat exchangers, thermoelectric modules (TEMs), and thermal interface materials at various scales. A transient thermal model of the coolant loop was created in order to design a system which can maintain constant coolant temperature under variable heat input. Additionally, as electrical heaters cannot match the transient response of an ICE, modelling was completed in order to design a relaxed exhaust flow and temperature history utilizing the system thermal lag. This profile reduced required heating power and gas flow rates by over 50%. The test bench was used to evaluate a DOE/GM initial prototype automotive TEG and validate analytical performance models. The maximum electrical power generation was found to be 54 W with a thermal conversion efficiency of 1.8%. It has been found that thermal interface management is critical for achieving maximum system performance, with novel designs being considered for further improvement.

Downsizing assessment of automotive Stirling engines

Science.gov (United States)

Knoll, R. H.; Tew, R. C., Jr.; Klann, J. L.

1983-01-01

A 67 kW (90 hp) Stirling engine design, sized for use in a 1984 1440 kg (3170 lb) automobile was the focal point for developing automotive Stirling engine technology. Since recent trends are towards lighter vehicles, an assessment was made of the applicability of the Stirling technology being developed for smaller, lower power engines. Using both the Philips scaling laws and a Lewis Research Center (Lewis) Stirling engine performance code, dimensional and performance characteristics were determined for a 26 kW (35 hp) and a 37 kW (50 hp) engine for use in a nominal 907 kg (2000 lb) vehicle. Key engine elements were sized and stressed and mechanical layouts were made to ensure mechanical fit and integrity of the engines. Fuel economy estimates indicated that the Stirling engine would maintain a 30 to 45 percent fuel economy advantage comparable spark ignition and diesel powered vehicles in the 1984 period.

Can preoperative MR imaging predict optic nerve invasion of retinoblastoma?

International Nuclear Information System (INIS)

Song, Kyoung Doo; Eo, Hong; Kim, Ji Hye; Yoo, So-Young; Jeon, Tae Yeon

2012-01-01

Purpose: To evaluate the accuracy of pre-operative MRI for the detection of optic nerve invasion in retinoblastoma. Materials and methods: Institutional review board approval and informed consent were waived for this retrospective study. A total of 41 patients were included. Inclusion criteria were histologically proven retinoblastoma, availability of diagnostic-quality preoperative MR images acquired during the 4 weeks before surgery, unilateral retinoblastoma, and normal-sized optic nerve. Two radiologists retrospectively reviewed the MR images independently. Five imaging findings (diffuse mild optic nerve enhancement, focal strong optic nerve enhancement, optic sheath enhancement, tumor location, and tumor size) were evaluated against optic nerve invasion of retinoblastoma. The predictive performance of all MR imaging findings for optic nerve invasion was also evaluated by the receiver operating characteristic curve analysis. Results: Optic nerve invasion was histopathologically confirmed in 24% of study population (10/41). The differences in diffuse mild enhancement, focal strong enhancement, optic sheath enhancement, and tumor location between patients with optic nerve invasion and patients without optic nerve invasion were not significant. Tumor sizes were 16.1 mm (SD: 2.2 mm) and 14.9 mm (SD: 3.6 mm) in patients with and without optic nerve involvement, respectively (P = 0.444). P-Values from binary logistic regression indicated that all five imaging findings were not significant predictors of tumor invasion of optic nerve. The AUC values of all MR imaging findings for the prediction of optic nerve invasion were 0.689 (95% confidence interval: 0.499–0.879) and 0.653 (95% confidence interval: 0.445–0.861) for observer 1 and observer 2, respectively. Conclusion: Findings of MRI in patients with normal-sized optic nerves have limited usefulness in preoperatively predicting the presence of optic nerve invasion in retinoblastoma.

Can preoperative MR imaging predict optic nerve invasion of retinoblastoma?

Energy Technology Data Exchange (ETDEWEB)

Song, Kyoung Doo, E-mail: kdsong0308@gmail.com [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50, Ilwon-Dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of); Eo, Hong, E-mail: rtombow@gmail.com [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50, Ilwon-Dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of); Kim, Ji Hye, E-mail: jhkate.kim@samsung.com [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50, Ilwon-Dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of); Yoo, So-Young, E-mail: sy1131.yoo@samsung.com [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50, Ilwon-Dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of); Jeon, Tae Yeon, E-mail: hathor97.jeon@samsung.com [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50, Ilwon-Dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of)

2012-12-15

Purpose: To evaluate the accuracy of pre-operative MRI for the detection of optic nerve invasion in retinoblastoma. Materials and methods: Institutional review board approval and informed consent were waived for this retrospective study. A total of 41 patients were included. Inclusion criteria were histologically proven retinoblastoma, availability of diagnostic-quality preoperative MR images acquired during the 4 weeks before surgery, unilateral retinoblastoma, and normal-sized optic nerve. Two radiologists retrospectively reviewed the MR images independently. Five imaging findings (diffuse mild optic nerve enhancement, focal strong optic nerve enhancement, optic sheath enhancement, tumor location, and tumor size) were evaluated against optic nerve invasion of retinoblastoma. The predictive performance of all MR imaging findings for optic nerve invasion was also evaluated by the receiver operating characteristic curve analysis. Results: Optic nerve invasion was histopathologically confirmed in 24% of study population (10/41). The differences in diffuse mild enhancement, focal strong enhancement, optic sheath enhancement, and tumor location between patients with optic nerve invasion and patients without optic nerve invasion were not significant. Tumor sizes were 16.1 mm (SD: 2.2 mm) and 14.9 mm (SD: 3.6 mm) in patients with and without optic nerve involvement, respectively (P = 0.444). P-Values from binary logistic regression indicated that all five imaging findings were not significant predictors of tumor invasion of optic nerve. The AUC values of all MR imaging findings for the prediction of optic nerve invasion were 0.689 (95% confidence interval: 0.499–0.879) and 0.653 (95% confidence interval: 0.445–0.861) for observer 1 and observer 2, respectively. Conclusion: Findings of MRI in patients with normal-sized optic nerves have limited usefulness in preoperatively predicting the presence of optic nerve invasion in retinoblastoma.

Effect of Fe, Ni, and Cr on the corrosion behaviour of hyper-eutectic Al-Si automotive alloy under different pH conditions

Directory of Open Access Journals (Sweden)

Mohammad Salim Kaiser

2018-05-01

Full Text Available Effect of Fe, Ni and Cr on the corrosion behaviour of hyper-eutectic Al-Si automotive alloy was studied. The test of corrosion behaviour at different environmental pH 1, 3, 5, 7, 9, 11 and 13 was performed using conventional gravimetric measurements and complemented by resistivity, optical micrograph, scanning electron microscopy (SEM and X-ray analyser (EDX investigations. The highest corrosion rate was observed at pH 13 followed by pH 1, while in the pH range of 3.0 to 11, there is a high protection of surface due to formation of stable surface oxide film. The highest corrosion rate at pH 13 is due to presence of sodium hydroxide in the solution in which the surface oxide film is soluble. At pH 1, however, high corrosion rate can be attributed to dissolution of Al due to the surface attack by aggressive chloride ions. Presence of Fe, Ni and Cr in hyper-eutectic Al-Si automotive alloy has significant effect on the corrosion rate at both environmental pH values. Resistivity of alloy surfaces initially decreases at pH 1 and pH 13 due to formation of thin films. The SEM images of corroded samples immersed in pH 1 solution clearly show pores due to uniform degradation of the alloy. In pH 13 solution, however, the corrosion layer looks more packed and impermeable.

Round table on bio-fuels

International Nuclear Information System (INIS)

2005-11-01

The French ministers of agriculture and of industry have organized a meeting with the main French actors of agriculture, petroleum industry, car making and accessories industry and with professionals of agriculture machines to encourage the development of bio-fuels in France. This meeting took place in Paris in November 21, 2005. Its aim was to favor the partnerships between the different actors and the public authorities in order to reach the ambitious goals of the government of 5.75% of bio-fuels in fossil fuels by 2008, 7% by 2010 and 10% by 2015. The main points discussed by the participants were: the compatibility of automotive fuel standards with the objectives of bio-fuel incorporation, the development of direct incorporation of methanol in gasoline, the ethanol-ETBE partnership, the question of the lower calorific value of ETBE (ethyl tertio butyl ether), the development of new bio-fuels, the development of bio-diesel and the specific case of pure vegetal oils, and the fiscal framework of bio-fuels. This meeting has permitted to reach important improvements with 15 concrete agreements undertaken by the participants. (J.S.)

Final Report on Two-Stage Fast Spectrum Fuel Cycle Options

International Nuclear Information System (INIS)

Yang, Won Sik; Lin, C. S.; Hader, J. S.; Park, T. K.; Deng, P.; Yang, G.; Jung, Y. S.; Kim, T. K.; Stauff, N. E.

2016-01-01

This report presents the performance characteristics of two ''two-stage'' fast spectrum fuel cycle options proposed to enhance uranium resource utilization and to reduce nuclear waste generation. One is a two-stage fast spectrum fuel cycle option of continuous recycle of plutonium (Pu) in a fast reactor (FR) and subsequent burning of minor actinides (MAs) in an accelerator-driven system (ADS). The first stage is a sodium-cooled FR fuel cycle starting with low-enriched uranium (LEU) fuel; at the equilibrium cycle, the FR is operated using the recovered Pu and natural uranium without supporting LEU. Pu and uranium (U) are co-extracted from the discharged fuel and recycled in the first stage, and the recovered MAs are sent to the second stage. The second stage is a sodium-cooled ADS in which MAs are burned in an inert matrix fuel form. The discharged fuel of ADS is reprocessed, and all the recovered heavy metals (HMs) are recycled into the ADS. The other is a two-stage FR/ADS fuel cycle option with MA targets loaded in the FR. The recovered MAs are not directly sent to ADS, but partially incinerated in the FR in order to reduce the amount of MAs to be sent to the ADS. This is a heterogeneous recycling option of transuranic (TRU) elements

Final Report on Two-Stage Fast Spectrum Fuel Cycle Options

Energy Technology Data Exchange (ETDEWEB)

Yang, Won Sik [Purdue Univ., West Lafayette, IN (United States); Lin, C. S. [Purdue Univ., West Lafayette, IN (United States); Hader, J. S. [Purdue Univ., West Lafayette, IN (United States); Park, T. K. [Purdue Univ., West Lafayette, IN (United States); Deng, P. [Purdue Univ., West Lafayette, IN (United States); Yang, G. [Purdue Univ., West Lafayette, IN (United States); Jung, Y. S. [Purdue Univ., West Lafayette, IN (United States); Kim, T. K. [Argonne National Lab. (ANL), Argonne, IL (United States); Stauff, N. E. [Argonne National Lab. (ANL), Argonne, IL (United States)

2016-01-30

This report presents the performance characteristics of two “two-stage” fast spectrum fuel cycle options proposed to enhance uranium resource utilization and to reduce nuclear waste generation. One is a two-stage fast spectrum fuel cycle option of continuous recycle of plutonium (Pu) in a fast reactor (FR) and subsequent burning of minor actinides (MAs) in an accelerator-driven system (ADS). The first stage is a sodium-cooled FR fuel cycle starting with low-enriched uranium (LEU) fuel; at the equilibrium cycle, the FR is operated using the recovered Pu and natural uranium without supporting LEU. Pu and uranium (U) are co-extracted from the discharged fuel and recycled in the first stage, and the recovered MAs are sent to the second stage. The second stage is a sodium-cooled ADS in which MAs are burned in an inert matrix fuel form. The discharged fuel of ADS is reprocessed, and all the recovered heavy metals (HMs) are recycled into the ADS. The other is a two-stage FR/ADS fuel cycle option with MA targets loaded in the FR. The recovered MAs are not directly sent to ADS, but partially incinerated in the FR in order to reduce the amount of MAs to be sent to the ADS. This is a heterogeneous recycling option of transuranic (TRU) elements

Spin-echo Echo-planar Imaging MR Elastography versus Gradient-echo MR Elastography for Assessment of Liver Stiffness in Children and Young Adults Suspected of Having Liver Disease.

Science.gov (United States)

Serai, Suraj D; Dillman, Jonathan R; Trout, Andrew T

2017-03-01

Purpose To compare two-dimensional (2D) gradient-recalled echo (GRE) and 2D spin-echo (SE) echo-planar imaging (EPI) magnetic resonance (MR) elastography for measurement of hepatic stiffness in pediatric and young adult patients suspected of having liver disease. Materials and Methods In this institutional review board-approved, HIPAA-compliant study, 58 patients underwent both 2D GRE and 2D SE-EPI MR elastography at 1.5 T during separate breath holds. Liver stiffness (mean of means; in kilopascals) was measured by five blinded reviewers. Pooled mean liver stiffness and region-of-interest (ROI) size were compared by using paired t tests. Intraclass correlation coefficients (ICCs) were used to assess agreement between techniques. Respiratory motion artifacts were compared across sequences by using the Fisher exact test. Results Mean patient age was 14.7 years ± 5.2 (standard deviation; age range, 0.7-20.5 years), and 55.2% (32 of 58) of patients were male. Mean liver stiffness was 2.92 kPa ± 1.29 measured at GRE MR elastography and 2.76 kPa ± 1.39 at SE-EPI MR elastography (n = 290; P = .15). Mean ROI sizes were 8495 mm 2 ± 4482 for 2D GRE MR elastography and 15 176 mm 2 ± 7609 for 2D SE-EPI MR elastography (n = 290; P range, 0.91-0.95). Moderate or severe breathing artifacts were observed on 27.5% (16 of 58) of 2D GRE images versus 0% 2D SE-EPI images (P < .001). Conclusion There is excellent agreement on measured hepatic stiffness between 2D GRE and 2D SE-EPI MR elastography across multiple reviewers. SE-EPI MR elastography allowed for stiffness measurement across larger areas of the liver and can be performed in a single breath hold. © RSNA, 2016.

Assessment of the skeletal status by MR relaxometry techniques of the lumbar spine: comparison with dual X-ray absorptiometry

International Nuclear Information System (INIS)

Maris, Thomas G.; Damilakis, John; Sideri, Liana; Deimling, Michael; Papadokostakis, Georgios; Papakonstantinou, Olympia; Gourtsoyiannis, Nikos

2004-01-01

Purpose: To measure lumbar spine T2*, T2, T2' and T1 MR relaxometry parameters and compare them with lumbar spine bone mineral density (BMD) in a group of postmenopausal women. Materials and methods: Lumbar spine T2*, T2, T2' and T1 MR relaxometry parameters and BMD values were assessed in 101 postmenopausal women (mean age: 61.8±7.1 (1 S.D.) years); of them 63 referred to as control subjects (group A, BMD T-scores ≥ -2.5 S.D.) and 38 as osteoporotic (group B, BMD T-scores < -2.5 S.D.). All magnetic resonance imaging (MRI) examinations were performed on an 1.5 T imaging system using: (a) a 2D single slice multi echo (32 echoes) gradient echo (MEGRE) sequence (TR/TE1/TE32/FA: 160/2.7/74.93 ms/25 degree sign ) for the T2* measurement, (b) a respiratory gated 2D single slice Multi Echo (16 echoes) Spin Echo (MESE) sequence (TR/TE1/TE16/FA: 2000-2500/22.5/360 ms/90 degree sign ) for the T2 measurement and (c) a 2D single slice multi TI (18 repeats) turbo Fast Low Angle Shot (turbo FLASH) sequence (TR/TE/TI1/TI16/FA: 11/4.2/10/5000 ms/10 degree sign ) for the T1 measurement. T2' was calculated from its definition equation: (1/T2' = 1/T2* - 1/T2). Lumbar spine BMD was assessed using DXA. Results: All measured parameters showed statistically significant differences between groups A and B (from P<0.05 to <0.001). All parameters showed significant associations with subject's age ranging from r=0.245 (P<0.05) for the T2 up to r=0.377 (P<0.001) for the T2*. All parameters showed significant associations with subject's BMD measurements ranging from r=-0.184 (P<0.05) for the R1 = (1/T1) up to r=-0.345 (P<0.0005) for the T2. Conclusion: Among the MR relaxometry parameters studied, T2* and T2 showed better discrimination of patients with osteoporosis from control subjects

Assessment of the skeletal status by MR relaxometry techniques of the lumbar spine: comparison with dual X-ray absorptiometry

Energy Technology Data Exchange (ETDEWEB)

Maris, Thomas G. E-mail: tmaris@med.uoc.gr; Damilakis, John; Sideri, Liana; Deimling, Michael; Papadokostakis, Georgios; Papakonstantinou, Olympia; Gourtsoyiannis, Nikos

2004-06-01

Purpose: To measure lumbar spine T2*, T2, T2' and T1 MR relaxometry parameters and compare them with lumbar spine bone mineral density (BMD) in a group of postmenopausal women. Materials and methods: Lumbar spine T2*, T2, T2' and T1 MR relaxometry parameters and BMD values were assessed in 101 postmenopausal women (mean age: 61.8{+-}7.1 (1 S.D.) years); of them 63 referred to as control subjects (group A, BMD T-scores {>=} -2.5 S.D.) and 38 as osteoporotic (group B, BMD T-scores < -2.5 S.D.). All magnetic resonance imaging (MRI) examinations were performed on an 1.5 T imaging system using: (a) a 2D single slice multi echo (32 echoes) gradient echo (MEGRE) sequence (TR/TE1/TE32/FA: 160/2.7/74.93 ms/25 degree sign ) for the T2* measurement, (b) a respiratory gated 2D single slice Multi Echo (16 echoes) Spin Echo (MESE) sequence (TR/TE1/TE16/FA: 2000-2500/22.5/360 ms/90 degree sign ) for the T2 measurement and (c) a 2D single slice multi TI (18 repeats) turbo Fast Low Angle Shot (turbo FLASH) sequence (TR/TE/TI1/TI16/FA: 11/4.2/10/5000 ms/10 degree sign ) for the T1 measurement. T2' was calculated from its definition equation: (1/T2' = 1/T2* - 1/T2). Lumbar spine BMD was assessed using DXA. Results: All measured parameters showed statistically significant differences between groups A and B (from P<0.05 to <0.001). All parameters showed significant associations with subject's age ranging from r=0.245 (P<0.05) for the T2 up to r=0.377 (P<0.001) for the T2*. All parameters showed significant associations with subject's BMD measurements ranging from r=-0.184 (P<0.05) for the R1 = (1/T1) up to r=-0.345 (P<0.0005) for the T2. Conclusion: Among the MR relaxometry parameters studied, T2* and T2 showed better discrimination of patients with osteoporosis from control subjects.

Quantification of Hepatic Steatosis with T1-independent, T2*-corrected MR Imaging with Spectral Modeling of Fat: Blinded Comparison with MR Spectroscopy

Science.gov (United States)

Hines, Catherine D. G.; Hamilton, Gavin; Sirlin, Claude B.; McKenzie, Charles A.; Yu, Huanzhou; Brittain, Jean H.; Reeder, Scott B.

2011-01-01

Purpose: To prospectively compare an investigational version of a complex-based chemical shift–based fat fraction magnetic resonance (MR) imaging method with MR spectroscopy for the quantification of hepatic steatosis. Materials and Methods: This study was approved by the institutional review board and was HIPAA compliant. Written informed consent was obtained before all studies. Fifty-five patients (31 women, 24 men; age range, 24–71 years) were prospectively imaged at 1.5 T with quantitative MR imaging and single-voxel MR spectroscopy, each within a single breath hold. The effects of T2* correction, spectral modeling of fat, and magnitude fitting for eddy current correction on fat quantification with MR imaging were investigated by reconstructing fat fraction images from the same source data with different combinations of error correction. Single-voxel T2-corrected MR spectroscopy was used to measure fat fraction and served as the reference standard. All MR spectroscopy data were postprocessed at a separate institution by an MR physicist who was blinded to MR imaging results. Fat fractions measured with MR imaging and MR spectroscopy were compared statistically to determine the correlation (r2), and the slope and intercept as measures of agreement between MR imaging and MR spectroscopy fat fraction measurements, to determine whether MR imaging can help quantify fat, and examine the importance of T2* correction, spectral modeling of fat, and eddy current correction. Two-sided t tests (significance level, P = .05) were used to determine whether estimated slopes and intercepts were significantly different from 1.0 and 0.0, respectively. Sensitivity and specificity for the classification of clinically significant steatosis were evaluated. Results: Overall, there was excellent correlation between MR imaging and MR spectroscopy for all reconstruction combinations. However, agreement was only achieved when T2* correction, spectral modeling of fat, and magnitude

10 CFR 602.16 - National security.

Science.gov (United States)

2010-01-01

... 10 Energy 4 2010-01-01 2010-01-01 false National security. 602.16 Section 602.16 Energy DEPARTMENT... ASSISTANCE PROGRAM § 602.16 National security. Activities under the Epidemiology and Other Health Studies..., Formerly Restricted Data, National Security Information). However, if in the opinion of the recipient or...

Simulation of the irradiation-induced micro-thermo-mechanical behaviors evolution in ADS nuclear fuel pellets

Science.gov (United States)

Ding, Shurong; Zhao, Yunmei; Wan, Jibo; Gong, Xin; Wang, Canglong; Yang, Lei; Huo, Yongzhong

2013-11-01

An Accelerator Driven System (ADS) is dedicated to Minor Actinides (MA) transmutation. The fuels for ADS are highly innovative, which are composite fuel pellets with the fuel particles containing MA phases dispersed in a MgO or Mo matrix. Assuming that the fuel particles are distributed periodically in the MgO matrix, a three-dimensional finite element model is developed. The three-dimensional incremental large-deformation constitutive relations for the fuel particles and matrix are separately built, and a method is accordingly constructed to implement simulation of the micro-thermo-mechanical behaviors evolution. Evolutions of the temperature and mechanical fields are given and discussed. With irradiation creep included in the MgO matrix constitutive relation, the conclusions can be drawn as that (1) irradiation creep has a remarkable effect on the mechanical behaviors evolution in the matrix; (2) irradiation creep plays an important role in the damage mechanism interpretation of ceramic matrix fuel pellets. Thermal conductivity The thermal conductivity model is adopted as KUO2 = K0·FD·FP·FM·FR, which was proposed by Lucuta et al. [10] to adapt to the high burnup conditions with consideration of the effects of temperature, burnup, porosity and fission products. K0 is the thermal conductivity of fully dense un-irradiated UO2, as Eq. (1) in W/m K; FD, FP are the adjust factors reflecting the effects of dissolved and precipitated fission products; FM and FR are factors due to porosity and irradiation effects. The adopted thermal conductivity varies with temperature and burnup, which expresses its degradation with burnup, with the terms as k0={1}/{0.0375+2.165×10-4T}+{4.715×109}/{T2}exp-{16361}/{T} FD={1.09}/{B3.265}+{0.0643}/{√{B}}√{T}artan{1}/{1.09/B3.265}+{0.0643}/{√{B}}√{T} FP=1+0.019B/3-0.019B{1}/{1+exp(1200-T100)} FM={1-P}/{1+(s-1)P} FR=1-{0.2}/{1+expT-90080} Thermal expansion The engineering strain of thermal expansion [11] is given as {ΔL}/{L0

Sustainability of Advanced Fuel Cycles

International Nuclear Information System (INIS)

Abe, Tomoyuki

2013-01-01

Effect of FR Deployment for New Scenarios with Decreased Nuclear Contribution after 3.11: • Uranium utilization in constant contribution scenario: - Many countries maintain their nuclear energy program after 3.11. - Uranium shortage is still fatal issue of this century. - FR system has significant contribution to enhanse sustainability in uranium utilization. • Spent Fuel (SF) management in constant contribution scenario: - Reprocessing of spent fuels will be essential to remain the SF stockpile within the storage capacity. • Pu/waste management in all scenarios: - FR systems can provide flexibility to Pu/waste management

Interaction Design of Augmented Education Environments - Augmented and Mixed Reality for performance and training support of Aviation / Automotive Technicians.

OpenAIRE

Behringer, R; Christian, J; Krieger, H; Moore, D; Holzinger, A

2011-01-01

"Augmented reality (AR),Mixed Reality (MR) and their mix and combination with other disruptive technologies offer an enormous potential for supporting instructors and trainees in modern education and working environments such as of aircraft maintenance technicians or automotive service technicians. In this paper we investigate and show some examples on how the performance and training of such instructors and trainees can be actively supported. Furthermore we will discuss the new challenges fo...

Study of the D(p,π+)T and 9Be(p,π+)10Be from 400 to 800MeV

International Nuclear Information System (INIS)

Aslanides, E.; Bauer, T.; Bertini, R.; Beurtey, R.; Bimbot, L.; Bing, O.; Boudard, A.; Brochard, F.; Bruge, G.; Catz, H.; Chaumeaux, A.; Couvert, P.; Duchazeaubeneix, J.C.; Duhm, H.; Garreta, D.; Gorodetzky, P.; Habault, J.; Hibou, F.; Igo, G.; Le Bornec, Y.; Lugol, J.C.; Matoba, M.; Tatischeff, B.; Terrien, Y.

Pion production on CD 2 and 9 Be targets has been observed using the high resolution, energy loss, spectrometer SPES I. Differential cross sections for the D(p,π + ) reaction have been determined at 410, 605 and 809MeV and for the 9 Be(p,π + ) reaction at 410 and 605MeV. The 3.37MeV (2 + ) state in 10 Be is populated preferentially, but a significant part of the transition strength seems to populate the ground state and the higher lying multiplets at about 6.1MeV, 7.4MeV and 9.4MeV [fr

Automotive Electrical and Electronic System II; Automotive Mechanics-Intermediate: 9045.04.

Science.gov (United States)

Dade County Public Schools, Miami, FL.

This automotive electrical and electronic system course is an intermediate course designed for the student who has completed automotive Electrical and Electronic System I. The theory and principles of operation of the components of the starting and charging systems and other electrical accessory systems in the automobile will be learned by the…

Pancreatic adenocarcinoma: combination of MR imaging, MR angiography and MR cholangiopancreatography for the diagnosis and assessment of resectability

International Nuclear Information System (INIS)

Catalano, C.; Pavone, P.; Laghi, A.; Panebianco, V.; Scipioni, A.; Fanelli, F.; Brillo, R.; Passariello, R.

1998-01-01

The purpose of this study was to determine the possibility of integrating MR cholangiopancreatography (MRCP) and MR angiography (MRA) to conventional MR images in the diagnosis and assessment of resectability of pancreatic adenocarcinoma. Twenty-three patients with pancreatic adenocarcinoma were prospectively examined with MR. Conventional MR images were acquired in all patients. Three-dimensional MRCP and MRA images were acquired in all patients with suspected biliary and vascular involvement. Acquisition time was less than 45 min in all cases. Images were independently evaluated by two radiologists, with final reading decided by consensus among readers. Diagnosis was confirmed with surgery in 16 patients and with percutaneous biopsy in 7. Concordance among readers was high with a kappa value of 0.83. Pancreatic adenocarcinoma was observed in all patients. Correct assessment of unresectability due to vascular involvement was found in 22 of 23 patients. Biliary obstruction was evident in 13 patients, involving the biliary and pancreatic ducts in 9 and the biliary ducts only in 4. Technical advances permit extensive use of MRI in the evaluation of abdominal pathologies. The combination of MR imaging, MRCP, and MRA can provide sufficient information for the diagnosis and assessment of resectability of pancreatic adenocarcinoma, which otherwise would require three different exams. (orig.)

Fabrication technology of spherical fuel element for HTR-10

International Nuclear Information System (INIS)

He Jun; Zou Yanwen; Liang Tongxiang; Qiu Xueliang

2002-01-01

R and D on the fabrication technology of the spherical fuel elements for the 10 MW HTR Test Module (HTR-10) began from 1986. Cold quasi-isostatic molding with a silicon rubber die is used for manufacturing the spherical fuel elements.The fabrication technology and the graphite matrix materials were investigated and optimized. Twenty five batches of fuel elements, about 11000 of the fuel elements, have been produced. The cold properties of the graphite matrix materials satisfied the design specifications. The mean free uranium fraction of 25 batches was 5 x 10 -5

Advanced high temperature materials for the energy efficient automotive Stirling engine

International Nuclear Information System (INIS)

Titran, R.H.; Stephens, J.R.

1984-01-01

The Stirling engine is under investigation jointly by the Department of Energy and NASA Lewis as an alternative to the internal combustion engine for automotive applications. The Stirling engine is an external combustion engine that offers the advantage of high fuel economy, low emissions, low noise, and low vibrations compared to current internal combustion automotive engines. The most critical component from a materials viewpoint is the heater head consisting of the cylinders, heating tubes, and regenerator housing. Materials requirements for the heater head include compatibility with hydrogen, resistance to hydrogen permeation, high temperature oxidation/corrosion resistance, and high temperature creep-rupture and fatigue properties. A continuing supporting materials research and technology program has identified the wrought alloys CG-27 and 12RN72, and the cast alloys XF-818 and NASAUT 4G-A1 as candidate replacements for the cobalt containing alloys used in current prototype engines. Based on the materials research program in support of the automotive Stirling engine it is concluded that manufacture of the engine is feasible from low cost iron-base alloys rather than the cobalt alloys used in prototype engines. This paper presents results of research that led to this conclusion

Particle Count Limits Recommendation for Aviation Fuel

Science.gov (United States)

2015-10-05

Particle Counter Methodology • Particle counts are taken utilizing calibration methodologies and standardized cleanliness code ratings – ISO 11171 – ISO...Limits Receipt Vehicle Fuel Tank Fuel Injector Aviation Fuel DEF (AUST) 5695B 18/16/13 Parker 18/16/13 14/10/7 Pamas / Parker / Particle Solutions 19/17...12 U.S. DOD 19/17/14/13* Diesel Fuel World Wide Fuel Charter 5th 18/16/13 DEF (AUST) 5695B 18/16/13 Caterpillar 18/16/13 Detroit Diesel 18/16/13 MTU

Hydrogen Oxidation-Selective Electrocatalysis by Fine Tuning of Pt Ensemble Sites to Enhance the Durability of Automotive Fuel Cells.

Science.gov (United States)

Yun, Su-Won; Park, Shin-Ae; Kim, Tae-June; Kim, Jun-Hyuk; Pak, Gi-Woong; Kim, Yong-Tae

2017-02-08

A simple, inexpensive approach is proposed for enhancing the durability of automotive proton exchange membrane fuel cells by selective promotion of the hydrogen oxidation reaction (HOR) and suppression of the oxygen reduction reaction (ORR) at the anode in startup/shutdown events. Dodecanethiol forms a self-assembled monolayer (SAM) on the surface of Pt particles, thus decreasing the number of Pt ensemble sites. Interestingly, by controlling the dodecanethiol concentration during SAM formation, the number of ensemble sites can be precisely optimized such that it is sufficient for the HOR but insufficient for the ORR. Thus, a Pt surface with an SAM of dodecanethiol clearly effects HOR-selective electrocatalysis. Clear HOR selectivity is demonstrated in unit cell tests with the actual membrane electrode assembly, as well as in an electrochemical three-electrode setup with a thin-film rotating disk electrode configuration. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Automotive Electrical and Electronic Systems I; Automotive Mechanics 2: 9045.03.

Science.gov (United States)

Dade County Public Schools, Miami, FL.

The automotive electrical and electronic system I course is designed as one of a group of quinmester courses offered in the field of automotive mechanics. General information will be given along with technical knowledge, basic skills, attitudes and values that are required for job entry level. The nine week (135 clock hour) course overcomes some…

Get Your Automotive Program Nationally Certified!

Science.gov (United States)

Lundquist, Patricia A.

2000-01-01

Automotive programs that nationally certified enhance student recruitment and give students better employment opportunities. Technicians who earn the Automotive Service Excellence credential have joined the ranks of professionals in the automotive service industry. (Author/JOW)

Clinical estimation of myocardial infarct volume with MR imaging

International Nuclear Information System (INIS)

Johns, J.A.; Leavitt, M.B.; Field, B.D.; Yasuda, T.; Gold, H.; Leinbach, R.C.; Brady, T.J.; Dinsmore, R.E.

1987-01-01

MR imaging has not previously been used to assess infarct size in humans. Short-axis spin-echo cardiac MR imaging was performed in 20 patients who had undergone intravenous thrombolytic therapy and angiography, 10 days after myocardial infarct. A semi-automated computer program was used to outline the infarct region on each section. The outlines were algorithmically stacked and a three-dimensional representation of the infarct was created. The MR imaging infarct volume was then computed using the Simpson rule. Comparison with ventriculographic infarct size as determined by the computed severely hypokinetic segment length showed excellent correlation (r = .84, P < .001)

MR imaging findings of acetabular dysplasia in adults

Energy Technology Data Exchange (ETDEWEB)

James, Steven; Connell, David [The Royal National Orthopaedic Hospital, Radiology Department, London, Middlesex (United Kingdom); Miocevic, Miranda; Malara, Frank; Pike, Jonathan [Victoria House Hospital, Radiology Department, Melbourne (Australia); Young, David [Melbourne Orthopaedic Group, Orthopaedic Surgery, Melbourne (Australia)

2006-06-15

To evaluate the diagnostic accuracy of MR imaging in the identification of labral and articular cartilage lesions in patients with acetabular dysplasia. Pre-operative MR imaging was performed on 27 hips in 25 consecutive patients (16 males, 9 females, age range 19-52 years, mean age 31.2 years) with radiographic evidence of acetabular dysplasia (centre-edge angle of Wiberg <20 degrees). The average duration of symptoms was 16.2 months. Two musculoskeletal radiologists assessed MR images in consensus for the presence of abnormality involving the acetabular labrum and adjacent acetabular articular cartilage. A high resolution, non-arthrographic technique was used to assess the labrum and labral chondral transitional zone. Surgical correlation was obtained in all cases by a single surgeon experienced in hip arthroscopy and ten patients with normal hip MRI were included to provide a control group. The acetabular labra in the dysplastic hips demonstrated abnormal signal intensity, and had an elongated appearance when compared with the control group (mean length 10.9 mm vs 6.4 mm). Morphological appearances in the labra included surface irregularity, fissures and cleft formation. MR imaging correctly identified the severity of chondral abnormality in 24 of 27 hips (89%) when compared with arthroscopic findings. MR imaging demonstrates an elongated labrum, focal intra-substance signal change and irregularity and fissuring of the margins in patients with acetabular dysplasia. Abnormality is also identified at the labral chondral transitional zone, where fissuring, focal clefts, chondral deficiency and subchondral cyst formation may be apparent. A high-resolution, non-arthrographic technique can provide an accurate preoperative assessment and evaluate the presence of premature osteoarthritis. (orig.)

MR imaging findings of acetabular dysplasia in adults

International Nuclear Information System (INIS)

James, Steven; Connell, David; Miocevic, Miranda; Malara, Frank; Pike, Jonathan; Young, David

2006-01-01

To evaluate the diagnostic accuracy of MR imaging in the identification of labral and articular cartilage lesions in patients with acetabular dysplasia. Pre-operative MR imaging was performed on 27 hips in 25 consecutive patients (16 males, 9 females, age range 19-52 years, mean age 31.2 years) with radiographic evidence of acetabular dysplasia (centre-edge angle of Wiberg <20 degrees). The average duration of symptoms was 16.2 months. Two musculoskeletal radiologists assessed MR images in consensus for the presence of abnormality involving the acetabular labrum and adjacent acetabular articular cartilage. A high resolution, non-arthrographic technique was used to assess the labrum and labral chondral transitional zone. Surgical correlation was obtained in all cases by a single surgeon experienced in hip arthroscopy and ten patients with normal hip MRI were included to provide a control group. The acetabular labra in the dysplastic hips demonstrated abnormal signal intensity, and had an elongated appearance when compared with the control group (mean length 10.9 mm vs 6.4 mm). Morphological appearances in the labra included surface irregularity, fissures and cleft formation. MR imaging correctly identified the severity of chondral abnormality in 24 of 27 hips (89%) when compared with arthroscopic findings. MR imaging demonstrates an elongated labrum, focal intra-substance signal change and irregularity and fissuring of the margins in patients with acetabular dysplasia. Abnormality is also identified at the labral chondral transitional zone, where fissuring, focal clefts, chondral deficiency and subchondral cyst formation may be apparent. A high-resolution, non-arthrographic technique can provide an accurate preoperative assessment and evaluate the presence of premature osteoarthritis. (orig.)

Evaluation of the Benefits Attributable to Automotive Lighweight Materials Program Research and Development Projects

Energy Technology Data Exchange (ETDEWEB)

Das, S.

2002-01-11

The purpose of this project is to identify and test methods appropriate for estimating the benefits attributable to research and development (R and D) projects funded by the Automotive Lightweight Materials (ALM) Program of the Office of Advanced Automotive Technologies (OAAT) of the U.S. Department of Energy (DOE). The program focuses on the development and validation of advanced lightweight materials technologies to significantly reduce automotive vehicle body and chassis weight without compromising other attributes such as safety, performance, recyclability, and cost. The work supports the goals of the Partnership for a New Generation of Vehicles (PNGV). Up to thirty percent of the improvement required to meet the PNGV goal of tripling vehicle fuel economy and much of its cost, safety, and recyclability goal depend on the lightweight materials. Funded projects range from basic materials science research to applied research in production environments. Collaborators on these projects include national laboratories, universities, and private sector firms, such as leading automobile manufacturers and their suppliers.

FDG PET/MR for lymph node staging in head and neck cancer

Energy Technology Data Exchange (ETDEWEB)

Platzek, Ivan, E-mail: ivan.platzek@uniklinikum-dresden.de [Dresden University Hospital, Department of Radiology, Fetscherstr. 74, 01307 Dresden (Germany); Beuthien-Baumann, Bettina, E-mail: bettina.beuthien-baumann3@uniklinikum-dresden.de [Dresden University Hospital, Department of Nuclear Medicine, Fetscherstr. 74, 01307 Dresden (Germany); Schneider, Matthias, E-mail: m.schneider@mkgdresden.de [Dresden University Hospital, Department of Oral and Maxillofacial Surgery, Fetscherstr. 74, 01307 Dresden (Germany); Gudziol, Volker, E-mail: volker.gudziol@uniklinikum-dresden.de [Dresden University Hospital, Department of Otolaryngology, Fetscherstr. 74, 01307 Dresden (Germany); Kitzler, Hagen H., E-mail: hagen.kitzler@uniklinikum-dresden.de [Dresden University Hospital, Department of Neuroradiology, Fetscherstr. 74, 01307 Dresden (Germany); Maus, Jens, E-mail: j.maus@hzdr.de [Helmholtz-Zentrum Dresden-Rossendorf, Institute of Radiopharmaceutical Cancer Research, Bautzner Landstr. 400, 01328 Dresden (Germany); Schramm, Georg, E-mail: g.schramm@hzdr.de [Helmholtz-Zentrum Dresden-Rossendorf, Institute of Radiopharmaceutical Cancer Research, Bautzner Landstr. 400, 01328 Dresden (Germany); Popp, Manuel, E-mail: manuel.popp@praxisklinik-dresden.de [Dresden University Hospital, Department of Nuclear Medicine, Fetscherstr. 74, 01307 Dresden (Germany); Laniado, Michael, E-mail: michael.laniado@uniklinikum-dresden.de [Dresden University Hospital, Department of Radiology, Fetscherstr. 74, 01307 Dresden (Germany); Kotzerke, Jörg, E-mail: Joerg.Kotzerke@uniklinikum-dresden.de [Dresden University Hospital, Department of Nuclear Medicine, Fetscherstr. 74, 01307 Dresden (Germany); Hoff, Jörg van den, E-mail: j.van_den_hoff@hzdr.de [Helmholtz-Zentrum Dresden-Rossendorf, Institute of Radiopharmaceutical Cancer Research, Bautzner Landstr. 400, 01328 Dresden (Germany)

2014-07-15

Objective: To assess the diagnostic value of PET/MR (positron emission tomography/magnetic resonance imaging) with FDG (18F-fluorodeoxyglucose) for lymph node staging in head and neck cancer. Materials and methods: This prospective study was approved by the local ethics committee; all patients signed informed consent. Thirty-eight patients with squamous cell carcinoma of the head and neck region underwent a PET scan on a conventional scanner and a subsequent PET/MR on a whole-body hybrid system after a single intravenous injection of FDG. The accuracy of PET, MR and PET/MR for lymph node metastases were compared using receiver operating characteristic (ROC) analysis. Histology served as the reference standard. Results: Metastatic disease was confirmed in 16 (42.1%) of 38 patients and 38 (9.7%) of 391 dissected lymph node levels. There were no significant differences between PET/MR, MR and PET and MR (p > 0.05) regarding accuracy for cervical metastatic disease. Based on lymph node levels, sensitivity and specificity for metastatic involvement were 65.8% and 97.2% for MR, 86.8% and 97.0% for PET and 89.5% and 95.2% for PET/MR. Conclusions: In head and neck cancer, FDG PET/MR does not significantly improve accuracy for cervical lymph node metastases in comparison to MR or PET.

MR arthrographic findings in tenosynovitis of the long bicipital tendon of the shoulder

Energy Technology Data Exchange (ETDEWEB)

Gueckel, C. [Department of Radiology, University Hospital of Basel, Petersgraben 4, CH-4031 Basel (Switzerland); Nidecker, A. [MRI Institut Rebgasse, Untere Rebgasse 18, CH-4058 Basel (Switzerland)

1998-01-01

Purpose. To assess the MR arthrographic findings of bicipital tenosynovitis in correlation with arthroscopy. Design and patients. The shoulder MR arthrographies of 500 consecutive patients were retrospectively analyzed for signs of bicipital tenosynovitis and associated pathologies. Forty patients (8%) had MR evidence of bicipital tenosynovitis, but only 17 (3%) with arthroscopic confirmation were included in the study. The MR findings in these patients were compared with those of 10 patients with rotator cuff lesions but arthroscopically normal long biceps tendons. MR arthrography was performed with 10-15 ml of a 250 mmol/l gadoterate meglumine (Gd-DOTA) solution injected under fluoroscopic guidance, and transaxial, oblique coronal and sagittal MR sequences were obtained. Results. All 17 patients showed one or more abnormal findings: signal increase in the tendon with or without fusiform distension was seen in 12, surface irregularities in six, adhesions in 11 and noncommunicating effusions of the tendon sheath in six. Associated abnormalities of the rotator cuff were present in 16 while the seventeenth patient had glenohumeral synovitis without rotator cuff pathology. MR arthrograms correlated with arthroscopic findings in the joint but comparison was not possible in the intertubercular groove portion of the biceps tendon. None of the 10 patients with an arthroscopically normal biceps tendon showed any of the MR findings of bicipital tenosynovitis. Conclusion. Bicipital tenosynovitis is detectable by MR arthrography. In most cases it is an associated finding of rotator cuff abnormalities and likely to have a similar etiology. When lesions of the anterior rotator cuff are recognized, the biceps tendon should be scrutinized for inflammatory changes. (orig.) With 4 figs., 4 tabs., 22 refs.

FIRST PHOTOMETRIC INVESTIGATION OF THE NEWLY DISCOVERED W UMa-TYPE BINARY STAR MR Com

Energy Technology Data Exchange (ETDEWEB)

Qian, S.-B.; Liu, N.-P.; Liao, W.-P.; He, J.-J.; Liu, L.; Zhu, L.-Y.; Wang, J.-J.; Zhao, E.-G., E-mail: qsb@ynao.ac.cn [Yunnan Observatories, Chinese Academy of Sciences (CAS), P.O. Box 110, 650011 Kunming (China)

2013-08-01

By analyzing multi-color light curves of the newly discovered W UMa-type binary, MR Com, we discovered that it is a shallow-contact binary with a degree of contact factor of f = 10.0% {+-} 2.1%. Photometric solutions reveal that MR Com is a W-type system with a mass ratio of q = 3.9 where the less massive component is about 90 K hotter than the more massive one. By investigating all of the available times of minimum light, we found that the general trend of the Observed-Calculated (O - C) curve shows a downward parabolic variation while it undergoes a cyclic variation with a small amplitude of 0.0031 days and a period of 10.1 yr. The downward parabolic change corresponds to a long-term decrease in the orbital period at a rate of P-dot = -5.3 x 10{sup -7} days yr{sup -1} that may be caused by a combination of a mass transfer and an angular momentum loss (AML) via magnetic braking. Among the 16 shallow-contact systems with a decreasing orbital period, MR Com has the lowest mass ratio (e.g., 1/q = 0.26). The shallow-contact configuration, the low-mass ratio, and the long-term period decrease all suggest that systems similar to MR Com are on the AML-controlled stage of the evolutionary scheme proposed by Qian. They will oscillate around a critical mass ratio and evolve into a deep contact with a higher mass ratio. The small-amplitude cyclic change in the O - C curve was analyzed for the light-travel time effect via the presence of an extremely cool stellar companion.

Research report for fiscal 1998. Research into the trends of low-carbon automotive fuel manufacturing technologies; 1998 nendo jidoshayo teitanso nenryo no seizo gijutsu doko chosa hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-03-01

Studies are made of optimum materials and methods for manufacturing low-carbon fuels for reduction in greenhouse gas emissions. When their thermal dynamic limits and the technological maturity are considered, it is inferred that no extensive improvement will be achieved by merely improving on the efficiency of the existing fuels. The use of various high-efficiency driving power sources utterly different in mechanism from the conventional ones, such as those for fuel cell-powered automobiles, and the promotion of the use of low-carbon fuels such as methanol and methane for all kinds of driving power sources including those for the said fuel cell-powered automobiles, will become necessary. The use will also be necessary of recyclable materials. The biomass resources, in particular, since they absorb CO2 gas in their growing process by virtue of photosynthesis, may be said to be free of CO2 gas emissions. They have their own problems, however, which involve the economy of energy consumed for their production, harvesting, transportation, and conversion into fuels. It is therefore required that their whole life cycle be studied before their greenhouse gas reduction effect may be correctly assessed. The quantities of resources available for the production of automotive low-carbon fuels, manufacturing technologies, etc., are first of all put in order for easy perusal. An effective way is assessed for the whole including the life cycle. (NEDO)

Fuel Rod Performance Evaluation of CE 16 x 16 LTA Operated at Steady State Using Transuranus and Pad Codes

Energy Technology Data Exchange (ETDEWEB)

Krasnorutskyy, V.; Slyeptsov, O. [Nuclear Fuel Cycle Science and Technology Establishment (NFCSTE), National Science Center, Kharkhov Institute of Physics and Technology (NSC KIPT), Kharkhov (Ukraine)

2013-03-15

The report performed under IAEA research contract No. 15370 describes the results of fuel performance evaluation of PWR fuel rods operated at steady state up to discharge burnup of {approx}60 GWD/MTU using the codes of TRANSURANUS designed by ITU and PAD designed by Westinghouse. The experimental results from US-PWR 16x16 LTA Extended Burnup Demonstration Program presented in the IFPE database of the OECD/NEA have been utilized for assessing the codes themselves during simulation of such properties as rod burnup, cladding corrosion, fuel densification and swelling, cladding irradiation growth and strain, FGR and RIP. The results obtained by PAD showed that the code properly simulates rod burnup, cladding irradiation growth and cladding oxidation with Standard Zr-4 material. The calculated burnup values along the fuel stack vary within {+-} 5% of the rod average burnup. The predicted values of the rod axial growth are (0.88-0.94) % and within the measured ones obtained in the burnup range of (50 - 60) GWD/MTU. With allowance made for probability of crud deposition and hot channel hydraulic diameter variation, the axial distribution of oxide layer is predicted well. For the nominal rod dimensions and operation conditions, the calculated peak oxide thickness is slightly overestimated based on the BE corrosion model parameters. The WEC fuel swelling and densification model together with the US NRC one, which is incorporated in the code, were used to assess the change in fuel pellet density ({Delta}{rho}) and fuel volume ({Delta}V{sub F}/V) vs. burnup as well as the rod void volume change, {Delta}V{sub V}/V, and the cladding outer diameter (OD) variation along the fuel stack. (author)

Complete Cubic and Quartic Couplings of 16 and $\\bar{16}$ in SO(10) Unification

CERN Document Server

Syed, R M; Nath, Pran; Syed, Raza M.

2001-01-01

A recently derived basic theorem on the decomposition of SO(2N) vertices is used to obtain a complete analytic determination of all SO(10) invariant cubic superpotential couplings involving $16_{\\pm}$ semispinors of SO(10) chirality $\\pm$ and tensor representations. In addition to the superpotential couplings computed previously using the basic theorem involving the 10, 120 and $\\bar{126}$ tensor representations we compute here couplings involving the 1, 45 and 210 dimensional tensor representations, i.e., we compute the $\\bar{16}_{\\mp}16_{\\pm}1$,$\\bar{16}_{\\mp}16_{\\pm}45$ and $\\bar{16}_{\\mp}16_{\\pm}210$ Higgs couplings in the superpotential. A complete determination of dimension five operators in the superpotential arising from the mediation of the 1, 45 and 210 dimensional representations is also given. The vector couplings $\\bar{16}_{\\pm}16_{\\pm}1$, $\\bar{16}_{\\pm}16_{\\pm}45$ and $\\bar{16}_{\\pm}16_{\\pm}210$ are also analyzed. The role of large tensor representations and the possible application of results ...

Automotive Painting Technology A Monozukuri-Hitozukuri Perspective

CERN Document Server

Salazar, Abraham; Saito, Kozo

2013-01-01

This book offers unique and valuable contributions to the field. It offers breadth and inclusiveness. Most existing works on automotive painting cover only a single aspect of this complex topic, such as the chemistry of paint or paint booth technology. Monozukuri and Hitozukuri are Japanese terms that can be translated as “making things” and “developing people” but their implications in Japanese are richer and more complex than this minimal translation would indicate. The Monozukuri-Hitozukuri perspective is drawn from essential principles on which the Toyota approach to problem-solving and continuous improvement is based. From this perspective, neither painting technology R&D nor painting technology use in manufacturing can be done successfully without integrating technological and human concerns involved with making and learning in the broadest sense, as the hyphen is meant to indicate. The editors provide case studies and examples -- drawn from Mr. Toda’s 33 years of experience with automotiv...

Engine Tune-Up Service. Unit 5: Fuel and Carburetion Systems. Posttests. Automotive Mechanics Curriculum.

Science.gov (United States)

Morse, David T.

This book of posttests is designed to accompany the Engine Tune-Up Service Student Guide for Unit 5, Fuel and Carburetion Systems; available separately as CE 031 217. Focus of the posttests is the inspecting and servicing of the fuel and carburetion systems. One multiple choice posttest is provided that covers the 10 performance objectives…

Inhibitory Effect of Dried Pomegranate Concentration Powder on Melanogenesis in B16F10 Melanoma Cells; Involvement of p38 and PKA Signaling Pathways

Directory of Open Access Journals (Sweden)

Su Jin Kang

2015-10-01

Full Text Available Plants rich in antioxidant substances may be useful for preventing skin aging. Pomegranates, containing flavonoids and other polyphenolic compounds, are widely consumed due to their beneficial properties. We examined the underlying mechanisms of dried pomegranate concentrate powder (PCP on melanin synthesis in B16F10 melanoma cells. The antioxidant effects of PCP were determined by measuring free radical scavenging capacity and transcript levels of antioxidant enzymes. To explore the inhibitory effects of PCP on melanin synthesis, we measured tyrosinase activity and melanin content in α-melanocyte stimulating hormone (α-MSH-stimulated B16F10 cells. In addition, the levels of tyrosinase-related protein-1 (TRP-1, TRP-2, tyrosinase, and microphthalmia-associated transcription factor (MITF expression were determined by Western blotting. Changes in the phosphorylation status of protein kinase A (PKA, cAMP response element-binding protein (CREB, mitogen-activated protein kinases (MAPKs, phosphatidylinositol 3-kinase (PI3K, serine/threonine kinase Akt, and glycogen kinase 3β (GSK3β were also examined. The free radical scavenging activity of PCP increased in a dose-dependent manner. In PCP-treated B16F10 cells, transcript levels of glutathione peroxidase-1 (GPx-1 were increased compared with α-MSH-stimulated cells. In addition, PCP led to the down-regulation of phospho-p38, phospho-PKA, phospho-CREB, phospho-GSK3β, MITF, and TRP-1 compared with α-MSH-stimulated B16F10 cells. We believe this effect may be associated with PCP activity, which leads to the inhibition of melanin production and tyrosinase activity. These results suggest that PCP decreases tyrosinase activity and melanin production via inactivation of the p38 and PKA signaling pathways, and subsequently decreases phosphorylation of CREB, MITF, and melanogenic enzymes. These observations provided new insights on the molecular mechanisms of the skin-whitening property of PCP.

Inhibitory Effect of Dried Pomegranate Concentration Powder on Melanogenesis in B16F10 Melanoma Cells; Involvement of p38 and PKA Signaling Pathways

Science.gov (United States)

Kang, Su Jin; Choi, Beom Rak; Lee, Eun Kyoung; Kim, Seung Hee; Yi, Hae Yeon; Park, Hye Rim; Song, Chang Hyun; Lee, Young Joon; Ku, Sae Kwang

2015-01-01

Plants rich in antioxidant substances may be useful for preventing skin aging. Pomegranates, containing flavonoids and other polyphenolic compounds, are widely consumed due to their beneficial properties. We examined the underlying mechanisms of dried pomegranate concentrate powder (PCP) on melanin synthesis in B16F10 melanoma cells. The antioxidant effects of PCP were determined by measuring free radical scavenging capacity and transcript levels of antioxidant enzymes. To explore the inhibitory effects of PCP on melanin synthesis, we measured tyrosinase activity and melanin content in α-melanocyte stimulating hormone (α-MSH)-stimulated B16F10 cells. In addition, the levels of tyrosinase-related protein-1 (TRP-1), TRP-2, tyrosinase, and microphthalmia-associated transcription factor (MITF) expression were determined by Western blotting. Changes in the phosphorylation status of protein kinase A (PKA), cAMP response element-binding protein (CREB), mitogen-activated protein kinases (MAPKs), phosphatidylinositol 3-kinase (PI3K), serine/threonine kinase Akt, and glycogen kinase 3β (GSK3β) were also examined. The free radical scavenging activity of PCP increased in a dose-dependent manner. In PCP-treated B16F10 cells, transcript levels of glutathione peroxidase-1 (GPx-1) were increased compared with α-MSH-stimulated cells. In addition, PCP led to the down-regulation of phospho-p38, phospho-PKA, phospho-CREB, phospho-GSK3β, MITF, and TRP-1 compared with α-MSH-stimulated B16F10 cells. We believe this effect may be associated with PCP activity, which leads to the inhibition of melanin production and tyrosinase activity. These results suggest that PCP decreases tyrosinase activity and melanin production via inactivation of the p38 and PKA signaling pathways, and subsequently decreases phosphorylation of CREB, MITF, and melanogenic enzymes. These observations provided new insights on the molecular mechanisms of the skin-whitening property of PCP. PMID:26473849

A comparative study of MR imaging scores and MR perfusion imaging in pre-operative grading of intracranial gliomas

International Nuclear Information System (INIS)

Wu Honglin; Chen Junkun; Zhang Zongjun; Lu Guangming; Chen Ziqian; Wang Wei; Ji Xueman; Tang Xiaojun; Li Lin

2005-01-01

Objective: To compare the accuracy of MR imaging scores with MR perfusion imaging in pre-operative grading of intracranial gliomas. Methods: Thirty patients with intracranial gliomas (8 low-grade and 22 high-grade, according to WHO criteria) were examined with MR perfusion imaging pre-operatively. The lesions were evaluated by using an MR imaging score based on nine criteria. rCBV of the lesions were calculated by comparing the CBV of the lesion and that of contralateral normal white matter. The scores and ratios in high-grade and low-grade tumours were compared. Results: The MR imaging score of low grade (grades I and II) gliomas (0.67±0.29) were significantly lower than that of grades III (1.32 ± 0.47) (t=-3.48, P=0.003) and IV (1.56 ± 0.20) (t=-7.36, P=0.000) gliomas. There was no statistical difference when MR imaging scores of grades III and IV gliomas (t=-1.39, P=0.182) were compared. The maximum rCBV ratio of low grade (grades I and II) gliomas (2.38 ± 0.66 ) were significantly lower than that of grades III (5.81 ± 3.20) (t=-3.57, P=0.003) and IV (6.99 ± 2.47) (t=-5.09, P=0.001). There was no statistical difference when rCBV ratios of grades III and IV (t =-0.93, P=0.365) gliomas were compared. The accuracy of MR imaging scores in the noninvasive grading of untreated gliomas was all most the same as that of MR perfusion imaging (90.00% vs 89.29%). Conclusion: The MR imaging scores and MR perfusion imaging are two very useful tools in the evaluation of the histopathologic grade of cerebral gliomas. The overall accuracy in the noninvasive grading of gliomas may be imp roved if MR imaging scores and MR perfusion imaging are combined. (authors)

Single pion and several pions production in π+p interactions at 1.6 GeV/c

International Nuclear Information System (INIS)

Jabiol, M.A.

1966-01-01

The production of ρ + , N 33 * , and η 0 was observed in π + p interactions at 1.6 GeV/c. In the reactions where one pion is created, the comparison between the experimental distribution of the ρ + and the N 33 * with the predictions of the peripheral model modified by absorption effects permits the conclusion that the contribution of this model is important, but that other effects such as interferences between ρ + and N 33 * are not negligible. In the reactions where several pions are created, the branching ratios of some decay modes of η0 are evaluated and the associated production of η 0 and N 33 * is observed. (author) [fr

MR imaging at 0.5 Tesla with FLAIR sequence in the diagnosis of acute subarachnoid hemorrhage

International Nuclear Information System (INIS)

Kopsa, W.; Leitner, H.; Tscholakoff, D.; Perneczky, G.

1998-01-01

Purpose: Evaluation of MR imaging in patients with acute subarachnoid hemorrhage (SAH) at 0.5 Tesla using the FLAIR (Fluid Attenuated Inversion Recovery) sequenze. Additionally, the value of MR angiographie (MRA) in the diagnosis of intracranial aneurysms was assessed. Materials and Methods: 19 patients with suspected acute SAH were included in this study. MR imaging was performed using an axial FLAIR sequence and axial T 1 , T 2 and PD weighted sequences. In 16 patients an additional MRA (3D-TOF) was performed. 10 patients without SAH were examined as a control group. At the end of the study the 29 MR examinations were randomised and the images were read by two experienced radiologists; subsequently a consensus interpretation was made. Results: In 16 patients an acute SAH was verified with the FLAIR sequence, in 13 cases the origin of hemorrhage was found during surgery. In the consensus interpretation of the MR images all cases were diagnosed properly. 12 of the 16 MRA studies were of diagnostic quality, but only 6 cases were interpreted correctly. Conclusion: The FLAIR sequence at 0.5 Tesla proved effective in the diagnosis of acute SAH. MRA at 0.5 Tesla failed in the detection of intracranial aneurysms. (orig.) [de

Hippocampal MR volumetry

Science.gov (United States)

Haller, John W.; Botteron, K.; Brunsden, Barry S.; Sheline, Yvette I.; Walkup, Ronald K.; Black, Kevin J.; Gado, Mokhtar; Vannier, Michael W.

1994-09-01

Goal: To estimate hippocampal volumes from in vivo 3D magnetic resonance (MR) brain images and determine inter-rater and intra- rater repeatability. Objective: The precision and repeatability of hippocampal volume estimates using stereologic measurement methods is sought. Design: Five normal control and five schizophrenic subjects were MR scanned using a MPRAGE protocol. Fixed grid stereologic methods were used to estimate hippocampal volumes on a graphics workstation. The images were preprocessed using histogram analysis to standardize 3D MR image scaling from 16 to 8 bits and image volumes were interpolated to 0.5 mm3 isotropic voxels. The following variables were constant for the repeated stereologic measures: grid size, inter-slice distance (1.5 mm), voxel dimensions (0.5 mm3), number of hippocampi measured (10), total number of measurements per rater (40), and number of raters (5). Two grid sizes were tested to determine the coefficient of error associated with the number of sampled 'hits' (approximately 140 and 280) on the hippocampus. Starting slice and grid position were randomly varied to assure unbiased volume estimates. Raters were blind to subject identity, diagnosis, and side of the brain from which the image volumes were extracted and the order of subject presentation was randomized for each of the raters. Inter- and intra-rater intraclass correlation coefficients (ICC) were determined. Results: The data indicate excellent repeatability of fixed grid stereologic hippocampal volume measures when using an inter-slice distance of 1.5 mm and a 6.25 mm2 grid (inter-rater ICCs equals 0.86 - 0.97, intra- rater ICCs equals 0.85 - 0.97). One major advantage of the current study was the use of 3D MR data which significantly improved visualization of hippocampal boundaries by providing the ability to access simultaneous orthogonal views while counting stereological marks within the hippocampus. Conclusion: Stereological estimates of 3D volumes from 2D MR

Evaluation of the environmental impact of modern passenger cars on petrol, diesel, automotive LPG and CNG

NARCIS (Netherlands)

Hendriksen, P.; Vermeulen, R.J.; Rijkeboer, R.C.; Bremmers, D.A.C.M.; Smokers, R.T.M.; Winkel, R.G.

2003-01-01

The project reported here concerns an investigation into the environmental performance of modern passenger cars on four different fuels: petrol, diesel, automotive LPG and CNG. The objectives of the project were twofold: - To make a valid and useful comparison between modern vehicles fuelled by

In situ responses of a biological indicator Mytilus edulis L. to the variations of radionuclide discharges from a fuel reprocessing plant

International Nuclear Information System (INIS)

Masson, Michel; Leon, Rene; Miramand, Pierre; Germain, Pierre.

1983-01-01

The introduction of 10 lots of 100kg of mussels in La Hague waters made it possible to investigate the in situ uptake kinetics of 106 Ru + 106 Rh released by the fuel reprocessing plant of La Hague during 1 year. Equilibrium was reached within 1 - 3 months, whatever the time of introduction and the amounts released. The removal of the mussels labelled at La Hague to a remote aera made it possible to calculate the biological half-life of 106 Ru + 106 Rh, viz from 16 to 18 days [fr

Early evaluation of irradiated parotid glands with intravoxel incoherent motion MR imaging: correlation with dynamic contrast-enhanced MR imaging

International Nuclear Information System (INIS)

Zhou, Nan; Chu, Chen; Dou, Xin; Li, Ming; Liu, Song; Zhu, Lijing; Liu, Baorui; Guo, Tingting; Chen, Weibo; He, Jian; Yan, Jing; Zhou, Zhengyang; Yang, Xiaofeng; Liu, Tian

2016-01-01

Radiation-induced parotid damage is one of the most common complications in patients with nasopharyngeal carcinoma (NPC) undergoing radiotherapy (RT). Intravoxel incoherent motion (IVIM) magnetic resonance (MR) imaging has been reported for evaluating irradiated parotid damage. However, the changes of IVIM perfusion-related parameters in irradiated parotid glands have not been confirmed by conventional perfusion measurements obtained from dynamic contrast-enhanced (DCE) MR imaging. The purposes of this study were to monitor radiation-induced parotid damage using IVIM and DCE MR imaging and to investigate the correlations between changes of these MR parameters. Eighteen NPC patients underwent bilateral parotid T1-weighted, IVIM and DCE MR imaging pre-RT (2 weeks before RT) and post-RT (4 weeks after RT). Parotid volume; IVIM MR parameters, including apparent diffusion coefficient (ADC), pure diffusion coefficient (D), pseudo-diffusion coefficient (D*), and perfusion fraction (f); and DCE MR parameters, including maximum relative enhancement (MRE), time to peak (TTP), Wash in Rate, and the degree of xerostomia were recorded. Correlations of parotid MR parameters with mean radiation dose, atrophy rate and xerostomia degree, as well as the relationships between IVIM and DCE MR parameters, were investigated. From pre-RT to post-RT, all of the IVIM and DCE MR parameters increased significantly (p < 0.001 for ADC, D, f, MRE, Wash in Rate; p = 0.024 for D*; p = 0.037 for TTP). Change rates of ADC, f and MRE were negatively correlated with atrophy rate significantly (all p < 0.05). Significant correlations were observed between the change rates of D* and MRE (r = 0.371, p = 0.026) and between the change rates of D* and TTP (r = 0.396, p = 0.017). The intra- and interobserver reproducibility of IVIM and DCE MR parameters was good to excellent (intraclass correlation coefficient, 0.633–0.983). Early radiation-induced changes of parotid glands could be evaluated by IVIM and

An innovative magnetorheological damper for automotive suspension: from design to experimental characterization

Science.gov (United States)

Sassi, Sadok; Cherif, Khaled; Mezghani, Lotfi; Thomas, Marc; Kotrane, Asma

2005-08-01

The development of a powerful new magnetorheological fluid (MRF), together with recent progress in the understanding of the behavior of such fluids, has convinced researchers and engineers that MRF dampers are among the most promising devices for semi-active automotive suspension vibration control, because of their large force capacity and their inherent ability to provide a simple, fast and robust interface between electronic controls and mechanical components. In this paper, theoretical and experimental studies are performed for the design, development and testing of a completely new MRF damper model that can be used for the semi-active control of automotive suspensions. The MR damper technology presented in this paper is based on a completely new approach where, in contrast to in the conventional solutions where the coil axis is usually superposed on the damper axis and where the inner cylindrical housing is part of the magnetic circuit, the coils are wound in a direction perpendicular to the damper axis. The paper investigates approaches to optimizing the dynamic response and provides experimental verification. Both experimental and theoretical results have shown that, if this particular model is filled with an 'MRF 336AG' MR fluid, it can provide large controllable damping forces that require only a small amount of energy. For a magnetizing system with four coils, the damping coefficient could be increased by up to three times for an excitation current of only 2 A. Such current could be reduced to less than 1 A if the magnetizing system used eight small cores. In this case, the magnetic field will be more powerful and more regularly distributed. In the presence of harmonic excitation, such a design will allow the optimum compromise between comfort and stability to be reached over different intervals of the excitation frequencies.

75 FR 34483 - In the Matter of Certain Automotive Vehicles and Designs Therefore; Notice of Investigation

Science.gov (United States)

2010-06-17

... automotive vehicles and designs therefore that infringe U.S. Patent No. D513,395, and whether an industry in... Industry Zone, Yongkang, Zhejiang Province, China 321307. Shanghai Xingyue Power Machinery Co. Ltd., No... INTERNATIONAL TRADE COMMISSION [Inv. No. 337-TA-722] In the Matter of Certain Automotive Vehicles...

Comparison of MR-based attenuation correction and CT-based attenuation correction of whole-body PET/MR imaging

International Nuclear Information System (INIS)

Izquierdo-Garcia, David; Sawiak, Stephen J.; Knesaurek, Karin; Machac, Joseph; Narula, Jagat; Fuster, Valentin; Fayad, Zahi A.

2014-01-01

The objective of this study was to evaluate the performance of the built-in MR-based attenuation correction (MRAC) included in the combined whole-body Ingenuity TF PET/MR scanner and compare it to the performance of CT-based attenuation correction (CTAC) as the gold standard. Included in the study were 26 patients who underwent clinical whole-body FDG PET/CT imaging and subsequently PET/MR imaging (mean delay 100 min). Patients were separated into two groups: the alpha group (14 patients) without MR coils during PET/MR imaging and the beta group (12 patients) with MR coils present (neurovascular, spine, cardiac and torso coils). All images were coregistered to the same space (PET/MR). The two PET images from PET/MR reconstructed using MRAC and CTAC were compared by voxel-based and region-based methods (with ten regions of interest, ROIs). Lesions were also compared by an experienced clinician. Body mass index and lung density showed significant differences between the alpha and beta groups. Right and left lung densities were also significantly different within each group. The percentage differences in uptake values using MRAC in relation to those using CTAC were greater in the beta group than in the alpha group (alpha group -0.2 ± 33.6 %, R 2 = 0.98, p 2 = 0.97, p < 0.001). In comparison to CTAC, MRAC led to underestimation of the PET values by less than 10 % on average, although some ROIs and lesions did differ by more (including the spine, lung and heart). The beta group (imaged with coils present) showed increased overall PET quantification as well as increased variability compared to the alpha group (imaged without coils). PET data reconstructed with MRAC and CTAC showed some differences, mostly in relation to air pockets, metallic implants and attenuation differences in large bone areas (such as the pelvis and spine) due to the segmentation limitation of the MRAC method. (orig.)

Dysembryoplastic neuroepithelial tumors: proton MR spectroscopy, diffusion and perfusion characteristics

Energy Technology Data Exchange (ETDEWEB)

Bulakbasi, Nail; Kocaoglu, Murat; Sanal, Tuba H.; Tayfun, Cem [Gulhane Military Medical Academy, Department of Radiology, Military Medical Faculty, Ankara (Turkey)

2007-10-15

We describe the magnetic resonance (MR) imaging characteristics of dysembryoplastic neuroepithelial tumors (DNT) and discuss their differential diagnosis. Proton MR spectroscopy (TE 30 and 136 ms), diffusion-weighted and perfusion images were retrospectively evaluated in 22 patients with pathologically proven DNT (17 male and 5 female, mean age 18.7 years) and 14 control subjects (10 male and 4 female, mean age 16.9 years). The results from the DNT patients and from the control subjects were compared using an independent sample t-test and the degree of correlation was tested by Pearson's correlation. All DNTs were solitary and in a supratentorial cortical or subcortical location (ten temporal, eight frontal and four parietal). They had low-signal on T1-weighted images and high-signal on T2-weighted images without a prominent mass effect. Additionally a cystic appearance (six patients, 27.3%), cortical dysplasia (six patients, 27.3%) and contrast enhancement (four patients, 18.2%) were also noted. No significant differences were detected in NAA/Cho, NAA/Cr, NAA/Cho+Cr or Cho/Cr ratios between DNT and normal brain. DNTs had a significantly higher mI/Cr ratio and apparent diffusion coefficient (ADC) values and lower cerebral blood values than normal parenchyma (P < 0.001). ADC had the highest correlation with the diagnosis of DNT (r = 0.996) followed by relative cerebral blood volume (rCBV) (r = -0.883) and mI/Cr ratio (r = 0.663). Proton MR spectroscopy, diffusion-weighted and perfusion imaging characteristics of DNTs provide additional information to their MR imaging findings. The MR spectrum showing a slight increase in mI/Cr ratio, and higher ADC and lower rCBV values than normal parenchyma help to differentiate DNTs from other cortical tumors, which had higher rCBV and lower ADC values than DNTs. (orig.)

MR findings of cerebral palsy and clinical correlation

Energy Technology Data Exchange (ETDEWEB)

Kim, Sun Ho; Kim, In One; Kim, Woo Sun; Yeon, Kyung Mo [Seoul National Univ. College of Medicine, Seoul (Korea, Republic of)

1997-04-01

To demonstrate MR findings of cerebral palsy (CP), correlation with clinical findings, and differences between the full-term and pre-term group. Brain MRI of 94 patients with cerebral palsy (CP) were reviewed. The frequency of each MR finding, statistical correlation with clinical findings including type, severity and extent of CP, and differences between the full-term and pre-term group were analyzed. Abnormal MR findings were found in 83 patients(88%), and were as follows : diffuse brain atrophy(30%); periventricular leukomalacia(PVL)(28%); infarction(11%), basal ganglia abnormality(11%); delayed myelination(10%); nonspecific tissue loss or encephalomalacia(9%); and cortical dysplasia(7%). Hemiplegia was the most common condition among patients with infarction, and was found in 80% of this group; diplegia was found in 50% of cases with diffuse brain atrophy, while paraplegia was found in 36% of those with normal MR findings (p < .05). Mild symptoms were dominant in patients with normal MR findings(82%) and in those with infarctions(90%)(p < .05). PVL was the dominant finding in the pre-term group (65%) whereas findings in the full-term group varied; in this group, 38% of MR findings suggested prenatal insults. Possible causative factors were found in 66% of the full-term and 80% of the pre-term group. Perinatal factors were dominant in the pre-term group(81%), whereas prenatal and postnatal factors showed relatively higher frequencies in the full-term group(30% and 24%, respectively). Diffuse brain atrophy and PVL were the most common MR findings. The extent of CP the pre-term correlated well with MR findings. PVL and perinatal factors were dominant in the pre-term group, whereas variable MR findings and relatively higher frequencies of pre- and postnatal factors were found in the full-term group.

MR findings of cerebral palsy and clinical correlation

International Nuclear Information System (INIS)

Kim, Sun Ho; Kim, In One; Kim, Woo Sun; Yeon, Kyung Mo

1997-01-01

To demonstrate MR findings of cerebral palsy (CP), correlation with clinical findings, and differences between the full-term and pre-term group. Brain MRI of 94 patients with cerebral palsy (CP) were reviewed. The frequency of each MR finding, statistical correlation with clinical findings including type, severity and extent of CP, and differences between the full-term and pre-term group were analyzed. Abnormal MR findings were found in 83 patients(88%), and were as follows : diffuse brain atrophy(30%); periventricular leukomalacia(PVL)(28%); infarction(11%), basal ganglia abnormality(11%); delayed myelination(10%); nonspecific tissue loss or encephalomalacia(9%); and cortical dysplasia(7%). Hemiplegia was the most common condition among patients with infarction, and was found in 80% of this group; diplegia was found in 50% of cases with diffuse brain atrophy, while paraplegia was found in 36% of those with normal MR findings (p < .05). Mild symptoms were dominant in patients with normal MR findings(82%) and in those with infarctions(90%)(p < .05). PVL was the dominant finding in the pre-term group (65%) whereas findings in the full-term group varied; in this group, 38% of MR findings suggested prenatal insults. Possible causative factors were found in 66% of the full-term and 80% of the pre-term group. Perinatal factors were dominant in the pre-term group(81%), whereas prenatal and postnatal factors showed relatively higher frequencies in the full-term group(30% and 24%, respectively). Diffuse brain atrophy and PVL were the most common MR findings. The extent of CP the pre-term correlated well with MR findings. PVL and perinatal factors were dominant in the pre-term group, whereas variable MR findings and relatively higher frequencies of pre- and postnatal factors were found in the full-term group

Evaluation of severity in aplastic anemia by MR imaging

Energy Technology Data Exchange (ETDEWEB)

Park, Jeong Mi; Lim, Gye Yeon; Kim, Euy Neyng; Lee, Jae Mun; Kim, Dong Wook; Han, Chi Wha; Kim, Chun Choo [The Catholic University College of Medicine, Seoul (Korea, Republic of)

1999-02-01

To evaluate the role of bone marrow (BM) magnetic resonance (MR) imaging for assessment of the severity of aplastic anemia (AA). Eighty patients with AA, ranging in age from 16 to 44 years underwent MR imaging. Fifty four patients had clinically severe AA(SAA), while in 26 the condition was moderate(MAA). Sagittal T1-weighted images (T1WI) and short tau inversion recovery (STIR) images of lumbar vertebral BM were analysed. Bulk T1, T2 and rho values (msec) were also measured, with mixed sequences. Signal intensity (SI) on both T1WI and STIR was classified into four patterns according to the amount fatty marrow : pattern I, homogeneous fatty marrow ; 2, fatty marrow with focal cellular nodules ; 3, mixed fatty and cellular marrow ; 4, cellular marrow with focal fatty nodules. These SI patterns and bulk T1, T2 and rho values of the lumbar BM were compared with the clinical severity of AA. On both T1WI and STIR sequences, MR imaging of lumbar vertebral BM in patients with AA showed various SI patterns. Pattern 1, 2 and 3 were much frequently seen in the SAA group (48 of 54 patients on T1WI and 43 of 54 on STIR) and pattern 4 was common in the MAA group (16 of 26 patients on T1WI and 18 of 26 on STIR). The SI patterns of AA seen on both T1WI and STIR sequences closely correlated with clinical severity (x 2 test, p=0.0001). Bulk T1 value was significantly different between SAA and MAA (SAA : 382.82msec {+-} 113.91 ; MAA : 517.99msec {+-} 151.92 ; t test, p=0.0001). The SI pattern seen on MR imaging, and T1 relaxation time of lumbar spinal BM can be useful for assessing the severity of AA.

Evaluation of severity in aplastic anemia by MR imaging

International Nuclear Information System (INIS)

Park, Jeong Mi; Lim, Gye Yeon; Kim, Euy Neyng; Lee, Jae Mun; Kim, Dong Wook; Han, Chi Wha; Kim, Chun Choo

1999-01-01

To evaluate the role of bone marrow (BM) magnetic resonance (MR) imaging for assessment of the severity of aplastic anemia (AA). Eighty patients with AA, ranging in age from 16 to 44 years underwent MR imaging. Fifty four patients had clinically severe AA(SAA), while in 26 the condition was moderate(MAA). Sagittal T1-weighted images (T1WI) and short tau inversion recovery (STIR) images of lumbar vertebral BM were analysed. Bulk T1, T2 and rho values (msec) were also measured, with mixed sequences. Signal intensity (SI) on both T1WI and STIR was classified into four patterns according to the amount fatty marrow : pattern I, homogeneous fatty marrow ; 2, fatty marrow with focal cellular nodules ; 3, mixed fatty and cellular marrow ; 4, cellular marrow with focal fatty nodules. These SI patterns and bulk T1, T2 and rho values of the lumbar BM were compared with the clinical severity of AA. On both T1WI and STIR sequences, MR imaging of lumbar vertebral BM in patients with AA showed various SI patterns. Pattern 1, 2 and 3 were much frequently seen in the SAA group (48 of 54 patients on T1WI and 43 of 54 on STIR) and pattern 4 was common in the MAA group (16 of 26 patients on T1WI and 18 of 26 on STIR). The SI patterns of AA seen on both T1WI and STIR sequences closely correlated with clinical severity (x 2 test, p=0.0001). Bulk T1 value was significantly different between SAA and MAA (SAA : 382.82msec ± 113.91 ; MAA : 517.99msec ± 151.92 ; t test, p=0.0001). The SI pattern seen on MR imaging, and T1 relaxation time of lumbar spinal BM can be useful for assessing the severity of AA

Functional MR imaging in the patients with complex partial seizures

International Nuclear Information System (INIS)

Chung, Jin Il; Chang, Kee Hyun; Song, In Chan; Goo, Jin Mo; Chung, Chun Kee; Lee, Sang Kun; Kim, Hong Dae; Han, Moon Hee; Kim, Sam Soo

1999-01-01

To evaluate the clinical usefulness of functional MR imaging (fMRI) for localization of the cerebral motor and sensory cortices and language center in patients with complex partial seizure. A total of 47 fMRIs were obtained in 14 patients (M:F = 9:5; age 15-50 years; 13 right handed and 1 ambidextrous) with complex partial seizure (6 temporal lobe epilepsy, 6 frontal lobe epilepsy, 1 occipitotemporal lobe epilepsy, 1 hemispheric epilepsy). Conventional MR imaging revealed no abnormality in four patients, localized cerebral atrophy in one, hippocampal sclerosis in four, and benign neoplasm in the remaining five. fMRI was performed on a 1.5 T MR scanner (GE Signa Horizon) using gradient-echo singleshot EPI. Nineteen fMRIs were obtained in eight patients who performed the language task, 16 fMRIs in ten who performed the motor task and 12 fMRIs in ten who performed the somatosensory task. The activation task consisted of three language tasks (silent picture naming , word generation from a character, categorical word generation), motor tasks (opposition of thumb and index finger for hand/dorsifexion or extension for foot), and sensory tasks (passive tactile stimulation of hand or foot using a toothbrush). The data were analyzed using z-score (p<0.05), clustering, and cross-correlation analysis based upon homemade software, IDL 5.1. The success rate for obtaining meaningful fMRI was evaluated and activated regions were assessed on the basis of each fMRI obtained during, language, motor, and somatosensory tasks. fMRI findings were compared with those of the Wada test (n = 7) for language lateralization and with invasive cortical mapping (n = 3) for the localization of eloquent cerebral cortex, especially around the central sulcus. The overall success rate of fMRI was 79 % (37/47); success rates of fMRI with language, sensory, and motor task were 89% (17/19), 83 % (10/12), and 63 % (10/16), respectively. Areas activated during language tasks (n=17) included the

Complete cubic and quartic couplings of 16 and 16-bar in SO(10) unification

International Nuclear Information System (INIS)

Nath, Pran; Syed, Raza M.

2001-01-01

A recently derived basic theorem on the decomposition of SO(2N) vertices is used to obtain a complete analytic determination of all SO(10)-invariant cubic superpotential couplings involving 16 ± semispinors of SO(10) chirality ± and tensor representations. In addition to the superpotential couplings computed previously using the basic theorem involving the 10, 120 and 126-bar tensor representations we compute here couplings involving the 1-, 45- and 210-dimensional tensor representations, i.e., we compute the 16-bar -+ 16 ± 1, 16-bar -+ 16 ± 45 and 16-bar -+ 16 ± 210 Higgs couplings in the superpotential. A complete determination of dimension five operators in the superpotential arising from the mediation of the 1-, 45- and 210-dimensional representations is also given. The vector couplings 16-bar ± 16 ± 1, 16-bar ± 16 ± 45 and 16-bar ± 16 ± 210 are also analyzed. The role of large tensor representations and the possible application of results derived here in model building are discussed

A Descriptive Study of Pediatric Injury Patterns from the National Automotive Sampling System

Science.gov (United States)

Newgard, C; Jolly, BT

1998-01-01

This study describes information from the National Automotive Sampling System for injury mechanisms in the pediatric age group (age 0–16). The total number of pediatric cases in the NASS database for this three year sampling period is 2141(weighted 591,084). No restraint use was identified in 23–43% of the children. For age < 1yr, 60% of patients suffer a facial injury. Head injuries make up only 10% of the total injuries, but are severe. For those age 1–4 yrs abdominal injuries and lower extremity injuries begin to appear. For those age 5–10 yrs, the predominant change over younger occupants is the proportion of spinal injuries. By age 11–16, injuries to the spine, upper extremities, and lower extremities outnumber injuries to the face and head. However, in this population, the greatest proportions of AIS 3–5 injuries still occur to the head and abdomen.

28 CFR 16.10 - Preservation of records.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Preservation of records. 16.10 Section 16.10 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE OF MATERIAL OR INFORMATION... title 44 of the United States Code or the National Archives and Records Administration's General Records...

Deus: metafísica e pensar pós-metafísico (God: metaphysics and post-metaphysical thinking - DOI: 10.5752/P.2175-5841.2010v8n16p8

Directory of Open Access Journals (Sweden)

Ibraim Vitor de Oliveira

2010-04-01

Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} Editorial - Dossiê: Pensamento pós-metafísico e discurso sobre Deus – (Dossier: Post-metaphysical thought and speech about God Normal 0 21 false false false MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} Deus: metafísica e pensar pós-metafísico (God: metaphysics and post-metaphysical thinking - DOI: 10.5752/P.2175-5841.2010v8n16p8 

Automotive History and Development of the Automobile; Automotive Mechanics I: 9043.01.

Science.gov (United States)

Dade County Public Schools, Miami, FL.

The automotive history and development of the automobile course is designed to familiarize the beginning student with basic concepts common to the automobile history and general information that is required for successful advancement in the automotive mechanics field. A course outline is provided and seven pages of post-tests are included in the…

Design and Construction Rules for Mechanical components of FBR nuclear islands: RCC-MR. Tome 1, Volume A: generalities

International Nuclear Information System (INIS)

1985-06-01

The French Rules of Mechanical equipments of Fast Neutron nuclear Reactors (RCC-MR) aims at equipments included in a safety classification. The equipments concerned are those of the nuclear boiler and its auxiliaries: tanks, vessels, internal equipments of the reactor, exchangers, pumps, fittings, pipes, and supports. The present edition of the RCC-MR comprises 12 books presented in the present one in the volume A. The chapter RA 3000 defines the documents to be established in application of the RCC-MR rules. The chapter RA 5000 defines the requirements to take into account to establish and carry out quality Assurance programs according to the RCC-MR rules [fr

Quantification of fat using chemical shift imaging and 1H-MR spectroscopy in phantom model

International Nuclear Information System (INIS)