WorldWideScience

Sample records for forged s-816 x-40

  1. 40 CFR 467.40 - Applicability; description of the forging subcategory.

    Science.gov (United States)

    2010-07-01

    ... forging subcategory. 467.40 Section 467.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS ALUMINUM FORMING POINT SOURCE CATEGORY Forging Subcategory § 467.40 Applicability; description of the forging subcategory. This subpart applies to discharges of...

  2. 31 CFR 370.40 - Can I be held accountable if my negligence contributes to a forged signature?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Can I be held accountable if my negligence contributes to a forged signature? 370.40 Section 370.40 Money and Finance: Treasury Regulations... if my negligence contributes to a forged signature? (a) General. If your failure to exercise ordinary...

  3. Properties of powder metallurgy steel forgings

    International Nuclear Information System (INIS)

    Crowson, A.; Anderson, F.E.

    1977-01-01

    The effects of processing variables on the mechanical properties of heat-treated powder metallurgy (P/M) steel forgings were determined. Prealloyed 4600 steel powder blended with graphite to yield 4640 was compacted into preforms and hot forged in a warm, closed die. Variables studied were preform density, method of lubrication, preform sintering (time, temperature and atmosphere), forging pressure (20 and 40 tsi) and temperature (1850 0 F, 2000 0 F and 2200 0 F), and forging ratio (0.75 and 0.95). Relationships between interconnected porosity and total porosity for the various preform densities were determined. High density compacts required higher sintering temperatures due to the restricted mobility of the reducing gases in the pores. Die wall lubrication was comparable to admixed lubrication, and it simplified powder mixing and preform sintering operations. Forgings with densities from 99 to 99.8 percent of theoretical density were attained with a forging pressure of 20 to 40 tsi and preform temperatures of 2000 0 F and above. At forging conditions which resulted in forgings with acceptable mechanical properties, complete die fill was accomplished at a forging ratio of 0.95, whereas incomplete die fill resulted at a forging ratio of 0.75. The response of P/M forgings to heat treatment was comparable to that for wrought materials, and the resultant tensile and yield strengths were equivalent to the strength values described for wrought 4640 steel in AMS specification 6317B. In addition, ductility and impact properties of P/M forgings with near theoretical density (99.5+ percent) were comparable to bar stock forgings

  4. X-ray tomography studies on porosity and particle size distribution in cast in-situ Al-Cu-TiB{sub 2} semi-solid forged composites

    Energy Technology Data Exchange (ETDEWEB)

    Mathew, James; Mandal, Animesh [School of Minerals, Metallurgical and Materials Engineering, Indian Institute of Technology, Bhubaneswar (India); Warnett, Jason; Williams, Mark A. [WMG, University of Warwick, Coventry CV4 7AL (United Kingdom); Chakraborty, Madhusudan [Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Kharagpur (India); Srirangam, Prakash, E-mail: p.srirangam@warwick.ac.uk [WMG, University of Warwick, Coventry CV4 7AL (United Kingdom)

    2016-08-15

    X-ray computed tomography (XCT) was used to characterise the internal microstructure and clustering behaviour of TiB{sub 2} particles in in-situ processed Al-Cu metal matrix composites prepared by casting method. Forging was used in semi-solid state to reduce the porosity and to uniformly disperse TiB{sub 2} particles in the composite. Quantification of porosity and clustering of TiB{sub 2} particles was evaluated for different forging reductions (30% and 50% reductions) and compared with an as-cast sample using XCT. Results show that the porosity content was decreased by about 40% due to semi-solid forging as compared to the as-cast condition. Further, XCT results show that the 30% forging reduction resulted in greater uniformity in distribution of TiB{sub 2} particles within the composite compared to as-cast and the 50% forge reduction in semi-solid state. These results show that the application of forging in semi-solid state enhances particle distribution and reduces porosity formation in cast in-situ Al-Cu-TiB{sub 2} metal matrix composites. - Highlights: •XCT was used to visualise 3D internal structure of Al-Cu-TiB{sub 2} MMCs. •Al-Cu-TiB{sub 2} MMC was prepared by casting using flux assisted synthesis method. •TiB{sub 2} particles and porosity size distribution were evaluated. •Results show that forging in semi-solid condition decreases the porosity content and improve the particle dispersion in MMCs.

  5. Kinematics at the Main Mechanism of a Railbound Forging Manipulator

    Directory of Open Access Journals (Sweden)

    Florian Ion Tiberiu Petrescu

    2015-09-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 Heavy payload forging manipulators are mainly characterized by large load output and large capacitive load input. The relationship between outputs and inputs will greatly influence the control and the reliability. Forging manipulators have become more prevalent in the industry today. They are used to manipulate objects to be forged. The most common forging manipulators are moving on a railway to have a greater precision and stability. They have been called the railbound forging manipulators. In this paper we analyze the general kinematics of the main mechanism from a such manipulator. Kinematic scheme shows a typical forging manipulator, with the basic motions in operation process: walking, motion of the tong and buffering. The lifting mechanism consists of several parts including linkages, hydraulic drives and motion pairs. The principle of type design from the viewpoints of the relationship between output characteristics and actuator inputs is discussed. An idea of establishing the incidence relationship between output characteristics and actuator inputs is proposed. These novel forging manipulators which satisfy certain functional requirements provide an effective help for the design of forging manipulators.

  6. Manufacturing of Precision Forgings by Radial Forging

    International Nuclear Information System (INIS)

    Wallner, S.; Harrer, O.; Buchmayr, B.; Hofer, F.

    2011-01-01

    Radial forging is a multi purpose incremental forging process using four tools on the same plane. It is widely used for the forming of tool steels, super alloys as well as titanium- and refractory metals. The range of application goes from reducing the diameters of shafts, tubes, stepped shafts and axels, as well as for creating internal profiles for tubes in Near-Net-Shape and Net-Shape quality. Based on actual development of a weight optimized transmission input shaft, the specific features of radial forging technology is demonstrated. Also a Finite Element Model for the simulation of the process is shown which leads to reduced pre-processing effort and reduced computing time compared to other published simulation methods for radial forging. The finite element model can be applied to quantify the effects of different forging strategies.

  7. Press forging and optical properties of lithium fluoride

    Science.gov (United States)

    Ready, J. F.; Vora, H.

    1980-07-01

    Lithium fluoride is an important candidate material for windows on high power, short-pulse ultraviolet and visible lasers. Lithium fluoride crystals were press forged in one step over the temperature range 300 to 600 C to obtain fine grained polycrystalline material with improved mechanical properties. The deformation that can be given to a lithium fluoride crystal during forging is limited by the formation of internal cloudiness (veiling) with the deformation limit increasing with increasing forging temperature from about 40 percent at 400 C to 65 percent at 600 C. To suppress veiling, lithium fluoride crystals were forged in two steps over the temperature range 300 to 600 C, to total deformations of 69 to 76 percent, with intermediate annealing at 700 C. This technique yields a material which has lower scattering with more homogeneous microstructure than that obtained in one step forging. The results of characterization of various optical and mechanical properties of single crystal and forged lithium fluoride, including scattering, optical homogeneity, residual absorption, damage thresholds, environmental stability, and thresholds for microyield are described.

  8. Press forging and optical properties of lithium fluoride

    International Nuclear Information System (INIS)

    Ready, J.F.; Vora, H.

    1979-01-01

    Lithium fluoride is an important candidate material for windows on high-power, short-pulse ultraviolet and visible lasers. Lithium fluoride crystals have been press forged in one step over the temperature range 300 to 600 0 c to obtain fine-grained polycrystalline material with improved mechanical properties. The deformation that can be given to a lithium fluoride crystal during forging is limited by the formation of internal cloudiness (veiling) with the deformation limit increasing with increasing forging temperature from about 40% at 400 0 C to 65% at 600 0 C. To suppress veiling, lithium fluoride crystals were forged in two steps over the temperature range 300 to 600 0 C, to total deformations of 69-76%, with intermediate annealing at 700 0 C. This technique yields a material which has lower scattering with more homogeneous microstructure than that obtained in one-step forging. The results of characterization of various optical and mechanical properties of single-crystal and forged lithium fluoride, including scattering, optical homogeneity, residual absorption, damage thresholds, environmental stability, and thresholds for microyield are described

  9. Forging And Milling Contribution On Residual Stresses For A Textured Biphasic Titanium Alloy

    International Nuclear Information System (INIS)

    Deleuze, C.; Fabre, A.; Barrallier, L.; Molinas, O.

    2011-01-01

    Ti-10V-2Fe-3Al is a biphasic titanium alloy (α+β) used in aeronautical applications for its mechanical properties, such as its yield strength of 1200 MPa and it weighs 40% less than steel. This alloy is particularly useful for vital parts with complex geometry, because of its high forging capability. In order to predict the capability for fatigue lifetime, the designers need to know the residual stresses. X-Ray diffraction is the main experimental technique used to determine residual stresses on the surface. In this case, stress levels are primarily influenced by the complex forging and milling process. On this alloy in particular, it may be difficult to characterize stress due to modification of the microstructure close to the surface. Results obtained by x-ray analysis depend on the correct definition of the shape of the diffraction peaks. The more precisely defined the position of the peak, the more accurately the stresses are evaluated. This paper presents a method to detect if residual stresses can be characterized by x-ray diffraction. The characterization of hardness seems to be a relevant technique to quickly analyze the capability of x-ray diffraction to determine residual stresses.

  10. Fabrication and properties of Y-Ba-Cu-O high Tc superconductor by upset-forging method

    International Nuclear Information System (INIS)

    Chang, Ho Jung; Kang, Kae Myung; Song, Jin Tae

    1990-01-01

    YBa 2 Cu 3 O 7-x oxide superconductors was fabricated by sintering process and upset-forging method, respectively, and microstructures and conduction properties were compared. There was no difference in crystal structure the (001) x-ray reflection presumably due to preferred crystal orientation of the YBa 2 Cu 3 O 7-x superconductor. Furthermore, the grain size of the 123-phase increased as the reduction ratio became larger during the upset-forging. The critical temperature for zero resistivity of both samples was almost the same, i.e., about 90K. These results have demonstrated the potential of producing YBa 2 Cu 3 O 7-x superconducting wire or tape effectively using a upset-forging method. The critical current density of the upset-forged sample, however, was lower than that of the sintered one, which fact might be ascribed to microcrack formation during fast upset-forging. (Author)

  11. Methods of forging steel

    OpenAIRE

    Pečoler, Primož

    2014-01-01

    The following work presents processes of steel forming, challenges when forging steel, forming machines suitable for forging and which choice of machine is most suitable for forging. We can separate steel forming to free forging and drop forging. Free forging can be divided to hand forging and machine forging. The correct choice of furnaces is also very important. We must reach correct temperature in the furnace for raw steel to melt with less scalings. In diploma I mentioned some machine...

  12. 27 CFR 447.22 - Forgings, castings, and machined bodies.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Forgings, castings, and... IMPLEMENTS OF WAR The U.S. Munitions Import List § 447.22 Forgings, castings, and machined bodies. Articles on the U.S. Munitions Import List include articles in a partially completed state (such as forgings...

  13. Comparison study of multistep forging and injection forging of automobile fasteners

    OpenAIRE

    Chen Senyong; Qin Yi

    2015-01-01

    In order to improve production efficiency, injection forging as a feasible approach was introduced to automobile fasteners production. In the study reported in this paper, two forging approaches, traditional multistep forging and injection forging, were analysed by using a finite element method. Using ABAQUS and DEFORM, some significant factors, namely, forging force, energy consumption, component accuracy and stress distribution in the die, were compared to explore the potential and challeng...

  14. 2016 Accomplishments. Tritium aging studies on stainless steel. Forging process effects on the fracture toughness properties of tritium-precharged stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Michael J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-01-01

    Forged austenitic stainless steels are used as the materials of construction for pressure vessels designed to contain tritium at high pressure. These steels are highly resistant to tritium-assisted fracture but their resistance can depend on the details of the forging microstructure. During FY16, the effects of forging strain rate and deformation temperature on the fracture toughness properties of tritium-exposed-and-aged Type 304L stainless steel were studied. Forgings were produced from a single heat of steel using four types of production forging equipment – hydraulic press, mechanical press, screw press, and high-energy-rate forging (HERF). Each machine imparted a different nominal strain rate during the deformation. The objective of the study was to characterize the J-Integral fracture toughness properties as a function of the industrial strain rate and temperature. The second objective was to measure the effects of tritium and decay helium on toughness. Tritium and decay helium effects were measured by thermally precharging the as-forged specimens with tritium gas at 34.5 MPa and 350°C and aging for up to five years at -80°C to build-in decay helium prior to testing. The results of this study show that the fracture toughness properties of the as-forged steels vary with forging strain rate and forging temperature. The effect is largely due to yield strength as the higher-strength forgings had the lower toughness values. For non-charged specimens, fracture toughness properties were improved by forging at 871°C versus 816°C and Screw-Press forgings tended to have lower fracture toughness values than the other forgings. Tritium exposures reduced the fracture toughness values remarkably to fracture toughness values averaging 10-20% of as-forged values. However, forging strain rate and temperature had little or no effect on the fracture toughness after tritium precharging and aging. The result was confirmed by fractography which indicated that fracture modes

  15. Transmission electron microscopy of Ti-12Mo-13Nb Alloy aged after heat forging

    International Nuclear Information System (INIS)

    Oliveira, Nathalia Rodrigues; Baldan, Renato; Gabriel, Sinara Borborema

    2014-01-01

    Metastable β-Ti alloys possess mechanical properties, in particular a elastic modulus that depends not only on its composition but also the applied thermomechanical treatments. These alloys require high mechanical strength and a low Young’s modulus to avoid stress shielding. Preliminary studies on the development of Ti- 13Nb-12Mo alloy showed than the better properties were obtained at aged at 500 ° C / 24 h after cold forging , whose microstructure consisted of bimodal α phase in the β matrix. In this work, Ti-12Mo-13Nb alloy was heat forged and aged at 500 deg C for 24h and the microstructure was analyzed by employing X-ray diffraction and transmission electron microscopy. According to the results, while the cold forging resulted in bimodal α phase in the β matrix, hot forging resulted in a fine and homogeneous α phase in the β matrix. (author)

  16. Reparation of damaged forging dies

    Directory of Open Access Journals (Sweden)

    Vukić Lazić

    2015-03-01

    Full Text Available The forging dies are in exploitation exposed to elevated temperatures and variable impact loads, both compressive and shear. Steels for manufacturing of these tools must endure those loads while maintaining mechanical properties and being resistant to wear and thermal fatigue. For those reasons, the alloyed steels are used for making the forging dies, though they have less weldability, because alloying increases proneness to hardening. Any reparatory hard facing (HF of the damaged dies would require the specially adjusted technology to the particular piece. In this paper reparatory hard facing of dies used for forging pieces in the automobile industry is considered. Prior to reparatory hard facing of the real tools, numerous experimental hard facings on models were performed. All the model hard facings were done on the same steels which were used for production of the real forging dies. To define the optimal hard facing technology one needs to derive the optimal combination of the adequate heat treatment(s, to select the proper filler metals and the welding procedure. The established optimal HF technology was applied to real forging dies whose service life was further monitored in conditions of exploitation

  17. 22 CFR 121.10 - Forgings, castings and machined bodies.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Forgings, castings and machined bodies. 121.10... STATES MUNITIONS LIST Enumeration of Articles § 121.10 Forgings, castings and machined bodies. Articles on the U.S. Munitions List include articles in a partially completed state (such as forgings...

  18. Dicty_cDB: CFJ816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFJ816 (Link to dictyBase) - - - Contig-U16255-1 CFJ816P (Link... to Original site) CFJ816F 562 CFJ816Z 721 CFJ816P 1263 - - Show CFJ816 Library CF (Link to library) Clone ID CFJ816 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTT...PATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTTG GSTTGSHTTTGGSTTGSHTTTGGS

  19. 38 CFR 8.16 - Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U.S.C.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U.S.C. 8.16 Section 8.16 Pensions... Plan § 8.16 Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U...

  20. 30 CFR 816.151 - Primary roads.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Primary roads. 816.151 Section 816.151 Mineral... roads. Primary roads shall meet the requirements of section 816.150 and the additional requirements of this section. (a) Certification. The construction or reconstruction of primary roads shall be certified...

  1. 30 CFR 816.181 - Support facilities.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Support facilities. 816.181 Section 816.181... § 816.181 Support facilities. (a) Support facilities shall be operated in accordance with a permit... results. (b) In addition to the other provisions of this part, support facilities shall be located...

  2. Preliminary Physics Summary: Inclusive $\\Upsilon$ production in p-Pb collisions at $\\sqrt{s_{\\rm NN}} = 8.16$ TeV

    CERN Document Server

    2018-01-01

    The inclusive $\\Upsilon$ production in p-Pb interactions at the centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{\\rm NN}} = 8.16$ TeV is studied with the ALICE detector at the CERN LHC. The measurement has been performed reconstructing $\\Upsilon$(1S) and $\\Upsilon$(2S) mesons via their dimuon decay channel, in the centre-of-mass rapidities $2.03 < y_{\\rm cms} < 3.53$ and $-4.46 < y_{\\rm cms} < -2.96$, down to zero transverse momentum. Preliminary results on the inclusive $\\Upsilon$(1S) nuclear modification factors ($R_{\\rm pPb}$) as a function of rapidity, transverse momentum ($p_{\\rm T}$) and centrality of the collisions will be presented. The results will be compared with those obtained by ALICE in p-Pb collisions at $\\sqrt{s_{\\rm NN}} = 8.16$ TeV and with theoretical model calculations. The inclusive $\\Upsilon$(2S) $R_{\\rm pPb}$ will also be discussed and compared to the corresponding $\\Upsilon(1S)$ measurement.

  3. Forging Long Shafts On Disks

    Science.gov (United States)

    Tilghman, Chris; Askey, William; Hopkins, Steven

    1989-01-01

    Isothermal-forging apparatus produces long shafts integral with disks. Equipment based on modification of conventional isothermal-forging equipment, required stroke cut by more than half. Enables forging of shafts as long as 48 in. (122 cm) on typical modified conventional forging press, otherwise limited to making shafts no longer than 18 in. (46cm). Removable punch, in which forged material cools after plastic deformation, essential novel feature of forging apparatus. Technology used to improve such products as components of gas turbines and turbopumps and of other shaft/disk parts for powerplants, drive trains, or static structures.

  4. The structural and phase state formed in construction titanium alloy by radial forging

    Energy Technology Data Exchange (ETDEWEB)

    Shlyakhova, Galina V.; Danilov, Vladimir I.; Orlova, Dina V.; Zuev, Lev B. [Institute of Strength Physics and Materials Science SB RAS, Tomsk (Russian Federation); Zavodchikov, Aleksandr S. [Perm State Technical University, Perm (Russian Federation)

    2011-07-01

    The feasibility of rod manufacture from construction titanium alloy using radial forging on a high duty machine SXK16 was investigated. The investigations were carried on for titanium rod samples using the methods of metallography, electron transmission microscophy and X-ray analysis. The results obtained are described herein. It is found that radial forging results in the formation of homogeneous fine-grained structure.Using radial forging process, high-quality items are produced. As-worked material has submicrocrystalline globular structure and an optimal α:β phase ratio. Besides, the technology is more cost-effective relative to conventional flow charts. Key words: forging, titanium alloy, fine-grain structure, substructure, pore size.

  5. Precision forging technology for aluminum alloy

    Science.gov (United States)

    Deng, Lei; Wang, Xinyun; Jin, Junsong; Xia, Juchen

    2018-03-01

    Aluminum alloy is a preferred metal material for lightweight part manufacturing in aerospace, automobile, and weapon industries due to its good physical properties, such as low density, high specific strength, and good corrosion resistance. However, during forging processes, underfilling, folding, broken streamline, crack, coarse grain, and other macro- or microdefects are easily generated because of the deformation characteristics of aluminum alloys, including narrow forgeable temperature region, fast heat dissipation to dies, strong adhesion, high strain rate sensitivity, and large flow resistance. Thus, it is seriously restricted for the forged part to obtain precision shape and enhanced property. In this paper, progresses in precision forging technologies of aluminum alloy parts were reviewed. Several advanced precision forging technologies have been developed, including closed die forging, isothermal die forging, local loading forging, metal flow forging with relief cavity, auxiliary force or vibration loading, casting-forging hybrid forming, and stamping-forging hybrid forming. High-precision aluminum alloy parts can be realized by controlling the forging processes and parameters or combining precision forging technologies with other forming technologies. The development of these technologies is beneficial to promote the application of aluminum alloys in manufacturing of lightweight parts.

  6. High-Temperature Oxidation Behavior and Kinetics of Forged 12Cr-MoVW Steel

    Directory of Open Access Journals (Sweden)

    Kim Yong Hwan

    2017-06-01

    Full Text Available The oxidation kinetics of forged 12Cr-MoVW steel was investigated in an air (N2+O2 atmosphere at 873-1073 K (Δ50 K using thermogravimetric analysis. The oxidized samples were characterized using X-ray diffraction, and the surface and cross-sectional morphologies were examined using scanning electron microscopy coupled with energy-dispersive X-ray spectroscopy. The forged 12Cr-MoVW steel samples exhibited parabolic behavior and a low oxidation rate compared with their as-cast counterparts. A protective oxide layer was uniformly formed at relatively low temperature (≤973 K for the forged samples, which thus exhibited better oxidation resistance than the as-cast ones. These oxides are considered solid-solution compounds such as (Fe, Cr2O3.

  7. The X-40 sub-scale technology demonstrator and its U.S. Army CH-47 Chinook helicopter mothership fly

    Science.gov (United States)

    2000-01-01

    The X-40 sub-scale technology demonstrator and its U.S. Army CH-47 Chinook helicopter mothership fly over a dry lakebed runway during a captive-carry test flight from NASA's Dryden Flight Research Center, Edwards, California. The X-40 is attached to a sling which is suspended from the CH-47 by a 110-foot-long cable during the tests, while a small parachute trails behind to provide stability. The captive carry flights are designed to verify the X-40's navigation and control systems, rigging angles for its sling, and stability and control of the helicopter while carrying the X-40 on a tether. Following a series of captive-carry flights, the X-40 made free flights from a launch altitude of about 15,000 feet above ground, gliding to a fully autonomous landing. The X-40 is an unpowered 82 percent scale version of the X-37, a Boeing-developed spaceplane designed to demonstrate various advanced technologies for development of future lower-cost access to space vehicles. The X-37 will be carried into space aboard a space shuttle and then released to perform various maneuvers and a controlled re-entry through the Earth's atmosphere to an airplane-style landing on a runway, controlled entirely by pre-programmed computer software.

  8. Development of integral type forgings for steam generator of nuclear power plant

    International Nuclear Information System (INIS)

    Suzuki, Komei; Sato, Ikuo; Murai, Etsuo

    1992-01-01

    The use of integral type steel forgings for the construction of pressure vessel enhances the structural integrity of components and makes the fabrication of components and the execution of in-service inspection (ISI) easier than those fabrication from plate and casting materials. Such steel forgings have been realized for steam generator (SG) for nuclear power plant as follows : (1) Forged shell ring : change from welding fabrication of formed plates to forging ; (2) Forged conical shell ring : ditto ; (3) Forged head integral with nozzles (s) : (i) Primary head : change from casting to forging ; (ii) Secondary head : change from welding fabrication of formed plates to forging. These steel forgings have been realized by recent development in manufacturing technologies, such as steel making, forging processes and heat treatment which are vital to the quality of steel forgings. Some examples of recent typical high quality steel forgings developed by the Japan Steel Works, Ltd. (JSW) are introduced, and the main points of the manufacturing technique and the quality attained are also described. (author)

  9. The State of the Art in Cold Forging Lubrication

    DEFF Research Database (Denmark)

    Bay, Niels

    1994-01-01

    The manufature of components in steel, aluminium and copper alloys by cold forging production has increased ever since the 1950's. Typical processes are forward rod extrusion and backward can extrusion, upsetting, ironing, tube extrusion and radial extrusion. The tribological conditions in cold...... forging are extremely severe due to large surface expansion and normal pressure in the tool/workpiece interface combined with elevated tool temperatures. Except for the more simple cold forging operations successful production therefore requires advanced lubrication systems. The present paper gives...... a detailed description of the state of art for lubricant systems for cold forging of C-steels and low alloy steels as well as aluminium alloys including all the basic operations such as cleaning of the slugs, application of eventual conversion coating and lubrication. As regards cold forging of steel...

  10. Forging evaluaion of 304L stainless steel

    International Nuclear Information System (INIS)

    Packard, C.L.; Edstrom, C.M.

    1979-01-01

    The objective of this project was to evaluate and characterize the effects of various forging parameters on the metallographic structure and mechanical properties of 304L stainless steel forgings. Upset and die forgings were produced by hammer and Dynapak forging with forging temperatures ranging from 760 to 1145 0 C, upset reductions ranging from 20 to 60%, and annealing times ranging from 0 to 25 minutes at 843 0 C. The carbide precipitation behavior observed was found to be a function of forging temperature and annealing time. Higher forging temperatures were beneficial in avoiding continuous carbide precipitation and annealing at 843 0 C promoted increased carbide precipitation. The yield strength of the unannealed forgings decreased with increasing forging temperature and, with the exception of the 1145 0 C upset forgings, was significantly lowered by annealing

  11. 17 CFR 8.16 - Settlement offers.

    Science.gov (United States)

    2010-04-01

    ... Section 8.16 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION EXCHANGE PROCEDURES FOR DISCIPLINARY, SUMMARY, AND MEMBERSHIP DENIAL ACTIONS Disciplinary Procedure § 8.16 Settlement... the disciplinary committee at any time after the investigation report is completed. The disciplinary...

  12. Modelling of defects in ingot forging

    DEFF Research Database (Denmark)

    Christiansen, Peter

    The present report presents an investigation of the ingot forging process with special emphasis on modelling the influence of die geometry on the soundness of the ingot after hot forging. An investigation on how to model damage is also performed. The influence of the lower die angle is quantified...... angle of 130o-140o giving rise to the largest centreline porosity closure regardless of material hardening behaviour applied. Friction was found only to have minor influence on the optimum. Multi stroke forging operations have also been modelled since the ingot forging process consists of many forging...... damage. It is found that when evaluating damage only by relative density; feed size and lower die angle does not influence whether the hot forging process is successful or not. This is in disagreement with the general understanding of the ingot forging process. When evaluating ductile damage...

  13. Forging Industry Leadtimes: An Analysis of Causes for and Solutions to Long Leadtimes for Aerospace Forgings

    Science.gov (United States)

    1986-09-01

    Pamplet . Forging Industry Association, Cleveland-MT, uncatea. 20. Forging Industry Association, and American Society for Metals. Forging Handbook, edited... Pamplet . The Harris-Thomas Drop Forge Compnyayto--n R, undated. 43. Theeck, Michael F., TECH MOD Program Mana.er. Personal interview. Industrial Base... Brochure . Worcester MA, 3, . 125 "’ VITA Captain Stephen F. O’Neill was born on 19 June 1957 in Pittsfield, Massachusetts. He graduated from high school

  14. The influence of main parameters of the process of forging on the initial quality of forging for steel 35HM

    International Nuclear Information System (INIS)

    Banaszek, G.; Dyja, H.; Berski, S.

    2001-01-01

    The article discuss the effect of the main forging parameters and the selection of tools on improving the internal quality of forgings and closing up discontinuities of metallurgical origin during forging. As a result of investigations, the optimal values of the main technological parameters of forging have been determined and the application of an appropriate group of tools have been proposed for the flat die forging of forgings. (author)

  15. Microstructure Evolution and Surface Cracking Behavior of Superheavy Forgings during Hot Forging

    Directory of Open Access Journals (Sweden)

    Zhenhua Wang

    2018-01-01

    Full Text Available In recent years, superheavy forgings that are manufactured from 600 t grade ingots have been applied in the latest generation of nuclear power plants to provide good safety. However, component production is pushing the limits of the current free-forging industry. Large initial grain sizes and a low strain rate are the main factors that contribute to the deformation of superheavy forgings during forging. In this study, 18Mn18Cr0.6N steel with a coarse grain structure was selected as a model material. Hot compression and hot tension tests were conducted at a strain rate of 10−4·s−1. The essential nucleation mechanism of the dynamic recrystallization involved low-angle grain boundary formation and subgrain rotation, which was independent of the original high-angle grain boundary bulging and the presence of twins. Twins were formed during the growth of dynamic recrystallization grains. The grain refinement was not obvious at 1150°C. A lowering of the deformation temperature to 1050°C resulted in a fine grain structure; however, the stress increased significantly. Crack-propagation paths included high-angle grain boundaries, twin boundaries, and the insides of grains, in that order. For superheavy forging, the ingot should have a larger height and a smaller diameter.

  16. Microstructural and mechanical evolutions during the forging step of the COBAPRESS, a casting/forging process

    Science.gov (United States)

    Perrier, Frédéric; Desrayaud, Christophe; Bouvier, Véronique

    Aluminum casting/forging processes are used to produce parts for the automotive industry. In this study, we examined the influence of the forging step on the microstructure and the mechanical properties of an A356 aluminum alloy modified with strontium. Firstly, a design of samples which allows us to test mechanically the alloy before and after forging was created. A finite element analysis with the ABAQUS software predicts a maximum of strain in the core of the specimens. Observations with the EBSD technique confirm a more intense sub-structuration of the dendrite cells in this zone. Yield strength, ultimate tensile strength, elongation and fatigue lives were then improved for the casting/forging samples compared to the only cast specimens. The closure of the porosities and the improvement of the surface quality during the forging step enhance also the fatigue resistance of the samples.

  17. New Trends in Forging Technologies

    Science.gov (United States)

    Behrens, B.-A.; Hagen, T.; Knigge, J.; Elgaly, I.; Hadifi, T.; Bouguecha, A.

    2011-05-01

    Limited natural resources increase the demand on highly efficient machinery and transportation means. New energy-saving mobility concepts call for design optimisation through downsizing of components and choice of corrosion resistant materials possessing high strength to density ratios. Component downsizing can be performed either by constructive structural optimisation or by substituting heavy materials with lighter high-strength ones. In this context, forging plays an important role in manufacturing load-optimised structural components. At the Institute of Metal Forming and Metal-Forming Machines (IFUM) various innovative forging technologies have been developed. With regard to structural optimisation, different strategies for localised reinforcement of components were investigated. Locally induced strain hardening by means of cold forging under a superimposed hydrostatic pressure could be realised. In addition, controlled martensitic zones could be created through forming induced phase conversion in metastable austenitic steels. Other research focused on the replacement of heavy steel parts with high-strength nonferrous alloys or hybrid material compounds. Several forging processes of magnesium, aluminium and titanium alloys for different aeronautical and automotive applications were developed. The whole process chain from material characterisation via simulation-based process design to the production of the parts has been considered. The feasibility of forging complex shaped geometries using these alloys was confirmed. In spite of the difficulties encountered due to machine noise and high temperature, acoustic emission (AE) technique has been successfully applied for online monitoring of forging defects. New AE analysis algorithm has been developed, so that different signal patterns due to various events such as product/die cracking or die wear could be detected and classified. Further, the feasibility of the mentioned forging technologies was proven by means

  18. Forging process design for risk reduction

    Science.gov (United States)

    Mao, Yongning

    In this dissertation, forging process design has been investigated with the primary concern on risk reduction. Different forged components have been studied, especially those ones that could cause catastrophic loss if failure occurs. As an effective modeling methodology, finite element analysis is applied extensively in this work. Three examples, titanium compressor disk, superalloy turbine disk, and titanium hip prosthesis, have been discussed to demonstrate this approach. Discrete defects such as hard alpha anomalies are known to cause disastrous failure if they are present in those stress critical components. In this research, hard-alpha inclusion movement during forging of titanium compressor disk is studied by finite element analysis. By combining the results from Finite Element Method (FEM), regression modeling and Monte Carlo simulation, it is shown that changing the forging path is able to mitigate the failure risk of the components during the service. The second example goes with a turbine disk made of superalloy IN 718. The effect of forging on microstructure is the main consideration in this study. Microstructure defines the as-forged disk properties. Considering specific forging conditions, preform has its own effect on the microstructure. Through a sensitivity study it is found that forging temperature and speed have significant influence on the microstructure. In order to choose the processing parameters to optimize the microstructure, the dependence of microstructure on die speed and temperature is thoroughly studied using design of numerical experiments. For various desired goals, optimal solutions are determined. The narrow processing window of titanium alloy makes the isothermal forging a preferred way to produce forged parts without forging defects. However, the cost of isothermal forging (dies at the same temperature as the workpiece) limits its wide application. In this research, it has been demonstrated that with proper process design, the die

  19. 29 CFR 1910.218 - Forging machines.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Forging machines. 1910.218 Section 1910.218 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Machinery and Machine Guarding § 1910.218 Forging machines. (a... other identifier, for the forging machine which was inspected. (ii) Scheduling and recording the...

  20. Wear Analysis of Die Inserts in the Hot Forging Process of a Forked Type Forging Using Reverse Scanning Techniques

    Directory of Open Access Journals (Sweden)

    Łukasz Dworzak

    2017-12-01

    Full Text Available This article presents a wear analysis of die inserts used in the hot forging process of a forked forging (yoke, an element applied in steering systems of passenger vehicles. Studies involved the application of an original reverse scanning method intended for rapid and reliable wear analysis of forging tools (with complicated shape affording easy assessment without the need to dismount tools from the forging unit. The developed method involves analysis of progressive wear of forging tools based on measurements (scanning of forgings periodically collected from the process and constitutes a useful tool for measurement and testing. As the authors’ earlier works have demonstrated, the proposed new approach to analysis of tool wear with the application of reverse 3D scanning has proven successful in multiple instances in the case of axially symmetrical objects. The presented results of studies indicate that it is possible to utilize the expanded method to analyze the lifetime of forging tools, including tools with complex geometry. Application of the reverse scanning method allows for continuous and practical monitoring of the condition of forging tools over the course of the forging process and should have a positive impact on improving production output and reducing production costs.

  1. 48 CFR 225.7102 - Forgings.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Forgings. 225.7102 Section 225.7102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Forgings. ...

  2. Forged Signature Distinction Using Convolutional Neural Network for Feature Extraction

    Directory of Open Access Journals (Sweden)

    Seungsoo Nam

    2018-01-01

    Full Text Available This paper proposes a dynamic verification scheme for finger-drawn signatures in smartphones. As a dynamic feature, the movement of a smartphone is recorded with accelerometer sensors in the smartphone, in addition to the moving coordinates of the signature. To extract high-level longitudinal and topological features, the proposed scheme uses a convolution neural network (CNN for feature extraction, and not as a conventional classifier. We assume that a CNN trained with forged signatures can extract effective features (called S-vector, which are common in forging activities such as hesitation and delay before drawing the complicated part. The proposed scheme also exploits an autoencoder (AE as a classifier, and the S-vector is used as the input vector to the AE. An AE has high accuracy for the one-class distinction problem such as signature verification, and is also greatly dependent on the accuracy of input data. S-vector is valuable as the input of AE, and, consequently, could lead to improved verification accuracy especially for distinguishing forged signatures. Compared to the previous work, i.e., the MLP-based finger-drawn signature verification scheme, the proposed scheme decreases the equal error rate by 13.7%, specifically, from 18.1% to 4.4%, for discriminating forged signatures.

  3. Springer Pseudorapidity distributions of charged hadrons in proton-lead collisions at $\\sqrt{s_{_\\mathrm{NN}}} =$ 5.02 and 8.16 TeV

    CERN Document Server

    Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Grossmann, Johannes; Hrubec, Josef; Jeitler, Manfred; König, Axel; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Pree, Elias; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Karapostoli, Georgia; Lenzi, Thomas; Luetic, Jelena; Maerschalk, Thierry; Marinov, Andrey; Seva, Tomislav; Starling, Elizabeth; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Cimmino, Anna; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Salva Diblen, Sinem; Tytgat, Michael; Verbeke, Willem; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; Caudron, Adrien; David, Pieter; De Visscher, Simon; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Komm, Matthias; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Quertenmont, Loic; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Beliy, Nikita; Aldá Júnior, Walter Luiz; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhang, Sijing; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Ruiz Alvarez, José David; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Carrera Jarrin, Edgar; Abdelalim, Ahmed Ali; Mohammed, Yasser; Salama, Elsayed; Dewanjee, Ram Krishna; Kadastik, Mario; Perrini, Lucia; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Ghosh, Saranya; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Kucher, Inna; Leloup, Clément; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Charlot, Claude; Granier de Cassagnac, Raphael; Jo, Mihee; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Schomakers, Christian; Schulz, Johannes; Zhukov, Valery; Albert, Andreas; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hamer, Matthias; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Knutzen, Simon; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Teyssier, Daniel; Thüer, Sebastian; Flügge, Günter; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Eren, Engin; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Harb, Ali; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Korol, Ievgen; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Leonard, Jessica; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Ntomari, Eleni; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Shevchenko, Rostyslav; Spannagel, Simon; Stefaniuk, Nazar; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Lapsien, Tobias; Marchesini, Ivan; Marconi, Daniele; Meyer, Mareike; Niedziela, Marek; Nowatschin, Dominik; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Scharf, Christian; Schleper, Peter; Schmidt, Alexander; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Faltermann, Nils; Freund, Benedikt; Friese, Raphael; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Kudella, Simon; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Kousouris, Konstantinos; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Csanad, Mate; Filipovic, Nicolas; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Bahinipati, Seema; Bhowmik, Sandeep; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chawla, Ridhi; Dhingra, Nitish; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Mehta, Ankita; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Chauhan, Sushil; Choudhary, Brajesh C; Garg, Rocky Bala; Keshri, Sumit; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukhopadhyay, Supratik; Nandan, Saswati; Purohit, Arnab; Roy, Ashim; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Dugad, Shashikant; Mahakud, Bibhuprasad; Mitra, Soureek; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sarkar, Tanmay; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Errico, Filippo; Fiore, Luigi; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Costa, Salvatore; Di Mattia, Alessandro; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pauwels, Kristof; Pedrini, Daniele; Pigazzini, Simone; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Fienga, Francesco; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Carvalho Antunes De Oliveira, Alexandra; Checchia, Paolo; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Margoni, Martino; Meneguzzo, Anna Teresa; Pozzobon, Nicola; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Margaroli, Fabrizio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Traczyk, Piotr; Belforte, Stefano; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Lee, Ari; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Brochero Cifuentes, Javier Andres; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Kim, Yongsun; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Choi, Minkyoo; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chadeeva, Marina; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Popova, Elena; Rusinov, Vladimir; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Demiyanov, Andrey; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Skovpen, Yuri; Shtol, Dmitry; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Barrio Luna, Mar; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Curras, Esteban; Duarte Campderros, Jordi; Fernandez, Marcos; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bloch, Philippe; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Castello, Roberto; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Knünz, Valentin; Kornmayer, Andreas; Kortelainen, Matti J; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Neugebauer, Hannes; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Stoye, Markus; Tosi, Mia; Treille, Daniel; Triossi, Andrea; Tsirou, Andromachi; Veckalns, Viesturs; Verweij, Marta; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Bianchini, Lorenzo; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Klijnsma, Thomas; Lustermann, Werner; Mangano, Boris; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Quittnat, Milena; Reichmann, Michael; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Candelise, Vieri; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Fiori, Francesco; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Kovitanggoon, Kittikul; Singh, Gurpreet; Srimanobhas, Norraphat; Bakirci, Mustafa Numan; Bat, Ayse; Boran, Fatma; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Tali, Bayram; Tok, Ufuk Guney; Topakli, Huseyin; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Bilin, Bugra; Karapinar, Guler; Ocalan, Kadir; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Nazlim Agaras, Merve; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Sakuma, Tai; Seif El Nasr-storey, Sarah; Smith, Dominic; Smith, Vincent J; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Calligaris, Luigi; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Auzinger, Georg; Bainbridge, Robert; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Di Maria, Riccardo; Elwood, Adam; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Lane, Rebecca; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mastrolorenzo, Luca; Matsushita, Takashi; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Zahid, Sema; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Avetisyan, Aram; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Cutts, David; Garabedian, Alex; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Gardner, Michael; Ko, Winston; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Smith, John; Stolp, Dustin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Heilman, Jesse; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Macneill, Ian; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Pena, Cristian; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; Mulholland, Troy; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Magini, Nicolo; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Furic, Ivan-Kresimir; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Rank, Douglas; Shi, Kun; Sperka, David; Terentyev, Nikolay; Thomas, Laurent; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Joshi, Yagya Raj; Linn, Stephan; Markowitz, Pete; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Trauger, Hallie; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Yi, Kai; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Royon, Christophe; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Toda, Sachiko; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Hiltbrand, Joshua; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Dolen, James; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Liu, Bingxuan; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Lange, David; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Das, Souvik; Folgueras, Santiago; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xie, Wei; Cheng, Tongguang; Parashar, Neeti; Stupak, John; Adair, Antony; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Guilbaud, Maxime; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Verzetti, Mauro; Ciesielski, Robert; Goulianos, Konstantin; Mesropian, Christina; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Foerster, Mark; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Faulkner, James; Gurpinar, Emine; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Polese, Giovanni; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel

    2018-01-11

    The pseudorapidity distributions of charged hadrons in proton-lead collisions at nucleon-nucleon center-of-mass energies ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 and 8.16 TeV are presented. The measurements are based on data samples collected by the CMS experiment at the LHC. The number of primary charged hadrons produced in non-single-diffractive proton-lead collisions is determined in the pseudorapidity range $| \\eta_{\\text{lab}} | } | _ {| \\eta_{\\text{cm}} | < 0.5 }$ are 17.31 $\\pm$ 0.01 (stat) $\\pm$ 0.59 (syst) and 20.10 $\\pm$ 0.01 (stat) $\\pm$ 0.85 (syst) at ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 and 8.16 TeV, respectively. The particle densities per participant nucleon are compared to similar measurements in proton-proton, proton-nucleus, and nucleus-nucleus collisions.

  4. 30 CFR 816.83 - Coal mine waste: Refuse piles.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: Refuse piles. 816.83 Section... ACTIVITIES § 816.83 Coal mine waste: Refuse piles. Refuse piles shall meet the requirements of § 816.81, the... drainage may not be diverted over the outslope of the refuse piles. Runoff from the areas above the refuse...

  5. Using of material-technological modelling for designing production of closed die forgings

    Science.gov (United States)

    Ibrahim, K.; Vorel, I.; Jeníček, Š.; Káňa, J.; Aišman, D.; Kotěšovec, V.

    2017-02-01

    Production of forgings is a complex and demanding process which consists of a number of forging operations and, in many cases, includes post-forge heat treatment. An optimized manufacturing line is a prerequisite for obtaining prime-quality products which in turn are essential to profitable operation of a forging company. Problems may, however, arise from modifications to the manufacturing route due to changing customer needs. As a result, the production may have to be suspended temporarily to enable changeover and optimization. Using material-technological modelling, the required modifications can be tested and optimized under laboratory conditions outside the plant without disrupting the production. Thanks to material-technological modelling, the process parameters can be varied rapidly in response to changes in market requirements. Outcomes of the modelling runs include optimum parameters for the forging part’s manufacturing route, values of mechanical properties, and results of microstructure analysis. This article describes the use of material-technological modelling for exploring the impact of the amount of deformation and the rate of cooling of a particular forged part from the finish-forging temperature on its microstructure and related mechanical properties.

  6. Evolution of A-Type Macrosegregation in Large Size Steel Ingot After Multistep Forging and Heat Treatment

    Science.gov (United States)

    Loucif, Abdelhalim; Ben Fredj, Emna; Harris, Nathan; Shahriari, Davood; Jahazi, Mohammad; Lapierre-Boire, Louis-Philippe

    2018-06-01

    A-type macrosegregation refers to the channel chemical heterogeneities that can be formed during solidification in large size steel ingots. In this research, a combination of experiment and simulation was used to study the influence of open die forging parameters on the evolution of A-type macrosegregation patterns during a multistep forging of a 40 metric ton (MT) cast, high-strength steel ingot. Macrosegregation patterns were determined experimentally by macroetch along the longitudinal axis of the forged and heat-treated ingot. Mass spectroscopy, on more than 900 samples, was used to determine the chemical composition map of the entire longitudinal sectioned surface. FORGE NxT 1.1 finite element modeling code was used to predict the effect of forging sequences on the morphology evolution of A-type macrosegregation patterns. For this purpose, grain flow variables were defined and implemented in a large scale finite element modeling code to describe oriented grains and A-type segregation patterns. Examination of the A-type macrosegregation showed four to five parallel continuous channels located nearly symmetrical to the axis of the forged ingot. In some regions, the A-type patterns became curved or obtained a wavy form in contrast to their straight shape in the as-cast state. Mass spectrometry analysis of the main alloying elements (C, Mn, Ni, Cr, Mo, Cu, P, and S) revealed that carbon, manganese, and chromium were the most segregated alloying elements in A-type macrosegregation patterns. The observed differences were analyzed using thermodynamic calculations, which indicated that changes in the chemical composition of the liquid metal can affect the primary solidification mode and the segregation intensity of the alloying elements. Finite element modeling simulation results showed very good agreement with the experimental observations, thereby allowing for the quantification of the influence of temperature and deformation on the evolution of the shape of the

  7. Effect of forging process on microstructure, mechanical and corrosion properties of biodegradable Mg-1Ca alloy

    International Nuclear Information System (INIS)

    Harandi, Shervin Eslami; Hasbullah Idris, Mohd; Jafari, Hassan

    2011-01-01

    Research highlights: → Forging temperature demonstrates more pronounced effect compared to forging speed. → Precipitation of Mg 2 Ca phase at grain boundaries accelerates corrosion rate. → Forging process doesn't provide the corrosion resistance required for bone healing. -- Abstract: The performance of Mg-1Ca alloy, a biodegradable metallic material, may be improved by hot working in order that it may be of use in bone implant applications. In this study, Mg-1Ca cast alloy was preheated to different temperatures before undergoing forging process with various forging speeds. Macro- and microstructure of the samples were examined by stereo and scanning electron microscopes (SEM) equipped with energy dispersive X-ray spectroscopy (EDS), respectively. To determine the mechanical properties of the alloy, hardness value and plastic deformation ability of the samples were measured. To investigate the corrosion behaviour of the alloy, immersion and electrochemical tests were performed on the samples in simulated body fluid and the corrosion products were characterized by SEM/EDS. The results showed that increasing forging temperature decreased grain size led to improved hardness value and plastic deformation ability of the alloy, whereas no significant effect was observed by changing forging speed. Moreover, forging at higher temperatures led to an increase in the amount of Mg 2 Ca phase at grain boundaries resulted in higher corrosion rates. It can be concluded that although forging process improved the mechanical properties of the alloy, it does not satisfy the corrosion resistance criteria required for bone healing.

  8. Forging of Advanced Disk Alloy LSHR

    Science.gov (United States)

    Gabb, Timothy P.; Gayda, John; Falsey, John

    2005-01-01

    The powder metallurgy disk alloy LSHR was designed with a relatively low gamma precipitate solvus temperature and high refractory element content to allow versatile heat treatment processing combined with high tensile, creep and fatigue properties. Grain size can be chiefly controlled through proper selection of solution heat treatment temperatures relative to the gamma precipitate solvus temperature. However, forging process conditions can also significantly influence solution heat treatment-grain size response. Therefore, it is necessary to understand the relationships between forging process conditions and the eventual grain size of solution heat treated material. A series of forging experiments were performed with subsequent subsolvus and supersolvus heat treatments, in search of suitable forging conditions for producing uniform fine grain and coarse grain microstructures. Subsolvus, supersolvus, and combined subsolvus plus supersolvus heat treatments were then applied. Forging and subsequent heat treatment conditions were identified allowing uniform fine and coarse grain microstructures.

  9. Role of forgings in powder metallurgy industry

    International Nuclear Information System (INIS)

    Hayes, A.F.; DeRidder, A.J.

    1975-01-01

    Forging of powder metallurgy materials is discussed. Information and data are included on forging powder metallurgy W, Mo, In 100, Rene 95, Astroloy, Be, and Ti. It is noted that the combination of powder metallurgy and forging work provides the best product from standpoints of reproducibility, freedom from segregation, low scrap rate, and uniform mechanical properties. Experience is being used to develop contour forging from hot isostatic pressed billets or preforms. The quality of this product is under evaluation. Results show steady improvement and it is anticipated that continued effort will soon produce a reliable, less costly product. Forging can continue to be relied upon to correct subtle defects present in powder metallurgy material

  10. Forging loads, deformation modes and fracture in axi-symmetrric closed die cold forging of sintered aluminium powder compacts

    International Nuclear Information System (INIS)

    Butt, M.A.; Ali, L.

    2003-01-01

    An experimental investigation into closed-die cold forging of sintered aluminium powder rod- shaped compacts was carried out. Axi-symmetric components were forged from sintered powder preforms with different initial diameter to height ratios. Different compaction pressures, sintering and lubrication conditions were used as variables during the investigations. Detailed observations were made on green/sintered density, compaction defects, forging loads, deformation modes and on the onset of fracture during progressive forging of sintered powder compacts. Experimental results obtained during the investigations have been presented and discussed in detail. (author)

  11. 30 CFR 816.79 - Protection of underground mining.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Protection of underground mining. 816.79 Section 816.79 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PERMANENT PROGRAM PERFORMANCE STANDARDS PERMANENT PROGRAM PERFORMANCE STANDARDS-SURFACE MINING...

  12. Mechanical properties of Zr-2.5Nb pressure tube material manufactured employing forging routes for PHWR700 - Part 1: tensile behavior

    International Nuclear Information System (INIS)

    Bind, A.K.; Singh, R.N.; Sunil, Saurav; Chakravartty, J.K.; Ghosh, Agnish; Dhandharia, Priyesh; More, Nitin S.; Vijayakumar, S.; Chhatre, A.G.

    2012-01-01

    Tensile properties of Zr-2.5Nb alloy tubes produced employing forging to break the cast structure were evaluated by carrying out uni-axial tension test at temperatures between 25 and 325 degC and under strain-rate of 1.075 x 10 -4 /s for both longitudinal and transverse specimens. Both strength and elongation values were comparable for the samples obtained from front and back end of the tube. Transverse samples showed higher strength and lower uniform elongation values as compared to longitudinal samples. The yield strength of double forged material at 25 degC is higher than the PHWR700 specification of a maximum value of 586 MPa. (author)

  13. 30 CFR 816.46 - Hydrologic balance: Siltation structures.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Hydrologic balance: Siltation structures. 816...-SURFACE MINING ACTIVITIES § 816.46 Hydrologic balance: Siltation structures. (a) For the purpose of this... activities include diversion ditches, siltation structures, or roads that are designed constructed and...

  14. Pseudorapidity distributions of charged hadrons in proton-lead collisions at √{s_{NN}}=5.02 and 8.16 TeV

    Science.gov (United States)

    Sirunyan, A. M.; Tumasyan, A.; Adam, W.; Ambrogi, F.; Asilar, E.; Bergauer, T.; Brandstetter, J.; Brondolin, E.; Drag-icevic, M.; Erö, J.; Flechl, M.; Friedl, M.; Frühwirth, R.; Ghete, V. M.; Grossmann, J.; Hrubec, J.; Jeitler, M.; König, A.; Krammer, N.; Krätschmer, I.; Liko, D.; Madlener, T.; Mikulec, I.; Pree, E.; Rad, N.; Rohringer, H.; Schieck, J.; Schöfbeck, R.; Spanring, M.; Spitzbart, D.; Waltenberger, W.; Wittmann, J.; Wulz, C.-E.; Zarucki, M.; Chekhovsky, V.; Mossolov, V.; Suarez Gonzalez, J.; De Wolf, E. A.; Di Croce, D.; Janssen, X.; Lauwers, J.; Van De Klundert, M.; Van Haevermaet, H.; Van Mechelen, P.; Van Remortel, N.; Abu Zeid, S.; Blekman, F.; D'Hondt, J.; De Bruyn, I.; De Clercq, J.; Deroover, K.; Flouris, G.; Lontkovskyi, D.; Lowette, S.; Moortgat, S.; Moreels, L.; Python, Q.; Skovpen, K.; Tavernier, S.; Van Doninck, W.; Van Mulders, P.; Van Parijs, I.; Beghin, D.; Brun, H.; Clerbaux, B.; De Lentdecker, G.; Delannoy, H.; Dorney, B.; Fasanella, G.; Favart, L.; Goldouzian, R.; Grebenyuk, A.; Karapostoli, G.; Lenzi, T.; Luetic, J.; Maerschalk, T.; Marinov, A.; Seva, T.; Starling, E.; Vander Velde, C.; Vanlaer, P.; Vannerom, D.; Yonamine, R.; Zenoni, F.; Zhang, F.; Cimmino, A.; Cornelis, T.; Dobur, D.; Fagot, A.; Gul, M.; Khvastunov, I.; Poyraz, D.; Roskas, C.; Salva, S.; Tytgat, M.; Verbeke, W.; Zaganidis, N.; Bakhshiansohi, H.; Bondu, O.; Brochet, S.; Bruno, G.; Caputo, C.; Caudron, A.; David, P.; De Visscher, S.; Delaere, C.; Delcourt, M.; Francois, B.; Giammanco, A.; Komm, M.; Krintiras, G.; Lemaitre, V.; Magitteri, A.; Mertens, A.; Musich, M.; Piotrzkowski, K.; Quertenmont, L.; Saggio, A.; Vidal Marono, M.; Wertz, S.; Zobec, J.; Beliy, N.; Aldá Júnior, W. L.; Alves, F. L.; Alves, G. A.; Brito, L.; Correa Martins Junior, M.; Hensel, C.; Moraes, A.; Pol, M. E.; Rebello Teles, P.; Belchior Batista Das Chagas, E.; Carvalho, W.; Chinellato, J.; Coelho, E.; Da Costa, E. M.; Da Silveira, G. G.; De Jesus Damiao, D.; Fonseca De Souza, S.; Huertas Guativa, L. M.; Malbouisson, H.; Melo De Almeida, M.; Mora Herrera, C.; Mundim, L.; Nogima, H.; Sanchez Rosas, L. J.; Santoro, A.; Sznajder, A.; Thiel, M.; Tonelli Manganote, E. J.; Torres Da Silva De Araujo, F.; Vilela Pereira, A.; Ahuja, S.; Bernardes, C. A.; Fernandez Perez Tomei, T. R.; Gregores, E. M.; Mercadante, P. G.; Novaes, S. F.; Padula, Sandra S.; Romero Abad, D.; Ruiz Vargas, J. C.; Aleksandrov, A.; Hadjiiska, R.; Iaydjiev, P.; Misheva, M.; Rodozov, M.; Shopova, M.; Sultanov, G.; Dimitrov, A.; Glushkov, I.; Litov, L.; Pavlov, B.; Petkov, P.; Fang, W.; Gao, X.; Yuan, L.; Ahmad, M.; Bian, J. G.; Chen, G. M.; Chen, H. S.; Chen, M.; Chen, Y.; Jiang, C. H.; Leggat, D.; Liao, H.; Liu, Z.; Romeo, F.; Shaheen, S. M.; Spiezia, A.; Tao, J.; Wang, C.; Wang, Z.; Yazgan, E.; Zhang, H.; Zhang, S.; Zhao, J.; Ban, Y.; Chen, G.; Li, Q.; Liu, S.; Mao, Y.; Qian, S. J.; Wang, D.; Xu, Z.; Avila, C.; Cabrera, A.; Chaparro Sierra, L. F.; Florez, C.; González Hernández, C. F.; Ruiz Alvarez, J. D.; Segura Delgado, M. A.; Courbon, B.; Godinovic, N.; Lelas, D.; Puljak, I.; Ribeiro Cipriano, P. M.; Sculac, T.; Antunovic, Z.; Kovac, M.; Brigljevic, V.; Ferencek, D.; Kadija, K.; Mesic, B.; Starodumov, A.; Susa, T.; Ather, M. W.; Attikis, A.; Mavromanolakis, G.; Mousa, J.; Nicolaou, C.; Ptochos, F.; Razis, P. A.; Rykaczewski, H.; Finger, M.; Finger, M.; Carrera Jarrin, E.; Abdelalim, A. A.; Mohammed, Y.; Salama, E.; Dewanjee, R. K.; Kadastik, M.; Perrini, L.; Raidal, M.; Tiko, A.; Veelken, C.; Eerola, P.; Kirschenmann, H.; Pekkanen, J.; Voutilainen, M.; Havukainen, J.; Heikkilä, J. K.; Järvinen, T.; Karimäki, V.; Kinnunen, R.; Lampén, T.; Lassila-Perini, K.; Laurila, S.; Lehti, S.; Lindén, T.; Luukka, P.; Siikonen, H.; Tuominen, E.; Tuominiemi, J.; Talvitie, J.; Tuuva, T.; Besancon, M.; Couderc, F.; Dejardin, M.; Denegri, D.; Faure, J. L.; Ferri, F.; Ganjour, S.; Ghosh, S.; Givernaud, A.; Gras, P.; Hamel de Monchenault, G.; Jarry, P.; Kucher, I.; Leloup, C.; Locci, E.; Machet, M.; Malcles, J.; Negro, G.; Rander, J.; Rosowsky, A.; Sahin, M. Ö.; Titov, M.; Abdulsalam, A.; Amendola, C.; Antropov, I.; Baffioni, S.; Beaudette, F.; Busson, P.; Cadamuro, L.; Charlot, C.; Granier de Cassagnac, R.; Jo, M.; Lisniak, S.; Lobanov, A.; Martin Blanco, J.; Nguyen, M.; Ochando, C.; Ortona, G.; Paganini, P.; Pigard, P.; Salerno, R.; Sauvan, J. B.; Sirois, Y.; Stahl Leiton, A. G.; Strebler, T.; Yilmaz, Y.; Zabi, A.; Zghiche, A.; Agram, J.-L.; Andrea, J.; Bloch, D.; Brom, J.-M.; Buttignol, M.; Chabert, E. C.; Chanon, N.; Collard, C.; Conte, E.; Coubez, X.; Fontaine, J.-C.; Gelé, D.; Goerlach, U.; Jansová, M.; Le Bihan, A.-C.; Tonon, N.; Van Hove, P.; Gadrat, S.; Beauceron, S.; Bernet, C.; Boudoul, G.; Chierici, R.; Contardo, D.; Depasse, P.; El Mamouni, H.; Fay, J.; Finco, L.; Gascon, S.; Gouzevitch, M.; Grenier, G.; Ille, B.; Lagarde, F.; Laktineh, I. B.; Lethuillier, M.; Mirabito, L.; Pequegnot, A. L.; Perries, S.; Popov, A.; Sordini, V.; Vander Donckt, M.; Viret, S.; Toriashvili, T.; Tsamalaidze, Z.; Autermann, C.; Feld, L.; Kiesel, M. K.; Klein, K.; Lipinski, M.; Preuten, M.; Schomakers, C.; Schulz, J.; Zhukov, V.; Albert, A.; Dietz-Laursonn, E.; Duchardt, D.; Endres, M.; Erdmann, M.; Erdweg, S.; Esch, T.; Fischer, R.; Güth, A.; Hamer, M.; Hebbeker, T.; Heidemann, C.; Hoepfner, K.; Knutzen, S.; Merschmeyer, M.; Meyer, A.; Millet, P.; Mukherjee, S.; Pook, T.; Radziej, M.; Reithler, H.; Rieger, M.; Scheuch, F.; Teyssier, D.; Thüer, S.; Flügge, G.; Kargoll, B.; Kress, T.; Künsken, A.; Müller, T.; Nehrkorn, A.; Nowack, A.; Pistone, C.; Pooth, O.; Stahl, A.; Aldaya Martin, M.; Arndt, T.; Asawatangtrakuldee, C.; Beernaert, K.; Behnke, O.; Behrens, U.; Bermúdez Martínez, A.; Bin Anuar, A. A.; Borras, K.; Botta, V.; Campbell, A.; Connor, P.; Contreras-Campana, C.; Costanza, F.; Diez Pardos, C.; Eckerlin, G.; Eckstein, D.; Eichhorn, T.; Eren, E.; Gallo, E.; Garay Garcia, J.; Geiser, A.; Gizhko, A.; Grados Luyando, J. M.; Grohsjean, A.; Gunnellini, P.; Guthoff, M.; Harb, A.; Hauk, J.; Hempel, M.; Jung, H.; Kalogeropoulos, A.; Kasemann, M.; Keaveney, J.; Kleinwort, C.; Korol, I.; Krücker, D.; Lange, W.; Lelek, A.; Lenz, T.; Leonard, J.; Lipka, K.; Lohmann, W.; Mankel, R.; Melzer-Pellmann, I.-A.; Meyer, A. B.; Mittag, G.; Mnich, J.; Mussgiller, A.; Ntomari, E.; Pitzl, D.; Raspereza, A.; Savitskyi, M.; Saxena, P.; Shevchenko, R.; Spannagel, S.; Stefaniuk, N.; Van Onsem, G. P.; Walsh, R.; Wen, Y.; Wichmann, K.; Wissing, C.; Zenaiev, O.; Aggleton, R.; Bein, S.; Blobel, V.; Centis Vignali, M.; Dreyer, T.; Garutti, E.; Gonzalez, D.; Haller, J.; Hinzmann, A.; Hoffmann, M.; Karavdina, A.; Klanner, R.; Kogler, R.; Kovalchuk, N.; Kurz, S.; Lapsien, T.; Marchesini, I.; Marconi, D.; Meyer, M.; Niedziela, M.; Nowatschin, D.; Pantaleo, F.; Peiffer, T.; Perieanu, A.; Scharf, C.; Schleper, P.; Schmidt, A.; Schumann, S.; Schwandt, J.; Sonneveld, J.; Stadie, H.; Steinbrück, G.; Stober, F. M.; Stöver, M.; Tholen, H.; Troendle, D.; Usai, E.; Vanhoefer, A.; Vormwald, B.; Akbiyik, M.; Barth, C.; Baselga, M.; Baur, S.; Butz, E.; Caspart, R.; Chwalek, T.; Colombo, F.; De Boer, W.; Dierlamm, A.; Faltermann, N.; Freund, B.; Friese, R.; Giffels, M.; Harrendorf, M. A.; Hartmann, F.; Heindl, S. M.; Husemann, U.; Kassel, F.; Kudella, S.; Mildner, H.; Mozer, M. U.; Müller, Th.; Plagge, M.; Quast, G.; Rabbertz, K.; Schröder, M.; Shvetsov, I.; Sieber, G.; Simonis, H. J.; Ulrich, R.; Wayand, S.; Weber, M.; Weiler, T.; Williamson, S.; Wöhrmann, C.; Wolf, R.; Anagnostou, G.; Daskalakis, G.; Geralis, T.; Kyriakis, A.; Loukas, D.; Topsis-Giotis, I.; Karathanasis, G.; Kesisoglou, S.; Panagiotou, A.; Saoulidou, N.; Kousouris, K.; Evangelou, I.; Foudas, C.; Kokkas, P.; Mallios, S.; Manthos, N.; Papadopoulos, I.; Paradas, E.; Strologas, J.; Triantis, F. A.; Csanad, M.; Filipovic, N.; Pasztor, G.; Surányi, O.; Veres, G. I.; Bencze, G.; Hajdu, C.; Horvath, D.; Hunyadi, Á.; Sikler, F.; Veszpremi, V.; Beni, N.; Czellar, S.; Karancsi, J.; Makovec, A.; Molnar, J.; Szillasi, Z.; Bartók, M.; Raics, P.; Trocsanyi, Z. L.; Ujvari, B.; Choudhury, S.; Komaragiri, J. R.; Bahinipati, S.; Bhowmik, S.; Mal, P.; Mandal, K.; Nayak, A.; Sahoo, D. K.; Sahoo, N.; Swain, S. K.; Bansal, S.; Beri, S. B.; Bhatnagar, V.; Chawla, R.; Dhingra, N.; Kalsi, A. K.; Kaur, A.; Kaur, M.; Kaur, S.; Kumar, R.; Kumari, P.; Mehta, A.; Singh, J. B.; Walia, G.; Kumar, Ashok; Shah, Aashaq; Bhardwaj, A.; Chauhan, S.; Choudhary, B. C.; Garg, R. B.; Keshri, S.; Kumar, A.; Malhotra, S.; Naimuddin, M.; Ranjan, K.; Sharma, R.; Bhardwaj, R.; Bhattacharya, R.; Bhattacharya, S.; Bhawandeep, U.; Dey, S.; Dutt, S.; Dutta, S.; Ghosh, S.; Majumdar, N.; Modak, A.; Mondal, K.; Mukhopadhyay, S.; Nandan, S.; Purohit, A.; Roy, A.; Roy Chowdhury, S.; Sarkar, S.; Sharan, M.; Thakur, S.; Behera, P. K.; Chudasama, R.; Dutta, D.; Jha, V.; Kumar, V.; Mohanty, A. K.; Netrakanti, P. K.; Pant, L. M.; Shukla, P.; Topkar, A.; Aziz, T.; Dugad, S.; Mahakud, B.; Mitra, S.; Mohanty, G. B.; Sur, N.; Sutar, B.; Banerjee, S.; Bhattacharya, S.; Chatterjee, S.; Das, P.; Guchait, M.; Jain, Sa.; Kumar, S.; Maity, M.; Majumder, G.; Mazumdar, K.; Sarkar, T.; Wickramage, N.; Chauhan, S.; Dube, S.; Hegde, V.; Kapoor, A.; Kothekar, K.; Pandey, S.; Rane, A.; Sharma, S.; Chenarani, S.; Eskandari Tadavani, E.; Etesami, S. M.; Khakzad, M.; Mohammadi Najafabadi, M.; Naseri, M.; Paktinat Mehdiabadi, S.; Rezaei Hosseinabadi, F.; Safarzadeh, B.; Zeinali, M.; Felcini, M.; Grunewald, M.; Abbrescia, M.; Calabria, C.; Colaleo, A.; Creanza, D.; Cristella, L.; De Filippis, N.; De Palma, M.; Errico, F.; Fiore, L.; Iaselli, G.; Lezki, S.; Maggi, G.; Maggi, M.; Miniello, G.; My, S.; Nuzzo, S.; Pompili, A.; Pugliese, G.; Radogna, R.; Ranieri, A.; Selvaggi, G.; Sharma, A.; Silvestris, L.; Venditti, R.; Verwilligen, P.; Abbiendi, G.; Battilana, C.; Bonacorsi, D.; Borgonovi, L.; Braibant-Giacomelli, S.; Campanini, R.; Capiluppi, P.; Castro, A.; Cavallo, F. R.; Chhibra, S. S.; Codispoti, G.; Cuffiani, M.; Dallavalle, G. M.; Fabbri, F.; Fanfani, A.; Fasanella, D.; Giacomelli, P.; Grandi, C.; Guiducci, L.; Marcellini, S.; Masetti, G.; Montanari, A.; Navarria, F. L.; Perrotta, A.; Rossi, A. M.; Rovelli, T.; Siroli, G. P.; Tosi, N.; Albergo, S.; Costa, S.; Di Mattia, A.; Giordano, F.; Potenza, R.; Tricomi, A.; Tuve, C.; Barbagli, G.; Chatterjee, K.; Ciulli, V.; Civinini, C.; D'Alessandro, R.; Focardi, E.; Lenzi, P.; Meschini, M.; Paoletti, S.; Russo, L.; Sguazzoni, G.; Strom, D.; Viliani, L.; Benussi, L.; Bianco, S.; Fabbri, F.; Piccolo, D.; Primavera, F.; Calvelli, V.; Ferro, F.; Robutti, E.; Tosi, S.; Benaglia, A.; Beschi, A.; Brianza, L.; Brivio, F.; Ciriolo, V.; Dinardo, M. E.; Fiorendi, S.; Gennai, S.; Ghezzi, A.; Govoni, P.; Malberti, M.; Malvezzi, S.; Manzoni, R. A.; Menasce, D.; Moroni, L.; Paganoni, M.; Pauwels, K.; Pedrini, D.; Pigazzini, S.; Ragazzi, S.; Redaelli, N.; Tabarelli de Fatis, T.; Buontempo, S.; Cavallo, N.; Di Guida, S.; Fabozzi, F.; Fienga, F.; Iorio, A. O. M.; Khan, W. A.; Lista, L.; Meola, S.; Paolucci, P.; Sciacca, C.; Thyssen, F.; Azzi, P.; Bacchetta, N.; Benato, L.; Bisello, D.; Boletti, A.; Carlin, R.; Carvalho Antunes De Oliveira, A.; Checchia, P.; De Castro Manzano, P.; Dorigo, T.; Dosselli, U.; Gasparini, F.; Gasparini, U.; Gozzelino, A.; Lacaprara, S.; Margoni, M.; Meneguzzo, A. T.; Pozzobon, N.; Ronchese, P.; Rossin, R.; Simonetto, F.; Torassa, E.; Zanetti, M.; Zotto, P.; Zumerle, G.; Braghieri, A.; Magnani, A.; Montagna, P.; Ratti, S. P.; Re, V.; Ressegotti, M.; Riccardi, C.; Salvini, P.; Vai, I.; Vitulo, P.; Alunni Solestizi, L.; Biasini, M.; Bilei, G. M.; Cecchi, C.; Ciangottini, D.; Fanò, L.; Lariccia, P.; Leonardi, R.; Manoni, E.; Mantovani, G.; Mariani, V.; Menichelli, M.; Rossi, A.; Santocchia, A.; Spiga, D.; Androsov, K.; Azzurri, P.; Bagliesi, G.; Boccali, T.; Borrello, L.; Castaldi, R.; Ciocci, M. A.; Dell'Orso, R.; Fedi, G.; Giannini, L.; Giassi, A.; Grippo, M. T.; Ligabue, F.; Lomtadze, T.; Manca, E.; Mandorli, G.; Messineo, A.; Palla, F.; Rizzi, A.; Savoy-Navarro, A.; Spagnolo, P.; Tenchini, R.; Tonelli, G.; Venturi, A.; Verdini, P. G.; Barone, L.; Cavallari, F.; Cipriani, M.; Daci, N.; Del Re, D.; Di Marco, E.; Diemoz, M.; Gelli, S.; Longo, E.; Margaroli, F.; Marzocchi, B.; Meridiani, P.; Organtini, G.; Paramatti, R.; Preiato, F.; Rahatlou, S.; Rovelli, C.; Santanastasio, F.; Amapane, N.; Arcidiacono, R.; Argiro, S.; Arneodo, M.; Bartosik, N.; Bellan, R.; Biino, C.; Cartiglia, N.; Cenna, F.; Costa, M.; Covarelli, R.; Degano, A.; Demaria, N.; Kiani, B.; Mariotti, C.; Maselli, S.; Migliore, E.; Monaco, V.; Monteil, E.; Monteno, M.; Obertino, M. M.; Pacher, L.; Pastrone, N.; Pelliccioni, M.; Pinna Angioni, G. L.; Ravera, F.; Romero, A.; Ruspa, M.; Sacchi, R.; Shchelina, K.; Sola, V.; Solano, A.; Staiano, A.; Traczyk, P.; Belforte, S.; Casarsa, M.; Cossutti, F.; Della Ricca, G.; Zanetti, A.; Kim, D. H.; Kim, G. N.; Kim, M. S.; Lee, J.; Lee, S.; Lee, S. W.; Moon, C. S.; Oh, Y. D.; Sekmen, S.; Son, D. C.; Yang, Y. C.; Lee, A.; Kim, H.; Moon, D. H.; Oh, G.; Brochero Cifuentes, J. A.; Goh, J.; Kim, T. J.; Cho, S.; Choi, S.; Go, Y.; Gyun, D.; Ha, S.; Hong, B.; Jo, Y.; Kim, Y.; Lee, K.; Lee, K. S.; Lee, S.; Lim, J.; Park, S. K.; Roh, Y.; Almond, J.; Kim, J.; Kim, J. S.; Lee, H.; Lee, K.; Nam, K.; Oh, S. B.; Radburn-Smith, B. C.; Seo, S. h.; Yang, U. K.; Yoo, H. D.; Yu, G. B.; Choi, M.; Kim, H.; Kim, J. H.; Lee, J. S. H.; Park, I. C.; Choi, Y.; Hwang, C.; Lee, J.; Yu, I.; Dudenas, V.; Juodagalvis, A.; Vaitkus, J.; Ahmed, I.; Ibrahim, Z. A.; Ali, M. A. B. Md; Mohamad Idris, F.; Wan Abdullah, W. A. T.; Yusli, M. N.; Zolkapli, Z.; Reyes-Almanza, R.; Ramirez-Sanchez, G.; Duran-Osuna, M. C.; Castilla-Valdez, H.; De La Cruz-Burelo, E.; Heredia-De La Cruz, I.; Rabadan-Trejo, R. I.; Lopez-Fernandez, R.; Mejia Guisao, J.; Sanchez-Hernandez, A.; Carrillo Moreno, S.; Oropeza Barrera, C.; Vazquez Valencia, F.; Pedraza, I.; Salazar Ibarguen, H. A.; Uribe Estrada, C.; Morelos Pineda, A.; Krofcheck, D.; Butler, P. H.; Ahmad, A.; Ahmad, M.; Hassan, Q.; Hoorani, H. R.; Saddique, A.; Shah, M. A.; Shoaib, M.; Waqas, M.; Bialkowska, H.; Bluj, M.; Boimska, B.; Frueboes, T.; Górski, M.; Kazana, M.; Nawrocki, K.; Szleper, M.; Zalewski, P.; Bunkowski, K.; Byszuk, A.; Doroba, K.; Kalinowski, A.; Konecki, M.; Krolikowski, J.; Misiura, M.; Olszewski, M.; Pyskir, A.; Walczak, M.; Bargassa, P.; Beirão Da Cruz E Silva, C.; Di Francesco, A.; Faccioli, P.; Galinhas, B.; Gallinaro, M.; Hollar, J.; Leonardo, N.; Lloret Iglesias, L.; Nemallapudi, M. V.; Seixas, J.; Strong, G.; Toldaiev, O.; Vadruccio, D.; Varela, J.; Afanasiev, S.; Bunin, P.; Gavrilenko, M.; Golutvin, I.; Gorbunov, I.; Kamenev, A.; Karjavin, V.; Lanev, A.; Malakhov, A.; Matveev, V.; Palichik, V.; Perelygin, V.; Shmatov, S.; Shulha, S.; Skatchkov, N.; Smirnov, V.; Voytishin, N.; Zarubin, A.; Ivanov, Y.; Kim, V.; Kuznetsova, E.; Levchenko, P.; Murzin, V.; Oreshkin, V.; Smirnov, I.; Sulimov, V.; Uvarov, L.; Vavilov, S.; Vorobyev, A.; Andreev, Yu.; Dermenev, A.; Gninenko, S.; Golubev, N.; Karneyeu, A.; Kirsanov, M.; Krasnikov, N.; Pashenkov, A.; Tlisov, D.; Toropin, A.; Epshteyn, V.; Gavrilov, V.; Lychkovskaya, N.; Popov, V.; Pozdnyakov, I.; Safronov, G.; Spiridonov, A.; Stepennov, A.; Toms, M.; Vlasov, E.; Zhokin, A.; Aushev, T.; Bylinkin, A.; Chadeeva, M.; Parygin, P.; Philippov, D.; Polikarpov, S.; Popova, E.; Rusinov, V.; Andreev, V.; Azarkin, M.; Dremin, I.; Kirakosyan, M.; Terkulov, A.; Baskakov, A.; Belyaev, A.; Boos, E.; Demiyanov, A.; Ershov, A.; Gribushin, A.; Kodolova, O.; Korotkikh, V.; Lokhtin, I.; Miagkov, I.; Obraztsov, S.; Petrushanko, S.; Savrin, V.; Snigirev, A.; Vardanyan, I.; Blinov, V.; Skovpen, Y.; Shtol, D.; Azhgirey, I.; Bayshev, I.; Bitioukov, S.; Elumakhov, D.; Kachanov, V.; Kalinin, A.; Konstantinov, D.; Mandrik, P.; Petrov, V.; Ryutin, R.; Sobol, A.; Troshin, S.; Tyurin, N.; Uzunian, A.; Volkov, A.; Adzic, P.; Cirkovic, P.; Devetak, D.; Dordevic, M.; Milosevic, J.; Rekovic, V.; Alcaraz Maestre, J.; Barrio Luna, M.; Cerrada, M.; Colino, N.; De La Cruz, B.; Delgado Peris, A.; Escalante Del Valle, A.; Fernandez Bedoya, C.; Fernández Ramos, J. P.; Flix, J.; Fouz, M. C.; Gonzalez Lopez, O.; Goy Lopez, S.; Hernandez, J. M.; Josa, M. I.; Moran, D.; Pérez-Calero Yzquierdo, A.; Puerta Pelayo, J.; Quintario Olmeda, A.; Redondo, I.; Romero, L.; Soares, M. S.; Álvarez Fernández, A.; Albajar, C.; de Trocóniz, J. F.; Missiroli, M.; Cuevas, J.; Erice, C.; Fernandez Menendez, J.; Gonzalez Caballero, I.; González Fernández, J. R.; Palencia Cortezon, E.; Sanchez Cruz, S.; Vischia, P.; Vizan Garcia, J. M.; Cabrillo, I. J.; Calderon, A.; Chazin Quero, B.; Curras, E.; Duarte Campderros, J.; Fernandez, M.; Garcia-Ferrero, J.; Gomez, G.; Lopez Virto, A.; Marco, J.; Martinez Rivero, C.; Martinez Ruiz del Arbol, P.; Matorras, F.; Piedra Gomez, J.; Rodrigo, T.; Ruiz-Jimeno, A.; Scodellaro, L.; Trevisani, N.; Vila, I.; Vilar Cortabitarte, R.; Abbaneo, D.; Akgun, B.; Auffray, E.; Baillon, P.; Ball, A. H.; Barney, D.; Bendavid, J.; Bianco, M.; Bloch, P.; Bocci, A.; Botta, C.; Camporesi, T.; Castello, R.; Cepeda, M.; Cerminara, G.; Chapon, E.; Chen, Y.; d'Enterria, D.; Dabrowski, A.; Daponte, V.; David, A.; De Gruttola, M.; De Roeck, A.; Deelen, N.; Dobson, M.; du Pree, T.; Dünser, M.; Dupont, N.; Elliott-Peisert, A.; Everaerts, P.; Fallavollita, F.; Franzoni, G.; Fulcher, J.; Funk, W.; Gigi, D.; Gilbert, A.; Gill, K.; Glege, F.; Gulhan, D.; Harris, P.; Hegeman, J.; Innocente, V.; Jafari, A.; Janot, P.; Karacheban, O.; Kieseler, J.; Knünz, V.; Kornmayer, A.; Kortelainen, M. J.; Krammer, M.; Lange, C.; Lecoq, P.; Lourenço, C.; Lucchini, M. T.; Malgeri, L.; Mannelli, M.; Martelli, A.; Meijers, F.; Merlin, J. A.; Mersi, S.; Meschi, E.; Milenovic, P.; Moortgat, F.; Mulders, M.; Neugebauer, H.; Ngadiuba, J.; Orfanelli, S.; Orsini, L.; Pape, L.; Perez, E.; Peruzzi, M.; Petrilli, A.; Petrucciani, G.; Pfeiffer, A.; Pierini, M.; Rabady, D.; Racz, A.; Reis, T.; Rolandi, G.; Rovere, M.; Sakulin, H.; Schäfer, C.; Schwick, C.; Seidel, M.; Selvaggi, M.; Sharma, A.; Silva, P.; Sphicas, P.; Stakia, A.; Steggemann, J.; Stoye, M.; Tosi, M.; Treille, D.; Triossi, A.; Tsirou, A.; Veckalns, V.; Verweij, M.; Zeuner, W. D.; Bertl, W.; Caminada, L.; Deiters, K.; Erdmann, W.; Horisberger, R.; Ingram, Q.; Kaestli, H. C.; Kotlinski, D.; Langenegger, U.; Rohe, T.; Wiederkehr, S. A.; Backhaus, M.; Bäni, L.; Berger, P.; Bianchini, L.; Casal, B.; Dissertori, G.; Dittmar, M.; Donegà, M.; Dorfer, C.; Grab, C.; Heidegger, C.; Hits, D.; Hoss, J.; Kasieczka, G.; Klijnsma, T.; Lustermann, W.; Mangano, B.; Marionneau, M.; Meinhard, M. T.; Meister, D.; Micheli, F.; Musella, P.; Nessi-Tedaldi, F.; Pandolfi, F.; Pata, J.; Pauss, F.; Perrin, G.; Perrozzi, L.; Quittnat, M.; Reichmann, M.; Sanz Becerra, D. A.; Schönenberger, M.; Shchutska, L.; Tavolaro, V. R.; Theofilatos, K.; Vesterbacka Olsson, M. L.; Wallny, R.; Zhu, D. H.; Aarrestad, T. K.; Amsler, C.; Canelli, M. F.; De Cosa, A.; Del Burgo, R.; Donato, S.; Galloni, C.; Hreus, T.; Kilminster, B.; Pinna, D.; Rauco, G.; Robmann, P.; Salerno, D.; Schweiger, K.; Seitz, C.; Takahashi, Y.; Zucchetta, A.; Candelise, V.; Doan, T. H.; Jain, Sh.; Khurana, R.; Kuo, C. M.; Lin, W.; Pozdnyakov, A.; Yu, S. S.; Kumar, Arun; Chang, P.; Chao, Y.; Chen, K. F.; Chen, P. H.; Fiori, F.; Hou, W.-S.; Hsiung, Y.; Liu, Y. F.; Lu, R.-S.; Paganis, E.; Psallidas, A.; Steen, A.; Tsai, J. f.; Asavapibhop, B.; Kovitanggoon, K.; Singh, G.; Srimanobhas, N.; Bakirci, M. N.; Bat, A.; Boran, F.; Damarseckin, S.; Demiroglu, Z. S.; Dozen, C.; Girgis, S.; Gokbulut, G.; Guler, Y.; Hos, I.; Kangal, E. E.; Kara, O.; Kiminsu, U.; Oglakci, M.; Onengut, G.; Ozdemir, K.; Ozturk, S.; Polatoz, A.; Tali, B.; Tok, U. G.; Topakli, H.; Turkcapar, S.; Zorbakir, I. S.; Zorbilmez, C.; Bilin, B.; Karapinar, G.; Ocalan, K.; Yalvac, M.; Zeyrek, M.; Gülmez, E.; Kaya, M.; Kaya, O.; Tekten, S.; Yetkin, E. A.; Agaras, M. N.; Atay, S.; Cakir, A.; Cankocak, K.; Grynyov, B.; Levchuk, L.; Ball, F.; Beck, L.; Brooke, J. J.; Burns, D.; Clement, E.; Cussans, D.; Davignon, O.; Flacher, H.; Goldstein, J.; Heath, G. P.; Heath, H. F.; Kreczko, L.; Newbold, D. M.; Paramesvaran, S.; Sakuma, T.; Seif El Nasr-storey, S.; Smith, D.; Smith, V. J.; Belyaev, A.; Brew, C.; Brown, R. M.; Calligaris, L.; Cieri, D.; Cockerill, D. J. A.; Coughlan, J. A.; Harder, K.; Harper, S.; Olaiya, E.; Petyt, D.; Shepherd-Themistocleous, C. H.; Thea, A.; Tomalin, I. R.; Williams, T.; Auzinger, G.; Bainbridge, R.; Borg, J.; Breeze, S.; Buchmuller, O.; Bundock, A.; Casasso, S.; Citron, M.; Colling, D.; Corpe, L.; Dauncey, P.; Davies, G.; De Wit, A.; Della Negra, M.; Di Maria, R.; Elwood, A.; Haddad, Y.; Hall, G.; Iles, G.; James, T.; Lane, R.; Laner, C.; Lyons, L.; Magnan, A.-M.; Malik, S.; Mastrolorenzo, L.; Matsushita, T.; Nash, J.; Nikitenko, A.; Palladino, V.; Pesaresi, M.; Raymond, D. M.; Richards, A.; Rose, A.; Scott, E.; Seez, C.; Shtipliyski, A.; Summers, S.; Tapper, A.; Uchida, K.; Vazquez Acosta, M.; Virdee, T.; Wardle, N.; Winterbottom, D.; Wright, J.; Zenz, S. C.; Cole, J. E.; Hobson, P. R.; Khan, A.; Kyberd, P.; Reid, I. D.; Symonds, P.; Teodorescu, L.; Turner, M.; Zahid, S.; Borzou, A.; Call, K.; Dittmann, J.; Hatakeyama, K.; Liu, H.; Pastika, N.; Smith, C.; Bartek, R.; Dominguez, A.; Buccilli, A.; Cooper, S. I.; Henderson, C.; Rumerio, P.; West, C.; Arcaro, D.; Avetisyan, A.; Bose, T.; Gastler, D.; Rankin, D.; Richardson, C.; Rohlf, J.; Sulak, L.; Zou, D.; Benelli, G.; Cutts, D.; Garabedian, A.; Hadley, M.; Hakala, J.; Heintz, U.; Hogan, J. M.; Kwok, K. H. M.; Laird, E.; Landsberg, G.; Lee, J.; Mao, Z.; Narain, M.; Pazzini, J.; Piperov, S.; Sagir, S.; Syarif, R.; Yu, D.; Band, R.; Brainerd, C.; Burns, D.; Calderon De La Barca Sanchez, M.; Chertok, M.; Conway, J.; Conway, R.; Cox, P. T.; Erbacher, R.; Flores, C.; Funk, G.; Gardner, M.; Ko, W.; Lander, R.; Mclean, C.; Mulhearn, M.; Pellett, D.; Pilot, J.; Shalhout, S.; Shi, M.; Smith, J.; Stolp, D.; Tos, K.; Tripathi, M.; Wang, Z.; Bachtis, M.; Bravo, C.; Cousins, R.; Dasgupta, A.; Florent, A.; Hauser, J.; Ignatenko, M.; Mccoll, N.; Regnard, S.; Saltzberg, D.; Schnaible, C.; Valuev, V.; Bouvier, E.; Burt, K.; Clare, R.; Ellison, J.; Gary, J. W.; Ghiasi Shirazi, S. M. A.; Hanson, G.; Heilman, J.; Kennedy, E.; Lacroix, F.; Long, O. R.; Olmedo Negrete, M.; Paneva, M. I.; Si, W.; Wang, L.; Wei, H.; Wimpenny, S.; Yates, B. R.; Branson, J. G.; Cittolin, S.; Derdzinski, M.; Gerosa, R.; Gilbert, D.; Hashemi, B.; Holzner, A.; Klein, D.; Kole, G.; Krutelyov, V.; Letts, J.; Macneill, I.; Masciovecchio, M.; Olivito, D.; Padhi, S.; Pieri, M.; Sani, M.; Sharma, V.; Simon, S.; Tadel, M.; Vartak, A.; Wasserbaech, S.; Wood, J.; Würthwein, F.; Yagil, A.; Zevi Della Porta, G.; Amin, N.; Bhandari, R.; Bradmiller-Feld, J.; Campagnari, C.; Dishaw, A.; Dutta, V.; Franco Sevilla, M.; George, C.; Golf, F.; Gouskos, L.; Gran, J.; Heller, R.; Incandela, J.; Ovcharova, A.; Qu, H.; Richman, J.; Stuart, D.; Suarez, I.; Yoo, J.; Anderson, D.; Bornheim, A.; Lawhorn, J. M.; Newman, H. B.; Nguyen, T.; Pena, C.; Spiropulu, M.; Vlimant, J. R.; Xie, S.; Zhang, Z.; Zhu, R. Y.; Andrews, M. B.; Ferguson, T.; Mudholkar, T.; Paulini, M.; Russ, J.; Sun, M.; Vogel, H.; Vorobiev, I.; Weinberg, M.; Cumalat, J. P.; Ford, W. T.; Jensen, F.; Johnson, A.; Krohn, M.; Leontsinis, S.; Mulholland, T.; Stenson, K.; Wagner, S. R.; Alexander, J.; Chaves, J.; Chu, J.; Dittmer, S.; Mcdermott, K.; Mirman, N.; Patterson, J. R.; Quach, D.; Rinkevicius, A.; Ryd, A.; Skinnari, L.; Soffi, L.; Tan, S. M.; Tao, Z.; Thom, J.; Tucker, J.; Wittich, P.; Zientek, M.; Abdullin, S.; Albrow, M.; Alyari, M.; Apollinari, G.; Apresyan, A.; Apyan, A.; Banerjee, S.; Bauerdick, L. A. T.; Beretvas, A.; Berryhill, J.; Bhat, P. C.; Bolla, G.; Burkett, K.; Butler, J. N.; Canepa, A.; Cerati, G. B.; Cheung, H. W. K.; Chlebana, F.; Cremonesi, M.; Duarte, J.; Elvira, V. D.; Freeman, J.; Gecse, Z.; Gottschalk, E.; Gray, L.; Green, D.; Grünendahl, S.; Gutsche, O.; Harris, R. M.; Hasegawa, S.; Hirschauer, J.; Hu, Z.; Jayatilaka, B.; Jindariani, S.; Johnson, M.; Joshi, U.; Klima, B.; Kreis, B.; Lammel, S.; Lincoln, D.; Lipton, R.; Liu, M.; Liu, T.; Lopes De Sá, R.; Lykken, J.; Maeshima, K.; Magini, N.; Marraffino, J. M.; Mason, D.; McBride, P.; Merkel, P.; Mrenna, S.; Nahn, S.; O'Dell, V.; Pedro, K.; Prokofyev, O.; Rakness, G.; Ristori, L.; Schneider, B.; Sexton-Kennedy, E.; Soha, A.; Spalding, W. J.; Spiegel, L.; Stoynev, S.; Strait, J.; Strobbe, N.; Taylor, L.; Tkaczyk, S.; Tran, N. V.; Uplegger, L.; Vaandering, E. W.; Vernieri, C.; Verzocchi, M.; Vidal, R.; Wang, M.; Weber, H. A.; Whitbeck, A.; Acosta, D.; Avery, P.; Bortignon, P.; Bourilkov, D.; Brinkerhoff, A.; Carnes, A.; Carver, M.; Curry, D.; Field, R. D.; Furic, I. K.; Gleyzer, S. V.; Joshi, B. M.; Konigsberg, J.; Korytov, A.; Kotov, K.; Ma, P.; Matchev, K.; Mei, H.; Mitselmakher, G.; Rank, D.; Shi, K.; Sperka, D.; Terentyev, N.; Thomas, L.; Wang, J.; Wang, S.; Yelton, J.; Joshi, Y. R.; Linn, S.; Markowitz, P.; Rodriguez, J. L.; Ackert, A.; Adams, T.; Askew, A.; Hagopian, S.; Hagopian, V.; Johnson, K. F.; Kolberg, T.; Martinez, G.; Perry, T.; Prosper, H.; Saha, A.; Santra, A.; Sharma, V.; Yohay, R.; Baarmand, M. M.; Bhopatkar, V.; Colafranceschi, S.; Hohlmann, M.; Noonan, D.; Roy, T.; Yumiceva, F.; Adams, M. R.; Apanasevich, L.; Berry, D.; Betts, R. R.; Cavanaugh, R.; Chen, X.; Evdokimov, O.; Gerber, C. E.; Hangal, D. A.; Hofman, D. J.; Jung, K.; Kamin, J.; Sandoval Gonzalez, I. D.; Tonjes, M. B.; Trauger, H.; Varelas, N.; Wang, H.; Wu, Z.; Zhang, J.; Bilki, B.; Clarida, W.; Dilsiz, K.; Durgut, S.; Gandrajula, R. P.; Haytmyradov, M.; Khristenko, V.; Merlo, J.-P.; Mermerkaya, H.; Mestvirishvili, A.; Moeller, A.; Nachtman, J.; Ogul, H.; Onel, Y.; Ozok, F.; Penzo, A.; Snyder, C.; Tiras, E.; Wetzel, J.; Yi, K.; Blumenfeld, B.; Cocoros, A.; Eminizer, N.; Fehling, D.; Feng, L.; Gritsan, A. V.; Maksimovic, P.; Roskes, J.; Sarica, U.; Swartz, M.; Xiao, M.; You, C.; Al-bataineh, A.; Baringer, P.; Bean, A.; Boren, S.; Bowen, J.; Castle, J.; Khalil, S.; Kropivnitskaya, A.; Majumder, D.; Mcbrayer, W.; Murray, M.; Royon, C.; Sanders, S.; Schmitz, E.; Tapia Takaki, J. D.; Wang, Q.; Ivanov, A.; Kaadze, K.; Maravin, Y.; Mohammadi, A.; Saini, L. K.; Skhirtladze, N.; Toda, S.; Rebassoo, F.; Wright, D.; Anelli, C.; Baden, A.; Baron, O.; Belloni, A.; Calvert, B.; Eno, S. C.; Feng, Y.; Ferraioli, C.; Hadley, N. J.; Jabeen, S.; Jeng, G. Y.; Kellogg, R. G.; Kunkle, J.; Mignerey, A. C.; Ricci-Tam, F.; Shin, Y. H.; Skuja, A.; Tonwar, S. C.; Abercrombie, D.; Allen, B.; Azzolini, V.; Barbieri, R.; Baty, A.; Bi, R.; Brandt, S.; Busza, W.; Cali, I. A.; D'Alfonso, M.; Demiragli, Z.; Gomez Ceballos, G.; Goncharov, M.; Hsu, D.; Hu, M.; Iiyama, Y.; Innocenti, G. M.; Klute, M.; Kovalskyi, D.; Lai, Y. S.; Lee, Y.-J.; Levin, A.; Luckey, P. D.; Maier, B.; Marini, A. C.; Mcginn, C.; Mironov, C.; Narayanan, S.; Niu, X.; Paus, C.; Roland, C.; Roland, G.; Salfeld-Nebgen, J.; Stephans, G. S. F.; Tatar, K.; Velicanu, D.; Wang, J.; Wang, T. W.; Wyslouch, B.; Benvenuti, A. C.; Chatterjee, R. M.; Evans, A.; Hansen, P.; Hiltbrand, J.; Kalafut, S.; Kubota, Y.; Lesko, Z.; Mans, J.; Nourbakhsh, S.; Ruckstuhl, N.; Rusack, R.; Turkewitz, J.; Wadud, M. A.; Acosta, J. G.; Oliveros, S.; Avdeeva, E.; Bloom, K.; Claes, D. R.; Fangmeier, C.; Gonzalez Suarez, R.; Kamalieddin, R.; Kravchenko, I.; Monroy, J.; Siado, J. E.; Snow, G. R.; Stieger, B.; Dolen, J.; Godshalk, A.; Harrington, C.; Iashvili, I.; Nguyen, D.; Parker, A.; Rappoccio, S.; Roozbahani, B.; Alverson, G.; Barberis, E.; Hortiangtham, A.; Massironi, A.; Morse, D. M.; Orimoto, T.; Teixeira De Lima, R.; Trocino, D.; Wood, D.; Bhattacharya, S.; Charaf, O.; Hahn, K. A.; Mucia, N.; Odell, N.; Pollack, B.; Schmitt, M. H.; Sung, K.; Trovato, M.; Velasco, M.; Dev, N.; Hildreth, M.; Hurtado Anampa, K.; Jessop, C.; Karmgard, D. J.; Kellams, N.; Lannon, K.; Loukas, N.; Marinelli, N.; Meng, F.; Mueller, C.; Musienko, Y.; Planer, M.; Reinsvold, A.; Ruchti, R.; Smith, G.; Taroni, S.; Wayne, M.; Wolf, M.; Woodard, A.; Alimena, J.; Antonelli, L.; Bylsma, B.; Durkin, L. S.; Flowers, S.; Francis, B.; Hart, A.; Hill, C.; Ji, W.; Liu, B.; Luo, W.; Winer, B. L.; Wulsin, H. W.; Cooperstein, S.; Driga, O.; Elmer, P.; Hardenbrook, J.; Hebda, P.; Higginbotham, S.; Lange, D.; Luo, J.; Marlow, D.; Mei, K.; Ojalvo, I.; Olsen, J.; Palmer, C.; Piroué, P.; Stickland, D.; Tully, C.; Malik, S.; Norberg, S.; Barker, A.; Barnes, V. E.; Das, S.; Folgueras, S.; Gutay, L.; Jha, M. K.; Jones, M.; Jung, A. W.; Khatiwada, A.; Miller, D. H.; Neumeister, N.; Peng, C. C.; Qiu, H.; Schulte, J. F.; Sun, J.; Wang, F.; Xie, W.; Cheng, T.; Parashar, N.; Stupak, J.; Adair, A.; Chen, Z.; Ecklund, K. M.; Freed, S.; Geurts, F. J. M.; Guilbaud, M.; Kilpatrick, M.; Li, W.; Michlin, B.; Northup, M.; Padley, B. P.; Roberts, J.; Rorie, J.; Shi, W.; Tu, Z.; Zabel, J.; Zhang, A.; Bodek, A.; de Barbaro, P.; Demina, R.; Duh, Y. t.; Ferbel, T.; Galanti, M.; Garcia-Bellido, A.; Han, J.; Hindrichs, O.; Khukhunaishvili, A.; Lo, K. H.; Tan, P.; Verzetti, M.; Ciesielski, R.; Goulianos, K.; Mesropian, C.; Agapitos, A.; Chou, J. P.; Gershtein, Y.; Gómez Espinosa, T. A.; Halkiadakis, E.; Heindl, M.; Hughes, E.; Kaplan, S.; Kunnawalkam Elayavalli, R.; Kyriacou, S.; Lath, A.; Montalvo, R.; Nash, K.; Osherson, M.; Saka, H.; Salur, S.; Schnetzer, S.; Sheffield, D.; Somalwar, S.; Stone, R.; Thomas, S.; Thomassen, P.; Walker, M.; Delannoy, A. G.; Foerster, M.; Heideman, J.; Riley, G.; Rose, K.; Spanier, S.; Thapa, K.; Bouhali, O.; Castaneda Hernandez, A.; Celik, A.; Dalchenko, M.; De Mattia, M.; Delgado, A.; Dildick, S.; Eusebi, R.; Gilmore, J.; Huang, T.; Kamon, T.; Mueller, R.; Pakhotin, Y.; Patel, R.; Perloff, A.; Perniè, L.; Rathjens, D.; Safonov, A.; Tatarinov, A.; Ulmer, K. A.; Akchurin, N.; Damgov, J.; De Guio, F.; Dudero, P. R.; Faulkner, J.; Gurpinar, E.; Kunori, S.; Lamichhane, K.; Lee, S. W.; Libeiro, T.; Mengke, T.; Muthumuni, S.; Peltola, T.; Undleeb, S.; Volobouev, I.; Wang, Z.; Greene, S.; Gurrola, A.; Janjam, R.; Johns, W.; Maguire, C.; Melo, A.; Ni, H.; Padeken, K.; Sheldon, P.; Tuo, S.; Velkovska, J.; Xu, Q.; Arenton, M. W.; Barria, P.; Cox, B.; Hirosky, R.; Joyce, M.; Ledovskoy, A.; Li, H.; Neu, C.; Sinthuprasith, T.; Wang, Y.; Wolfe, E.; Xia, F.; Harr, R.; Karchin, P. E.; Poudyal, N.; Sturdy, J.; Thapa, P.; Zaleski, S.; Brodski, M.; Buchanan, J.; Caillol, C.; Dasu, S.; Dodd, L.; Duric, S.; Gomber, B.; Grothe, M.; Herndon, M.; Hervé, A.; Hussain, U.; Klabbers, P.; Lanaro, A.; Levine, A.; Long, K.; Loveless, R.; Polese, G.; Ruggles, T.; Savin, A.; Smith, N.; Smith, W. H.; Taylor, D.; Woods, N.

    2018-01-01

    The pseudorapidity distributions of charged hadrons in proton-lead collisions at nucleon-nucleon center-of-mass energies √{s_{NN}}=5.02 and 8.16 TeV are presented. The measurements are based on data samples collected by the CMS experiment at the LHC. The number of primary charged hadrons produced in non-single-diffractive proton-lead collisions is determined in the pseudorapidity range | η lab| < 2 .4. The charged-hadron multiplicity distributions are compared to the predictions from theoretical calculations and Monte Carlo event generators. In the center-of-mass pseudorapidity range | η cm| < 0 .5, the average charged-hadron multiplicity densities 〈d N ch/d η cm〉| ηcm| < 0.5 are 17 .31 ± 0 .01 (stat) ± 0 .59 (syst) and 20 .10 ± 0 .01 (stat) ± 0 .85(syst) at √{s_{NN}}=5.02 and 8.16 TeV, respectively. The particle densities per participant nucleon are compared to similar measurements in proton-proton, proton-nucleus, and nucleus-nucleus collisions. [Figure not available: see fulltext.

  15. Recent technological developments in forging; Recentes avancos tecnologicos no forjamento

    Energy Technology Data Exchange (ETDEWEB)

    Schaeffer, Lirio [Rio Grande do Sul Univ., Porto Alegre, RS (Brazil). Programa de Pos-graduacao em Engenharia Metalurgica e dos Materiais

    1987-12-31

    Recent advances in the area of open and closed die forging are summarized and discussed. The use of computer and alternatives such as incremental forging, sinter forging, liquid forging and precision forging are the main items reviewed 11 refs., 10 figs.

  16. Heavy forgings for reactor pressure vessels

    International Nuclear Information System (INIS)

    Cerjak, H.; Papouschek, F.

    1979-01-01

    The importance of forgings for an optimal design of nuclear components is described. Problems concerning the correlation of requirements, material behavior, fabrication and testing of forgings are discussed. (orig.) [de

  17. Microstructure evolution and mechanical properties of a particulate reinforced magnesium matrix composites forged at elevated temperatures

    International Nuclear Information System (INIS)

    Deng, K.K.; Wu, K.; Wang, X.J.; Wu, Y.W.; Hu, X.S.; Zheng, M.Y.; Gan, W.M.; Brokmeier, H.G.

    2010-01-01

    SiCp/AZ91 magnesium matrix composite was fabricated by stir casting. The as-cast ingots were cut into cylindrical billets, and then forged at different temperatures (320, 370, 420, 470 and 520 deg. C) at a constant RAM speed of 15 mm/s with 50% reduction. The microstructure evolution of the composites during forging was investigated by optical microscope, scanning electron microscope, and transmission electron microscope. The texture of the forged composites was measured by neutron diffraction. Mechanical properties of the composite at different forging temperatures were tested by tensile tests at room temperature. It was found that a strong basal plane texture formed during forging, and the intensity of basal plane texture weakened as forging temperatures increased. The particle distribution in the composite was significantly improved by hot forging. Typical microstructures were obtained after forging at different temperatures and the composite with different microstructures offered different mechanical properties during tensile test.

  18. Forging technology for large nuclear pressure vessel parts

    International Nuclear Information System (INIS)

    Kakimoto, Hideki; Ikegami, Tomonori

    2014-01-01

    The increasing output of nuclear power generation calls for larger vessels for next-generation nuclear power plants. A vessel with an increased diameter requires increased load for its forging, which can make it difficult to use a conventional solid die. In order to reduce the forging load, a rotary incremental forging method has been applied to hot forging. This method includes pressing and rotating a material in an incremental manner such that a target shape is obtained. This study aimed at improving the accuracy of numerical simulation for the rotary incremental forging to reduce the load when forging large vessels. This has enabled the temperature of the material and flow stress to be precisely predicted; an example of this is reported in the paper. Specifically, the heat transfer coefficient to be used for the numerical simulation had been determined experimentally from a small-scale hot-forging. The reduction of the flow stress associated with incremental forging, had been deduced from a compression test, and the value was applied to the numerical simulation. A preform was designed on the basis of the above simulation to perform a 1/1 size scale experiment. A precision of better than 5% has been confirmed for the shape prediction. (author)

  19. Forging New Cocoa Keys: The Impact of Unlocking the Cocoa Bean’s Genome on Pre-harvest Food Safety

    Science.gov (United States)

    Forging New Cocoa Keys: The Impact of Unlocking the Cocoa Bean’s Genome on Pre-harvest Food Safety David N. Kuhn, USDA ARS SHRS, Miami FL Sometimes it's hard to see the value and application of genomics to real world problems. How will sequencing the cacao genome affect West African farmers? Thi...

  20. 30 CFR 816.14 - Casing and sealing of drilled holes: Temporary.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: Temporary. 816.14 Section 816.14 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT...-SURFACE MINING ACTIVITIES § 816.14 Casing and sealing of drilled holes: Temporary. Each exploration hole...

  1. Constraints on nuclear parton distributions from W boson production in pPb collisions at $\\sqrt{s_{\\mathrm{NN}}} = 8.16~\\mathrm{TeV}$

    CERN Document Server

    CMS Collaboration

    2018-01-01

    The production of W bosons has been measured in proton-lead collisions at a nucleon-nucleon center-of-mass energy of $\\sqrt{s_{\\mathrm{NN}}} = 8.16~\\mathrm{TeV}$. The measurement of W bosons is performed in the $\\mathrm{W}\\rightarrow\\mu\

  2. International cooperation in cold forging technology

    DEFF Research Database (Denmark)

    Bay, Niels; Lange, K

    1992-01-01

    International cooperation in the field of cold forging technology started in 1961 by formation of the OECD Group of Experts on Metal Forming. In 1967 this group was transformed into the International Cold Forging Group, ICFG, an independent body which has now been operative for 25 years. Members...... of the ICFG are personally elected by the Plenary as experts within the field, often representing national groups within cold forging. The main work within the ICFG is carried out in its subgroups which are established by the Plenary to collect, compile and evaluate data and eventually also produce data...... by cooperative activities or by instigating national research. These subgroups have produced 9 data sheets and 7 guidelines on subjects such as materials, tool design and construction, calculation methods for cold forging tools, manufacture of slugs, lubrication aspects and small quantity production. Plenary...

  3. Hot forging of roll-cast high aluminum content magnesium alloys

    Science.gov (United States)

    Kishi, Tomohiro; Watari, Hisaki; Suzuki, Mayumi; Haga, Toshio

    2017-10-01

    This paper reports on hot forging of high aluminum content magnesium alloy sheets manufactured using horizontal twin-roll casting. AZ111 and AZ131 were applied for twin-roll casting, and a hot-forging test was performed to manufacture high-strength magnesium alloy components economically. For twin-roll casting, the casting conditions of a thick sheet for hot forging were investigated. It was found that twin-roll casting of a 10mm-thick magnesium alloy sheet was possible at a roll speed of 2.5m/min. The grain size of the cast strip was 50 to 70µm. In the hot-forging test, blank material was obtained from as-cast strip. A servo press machine with a servo die cushion was used to investigate appropriate forging conditions (e.g., temperature, forging load, and back pressure) for twin-roll casts (TRCs) AZ111 and AZ131. It was determined that high aluminum content magnesium alloy sheets manufactured using twin-roll casting could be forged with a forging load of 150t and a back pressure of 3t at 420 to 430°C. Applying back pressure during hot forging effectively forged a pin-shaped product.

  4. Stainless steel forgings for nuclear chemical plants

    International Nuclear Information System (INIS)

    1982-02-01

    This Specification covers detailed requirements for the supply of austenitic stainless steel forgings used in radioactive and corrosive areas within the Nuclear Industry. With the exception of 316S51 the materials specified are all suitable for contact with nitric acid, 316S51 being included as suitable for use in contact with sodium and other alkali metals at elevated temperatures. (author)

  5. Forging the frontiers: Travellers and documents on the South Africa-Mozambique border, 1890s-1940s

    Directory of Open Access Journals (Sweden)

    Andrew MacDonald

    Full Text Available It is well known that the Union of South Africa started to build an onerous border regime at the turn of the twentieth century in order to secure a White Man's Country in southern Africa. Newly formed, ambitious Immigration Departments consequently targeted 'Asiatics', poor whites and finally 'surplus' Africans from the 1920s onwards. An infrastructure of exclusion (detention and deportation compounds, police patrols, fingerprint offices and so on soon emerged at the region's maritime gateways as the colonial states sought to undermine decentralised indigenous societies characterised by long-term mobility. This article shows that the Union remained vulnerable on its eastern frontier with Mozambique and Swaziland, where 'undesirables' continued to arrive in numbers. Long-distance movement had a long precedent in these borderlands, and it proved difficult for colonial states to forge effective border controls until deep into the twentieth century. Based on extensive and critical engagement with multiple border control archives, the article traces the gradual 'paperisation of the border, and follows a thriving market in identity permits in southern Mozambique and Swaziland, which became important backdoor entry points to the Union. The main people to exploit corrupt local officials and entrepreneurial headmen on either side of the border were those associated with the merchant houses of coastal west India, syndicates from the Portuguese Atlantic island of Madeira, and long-distance, so-called 'tropical', African migrants. Together they forged sophisticated networks that moved permits, people and money across the region and gave south-east Africa's border builders hard and often thankless paperwork.

  6. 30 CFR 816.105 - Backfilling and grading: Thick overburden.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Backfilling and grading: Thick overburden. 816...-SURFACE MINING ACTIVITIES § 816.105 Backfilling and grading: Thick overburden. (a) Definition. Thick... surrounding terrain. (b) Performance standards. Where thick overburden occurs within the permit area, the...

  7. Transmission electron microscopy of Ti-12Mo-13Nb Alloy aged after heat forging; Microscopia eletronica de transmissao da liga Ti-12Mo-13Nb envelhecida apos forjamento a quente

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Nathalia Rodrigues [Centro Universitario de Volta Redonda (UNIFOA), Volta Redonda, RJ (Brazil); Baldan, Renato [Universidade de Sao Paulo (USP), Lorena, SP (Brazil). Escola de Engenharia; Nunes, Carlos Angelo; Mei, Paulo Roberto [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil); Gabriel, Sinara Borborema [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil)

    2014-06-15

    Metastable β-Ti alloys possess mechanical properties, in particular a elastic modulus that depends not only on its composition but also the applied thermomechanical treatments. These alloys require high mechanical strength and a low Young’s modulus to avoid stress shielding. Preliminary studies on the development of Ti- 13Nb-12Mo alloy showed than the better properties were obtained at aged at 500 ° C / 24 h after cold forging , whose microstructure consisted of bimodal α phase in the β matrix. In this work, Ti-12Mo-13Nb alloy was heat forged and aged at 500 deg C for 24h and the microstructure was analyzed by employing X-ray diffraction and transmission electron microscopy. According to the results, while the cold forging resulted in bimodal α phase in the β matrix, hot forging resulted in a fine and homogeneous α phase in the β matrix. (author)

  8. Fractography analysis of tool samples used for cold forging

    DEFF Research Database (Denmark)

    Dahl, K.V.

    2002-01-01

    Three fractured tool dies used for industrial cold forging have been investigated using light optical microscopy and scanning electron microscopy. Two of the specimens were produced using the traditional Böhler P/M steel grade s790, while the lastspecimen was a third generation P/M steel produced...... using new technology developed by Böhler. All three steels have the same nominal composition of alloying elements. The failure in both types of material occurs as a crack formation at a notch inside ofthe tool. Generally the cold forging dies constructed in third generation steels have a longer lifetime...

  9. Phased array inspection of large size forged steel parts

    Science.gov (United States)

    Dupont-Marillia, Frederic; Jahazi, Mohammad; Belanger, Pierre

    2018-04-01

    High strength forged steel requires uncompromising quality to warrant advance performance for numerous critical applications. Ultrasonic inspection is commonly used in nondestructive testing to detect cracks and other defects. In steel blocks of relatively small dimensions (at least two directions not exceeding a few centimetres), phased array inspection is a trusted method to generate images of the inside of the blocks and therefore identify and size defects. However, casting of large size forged ingots introduces changes of mechanical parameters such as grain size, the Young's modulus, the Poisson's ratio, and the chemical composition. These heterogeneities affect the wave propagation, and consequently, the reliability of ultrasonic inspection and the imaging capabilities for these blocks. In this context, a custom phased array transducer designed for a 40-ton bainitic forged ingot was investigated. Following a previous study that provided local mechanical parameters for a similar block, two-dimensional simulations were made to compute the optimal transducer parameters including the pitch, width and number of elements. It appeared that depending on the number of elements, backwall reconstruction can generate high amplitude artefacts. Indeed, the large dimensions of the simulated block introduce numerous constructive interferences from backwall reflections which may lead to important artefacts. To increase image quality, the reconstruction algorithm was adapted and promising results were observed and compared with the scattering cone filter method available in the CIVA software.

  10. Quality assurance for hammer forgings

    International Nuclear Information System (INIS)

    Potthast, E.

    1984-01-01

    The quality assurance program introduced by Arbed Saarstahl and laid down in a quality assurance manual is described. A particular attention is attached thereby both to quality practice proper and to a reliable flow of information amongst all the persons involved. The production and test sequence schedules of the hammer forging plant are illustrated by the example of a forged valve housing for nuclear power plants. These schedules specify not only the forging process in the individual production stages but also the workpiece contour after each working operation, the heat treatment, the furnace charging, and the inspection of finished parts. The formalization of the tests is designed both to promote the customer's trust towards the supplier and to prevent the formal operations involved from hindering further technical development. (orig.) [de

  11. Co-Operative Training in the Sheffield Forging Industry

    Science.gov (United States)

    Duncan, R.

    2008-01-01

    Purpose: The purpose of this paper is to give details of an operation carried out in Sheffield to increase the recruitment of young men into the steel forging industry. Design/methodology/approach: The Sheffield Forges Co-operative Training Scheme was designed to encourage boys to enter the forging industry and to provide them with training and…

  12. 21 CFR 172.816 - Methyl glucoside-coconut oil ester.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Methyl glucoside-coconut oil ester. 172.816 Section... HUMAN CONSUMPTION Multipurpose Additives § 172.816 Methyl glucoside-coconut oil ester. Methyl glucoside-coconut oil ester may be safely used in food in accordance with the following conditions: (a) It is the...

  13. 30 CFR 816.81 - Coal mine waste: General requirements.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: General requirements. 816.81... ACTIVITIES § 816.81 Coal mine waste: General requirements. (a) General. All coal mine waste disposed of in an... within a permit area, which are approved by the regulatory authority for this purpose. Coal mine waste...

  14. Phased Array Ultrasonic Inspection of Titanium Forgings

    International Nuclear Information System (INIS)

    Howard, P.; Klaassen, R.; Kurkcu, N.; Barshinger, J.; Chalek, C.; Nieters, E.; Sun, Zongqi; Fromont, F. de

    2007-01-01

    Aerospace forging inspections typically use multiple, subsurface-focused sound beams in combination with digital C-scan image acquisition and display. Traditionally, forging inspections have been implemented using multiple single element, fixed focused transducers. Recent advances in phased array technology have made it possible to perform an equivalent inspection using a single phased array transducer. General Electric has developed a system to perform titanium forging inspection based on medical phased array technology and advanced image processing techniques. The components of that system and system performance for titanium inspection will be discussed

  15. 20 CFR 408.816 - When does SVB entitlement end due to death?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When does SVB entitlement end due to death? 408.816 Section 408.816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Suspensions and Terminations Termination § 408.816 When does SVB entitlement end due to death? Your SVB entitlement ends wit...

  16. High-pressure X-ray diffraction studies on ThS up to 40 GPa using synchrotron radiation

    International Nuclear Information System (INIS)

    Benedict, U.; Spirlet, J.C.; Gerward, L.; Olsen, J.S.

    1983-12-01

    High-pressure X-ray diffraction studies have been performed on ThS up to 40 GPa using synchrotron radiation and a diamond anvil cell. The measured value of the bulk modulus B 0 =145 GPa is in disagreement with a previous measurement. The high-pressure behaviour indicates a phase transformation to ThS II starting at 15 to 20 GPa. The transformation is of second order nature, the resulting structure can be described as distorted fcc. (orig.)

  17. High pressure X-ray diffraction studies on ThS up to 40 GPa using synchrotron radiation

    International Nuclear Information System (INIS)

    Benedict, U.; Spirlet, J.C.; Gerward, L.; Olsen, J.S.

    1984-01-01

    High pressure X-ray diffraction studies (up to 40 GPa) were performed on ThS using synchrotron radiation and a diamond anvil cell. The measured value of 145 GPa for the bulk modulus B 0 disagrees with a previous measurement. The high pressure behaviour indicates a phase transformation to ThS II starting at 15 - 20 GPa. The transformation is of the second-order type, and the resulting structure can be described as distorted f.c.c. (Auth.)

  18. Study on the isothermal forging process of MB26 magnesium alloy adaptor

    Directory of Open Access Journals (Sweden)

    Xu Wenchen

    2015-01-01

    Full Text Available The isothermal forging process is an effective method to manufacture complex-shaped components of hard-to-work materials, such as magnesium alloys. This study investigates the isothermal forging process of an MB26 magnesium alloy adaptor with three branches. The results show that two-step forging process is appropriate to form the adaptor forging, which not only improves the filling quality but also reduces the forging load compared with one-step forging process. Moreover, the flow line is distributed along the contour of the complex-shaped adaptor forging.

  19. Near-Net Forging Technology Demonstration Program

    Science.gov (United States)

    Hall, I. Keith

    1996-01-01

    Significant advantages in specific mechanical properties, when compared to conventional aluminum (Al) alloys, make aluminum-lithium (Al-Li) alloys attractive candidate materials for use in cryogenic propellant tanks and dry bay structures. However, the cost of Al-Li alloys is typically five times that of 2219 aluminum. If conventional fabrication processes are employed to fabricate launch vehicle structure, the material costs will restrict their utilization. In order to fully exploit the potential cost and performance benefits of Al-Li alloys, it is necessary that near-net manufacturing methods be developed to off-set or reduce raw material costs. Near-net forging is an advanced manufacturing method that uses elevated temperature metal movement (forging) to fabricate a single piece, near-net shape, structure. This process is termed 'near-net' because only a minimal amount of post-forge machining is required. The near-net forging process was developed to reduce the material scrap rate (buy-to-fly ratio) and fabrication costs associated with conventional manufacturing methods. The goal for the near-net forging process, when mature, is to achieve an overall cost reduction of approximately 50 percent compared with conventional manufacturing options for producing structures fabricated from Al-Li alloys. This NASA Marshall Space Flight Center (MSFC) sponsored program has been a part of a unique government / industry partnership, coordinated to develop and demonstrate near-net forging technology. The objective of this program was to demonstrate scale-up of the near-net forging process. This objective was successfully achieved by fabricating four integrally stiffened, 170- inch diameter by 20-inch tall, Al-Li alloy 2195, Y-ring adapters. Initially, two 2195 Al-Li ingots were converted and back extruded to produce four cylindrical blockers. Conventional ring rolling of the blockers was performed to produce ring preforms, which were then contour ring rolled to produce

  20. Magnetostriction of heavily deformed Fe–Co binary alloys prepared by forging and cold rolling

    International Nuclear Information System (INIS)

    Yamaura, Shin-ichi; Nakajima, Takashi; Satoh, Takenobu; Ebata, Takashi; Furuya, Yasubumi

    2015-01-01

    Highlights: • The as-forged Fe 25 Co 75 alloy shows the magnetostriction of 108 ppm. • The as-cold rolled Fe 25 Co 75 alloy shows the magnetostriction of 140 ppm. • Magnetostriction of Fe–Co alloy reached the maximum in a single bcc state. • Fcc phase is harmful to the increase in magnetostriction of Fe–Co alloy. • Fcc phase precipitation in Fe–Co alloy can be suppressed by cold rolling. - Abstract: Magnetostriction of Fe 1−x Co x (x = 50–90 at%) alloys prepared by forging and subsequent cold-rolling was studied as functions of alloy compositions and thermomechanical treatments. Magnetostriction of the as-forged Fe 25 Co 75 alloy was 108 ppm and that of the as-cold rolled Fe 25 Co 75 alloy measured parallel to the rolling direction (RD) was 128 ppm. The cold-rolled Fe 25 Co 75 alloy possessed a nearly {1 0 0}<0 1 1> texture, leading to the maximum magnetostriction of 140 ppm when measured at an angle of 45° to RD. Moreover, the fully annealed Fe 25 Co 75 and Fe 20 Co 80 alloys were gradually cold rolled and magnetostriction were measured. Results showed that the magnetostriction of those cold-rolled alloys drastically increased with increasing reduction rate. According to the XRD and TEM observations, intensity of the fcc peak gradually decreased with increasing reduction rate and that the alloys became to be in a bcc single state at a reduction rate higher than 90%, leading to a drastic increase in magnetostriction

  1. Instant forgedUI starter

    CERN Document Server

    Luiz, Joseandro

    2013-01-01

    Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks.The book is a Starter guide to learning ForgedUI. This book will start by unfolding the installation and creating a simple application using Titanium and ForgedUI, followed by taking you through the features to model an engaging UI and generate multi-platform code with Titanium, while covering the best design practice for Apple and Android application development. Last but not least, you will also come across the available resources where you can

  2. An empirical model for friction in cold forging

    DEFF Research Database (Denmark)

    Bay, Niels; Eriksen, Morten; Tan, Xincai

    2002-01-01

    With a system of simulative tribology tests for cold forging the friction stress for aluminum, steel and stainless steel provided with typical lubricants for cold forging has been determined for varying normal pressure, surface expansion, sliding length and tool/work piece interface temperature...... of normal pressure and tool/work piece interface temperature. The model is verified by process testing measuring friction at varying reductions in cold forward rod extrusion. KEY WORDS: empirical friction model, cold forging, simulative friction tests....

  3. Die forging of the alloys Az80 and Zk60

    NARCIS (Netherlands)

    Kurz, G.; Clauw, B.; Sillekens, W.H.; Letzig, D.

    2009-01-01

    Overall goal of the MagForge project is to provide tailored and cost-effective technologies for the industrial manufacturing of magnesium forged components. Scientific and technological aspects are new alloys/feedstock materials with improved performance, forging process modeling and design tools

  4. 30 CFR 816.43 - Diversions.

    Science.gov (United States)

    2010-07-01

    ... into underground mines without approval of the regulatory authority under § 816.41(i). (2) The... construction of all diversions of perennial and intermittent streams and all stream restorations. The design... diversion or stream restoration meets all construction requirements of this section and is in accordance...

  5. Sintering and densification; new techniques: sinter forging

    International Nuclear Information System (INIS)

    Winnubst, A.J.A.

    1998-01-01

    In this chapter pressure assisted sintering methods will be described. Attention will mainly be paid to sinter forging as a die-wall free uniaxial pressure sintering technique, where large creep strains are possible. Sinter forging is an effective tool to reduce sintering temperature and time and to obtain a nearly theoretically dense ceramic. In this way grain size in tetragonal zirconia ceramics can be reduced down to 100 nm. Another important phenomenon is the reduction of the number density and size of cracks and flaws resulting in higher strength and improved reliability, which is of utmost importance for engineering ceramics. The creep deformation during sinter forging causes a rearrangement of the grains resulting in a reduction of interatomic spaces between grains, while grain boundary (glassy) phases can be removed. The toughness and in some cases the wear resistance is enhanced after sinter forging as a result of the grain-boundary-morphology improvement. (orig.)

  6. A-508 class 3 forgings for pressure vessels

    International Nuclear Information System (INIS)

    Comon, J.

    1977-01-01

    The manufacture of the forged parts of the first PWR nuclear pressure vessel installed in France started in the Creusot-Loire's Forge Plant in 1961. Since this date, more than 300 forgings of this type were delivered (flanges, rings, zones, and nozzles). The major part of these forgings were made of Mn, Ni, Mo steel (SA 508 class 3). They represent a population large and homogeneous enough to attempt a statistical analysis of chemical and mechanical test results. The aim of this analysis was double: (1) a better knowledge of the scattering of the results and a better estimate of what can be introduced or accepted in a specification, and (2) the setting up of correlations existing between these results, particularly between chemical analysis and mechanical test results. In addition to this statistical analysis concerning industrial results, several laboratory studies are presented, giving a more complete characterization of SA 508 class 3. All these results form a very complete documentation showing that SA 508 class 3 steel is suitable for the manufacture of large forged vessels requiring a high degree of reliability

  7. Analysis of hot rolling and hot forging effects on mechanical properties and microstructure of ZrNbMoGe alloy

    International Nuclear Information System (INIS)

    AH Ismoyo; Parikin; Bandriyana

    2014-01-01

    Research on formation technique by a combined method of rolling and forging has been carried out in order to improve the mechanical properties of ZrNbMoGe alloy to be used as fuel cladding in NPP (Nuclear Power Plant) application. The effects of rolling and forging were analyzed several tests. The tests were conducted for zirconium alloy specimen with a composition of (in % wt.) 97% Zr, 0,5% Mo, 2% Nb and 0,5% Ge, where the specimen was melted with an arc-furnace. The hot rolling and forging were conducted at 900 °C and 950 °C respectively. Hardness test was carried out by using a microhardness testing machine, while microstructure examination and crystal structure analysis were conducted with an optical microscope and an X-ray diffractometer. The results show that the hardness of the alloy increase from 141.21 HV (starting material) to 210.47 HV (hot rolled material) and 365.75 HV (hot forged material). Texturing phenomenon is clearly figured on the microstructure due to hot rolling and forging process. Analysis by diffractogram also indicates that the hot rolling and forging process has influence on the crystal orientation of dominant preferred direction in the reflection plane of (10ī1), recorded from the rise of intensity counting from about 2500 to 3000. In summary, hot forging and rolling process can change the mechanical properties (hardness and texture) and microstructure of materials. (author)

  8. Strain-induced grain growth of cryomilled nanocrystalline Al in trimodal composites during forging

    International Nuclear Information System (INIS)

    Yao, B.; Simkin, B.; Majumdar, B.; Smith, C.; Bergh, M. van den; Cho, K.; Sohn, Y.H.

    2012-01-01

    Highlights: ► Grain growth of cryomilled nanocrystalline aluminum during hot forging. ► Use of hollow cone dark field imaging technique in TEM for grain size measurement. ► Grain growth model of strain, strain rate and temperature for forging optimization. - Abstract: Grain growth of nanocrystalline aluminum ( nc Al) in trimodal Al metal-matrix-composites (MMCs) during hot forging was investigated. The nc Al phase formed through cryomilling of inert gas-atomized powders in liquid nitrogen has an average grain size down to 21 nm, exhibits excellent thermal stability. However, substantial grain growth of nc Al up to 63 nm was observed when the Al MMCs were thermo-mechanically processed even at relatively low temperatures. Grain growth of the cryomilled nc Al phase in trimodal Al MMCs after hot forging was documented with respect to temperature ranging from 175 °C to 287 °C, true strain ranging from 0.4 to 1.35 and strain rate ranging from 0.1 to 0.5 s −1 . Hollow cone dark field imaging technique was employed to provide statistically confident measurements of nc Al grain size that ranged from 21 to 63 nm. An increase in forging temperature and an increase in true strain were correlated with an increase in grain size of nc Al. Results were correlated to devise a phenomenological grain growth model for forging that takes strain, strain rate and temperature into consideration. Activation energy for the grain growth during thermo-mechanical hot-forging was determined to be 35 kJ/mol, approximately a quarter of activation energy for bulk diffusion of Al and a half of activation energy for static recrystallization.

  9. Effect of Laser Preheating AISI 4140 Specimens for Micro-Forging

    Directory of Open Access Journals (Sweden)

    Jung C.

    2017-06-01

    Full Text Available Many high performance and permanent service parts require suitable material characteristics-high fatigue strength is one of the most important characteristics. For this reason, surface treatment processes are essential to increase the material performance and avoid the use of costly ineffective material. There exist various surface treatment processes for various applications. Each process has advantages and disadvantages and hybridization can solve various problems. The micro-forging process delivers a controlled and uniform surface hardness, but the depth of the forged surface is limited. On the other hand, laser heat treatment can increase the hardness drastically, but the surface may become brittle, which reduces the fatigue life. Laser-assisted micro-forging is a novel hybrid process of laser heat treatment and micro-forging that has the potential to increase the forging depth and relax the stress caused by the high temperature of the forging process.

  10. The evolution of microtexture and macrotexture during subtransus forging of Ti-10V-2Fe-3Al

    International Nuclear Information System (INIS)

    Raghunathan, S.L.; Dashwood, R.J.; Jackson, M.; Vogel, S.C.; Dye, D.

    2008-01-01

    The macrotextures and microtextures produced during α+β forging of Ti-10V-2Fe-3Al were characterised using neutron, in situ synchrotron X-ray and ex situ electron backscatter diffraction (EBSD). The EBSD analysis showed that the measured misorientation distributions at a strain of 0.8 and strain rates of 0.1 and 0.01s -1 were similar, with an average misorientation of 2.2 deg. During forging, the moderate cube macrotexture inherited from the parent material was converted into a moderate fibre texture, with the major change occurring between strains of 0.4 and 0.6. The synchrotron diffraction studies allowed the orientation evolution of individual grains to be characterised. At the highest strain rate of 0.1s -1 , this indicated a change in behaviour from dispersion of the crystal mosaic (peak angular spread) at low strains, to convergence of the crystal mosaic at larger strains. At lower strain rates, only convergence of the crystal mosaic was observed. It is suggested that these results indicate a change in mechanism between deformation-controlled behaviour during the early stages of deformation and a strain rate of 0.1s -1 and diffusional, recovery-controlled behaviour at lower strain rates and higher strains

  11. 48 CFR 252.225-7025 - Restriction on acquisition of forgings.

    Science.gov (United States)

    2010-10-01

    ... of forgings. 252.225-7025 Section 252.225-7025 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.225-7025 Restriction on acquisition of forgings. As prescribed in 225.7102-4, use the following clause: Restriction on Acquisition of Forgings (DEC 2009) (a...

  12. Magnetostriction of heavily deformed Fe–Co binary alloys prepared by forging and cold rolling

    Energy Technology Data Exchange (ETDEWEB)

    Yamaura, Shin-ichi, E-mail: yamaura@imr.tohoku.ac.jp [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba, Sendai 980-8577 (Japan); Nakajima, Takashi [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba, Sendai 980-8577 (Japan); Satoh, Takenobu; Ebata, Takashi [Tohoku Steel, Co., Ltd., 23 Nishigaoka, Murata, Murata-machi, Shibata 989-1393 (Japan); Furuya, Yasubumi [North Japan Research Institute for Sustainable Energy, Hirosaki University, 2-1-3 Matsubara, Aomori 030-0813 (Japan)

    2015-03-15

    Highlights: • The as-forged Fe{sub 25}Co{sub 75} alloy shows the magnetostriction of 108 ppm. • The as-cold rolled Fe{sub 25}Co{sub 75} alloy shows the magnetostriction of 140 ppm. • Magnetostriction of Fe–Co alloy reached the maximum in a single bcc state. • Fcc phase is harmful to the increase in magnetostriction of Fe–Co alloy. • Fcc phase precipitation in Fe–Co alloy can be suppressed by cold rolling. - Abstract: Magnetostriction of Fe{sub 1−x}Co{sub x} (x = 50–90 at%) alloys prepared by forging and subsequent cold-rolling was studied as functions of alloy compositions and thermomechanical treatments. Magnetostriction of the as-forged Fe{sub 25}Co{sub 75} alloy was 108 ppm and that of the as-cold rolled Fe{sub 25}Co{sub 75} alloy measured parallel to the rolling direction (RD) was 128 ppm. The cold-rolled Fe{sub 25}Co{sub 75} alloy possessed a nearly {1 0 0}<0 1 1> texture, leading to the maximum magnetostriction of 140 ppm when measured at an angle of 45° to RD. Moreover, the fully annealed Fe{sub 25}Co{sub 75} and Fe{sub 20}Co{sub 80} alloys were gradually cold rolled and magnetostriction were measured. Results showed that the magnetostriction of those cold-rolled alloys drastically increased with increasing reduction rate. According to the XRD and TEM observations, intensity of the fcc peak gradually decreased with increasing reduction rate and that the alloys became to be in a bcc single state at a reduction rate higher than 90%, leading to a drastic increase in magnetostriction.

  13. Analysis of reforming process of large distorted ring in final enlarging forging

    International Nuclear Information System (INIS)

    Miyazawa, Takeshi; Murai, Etsuo

    2002-01-01

    In the construction of reactors or pressure vessels for oil chemical plants and nuclear power stations, mono block open-die forging rings are often utilized. Generally, a large forged ring is manufactured by means of enlarging forging with reductions of the wall thickness. During the enlarging process the circular ring is often distorted and becomes an ellipse in shape. However the shape control of the ring is a complicated work. This phenomenon makes the matter still worse in forging of larger rings. In order to make precision forging of large rings, we have developed the forging method using a v-shape anvil. The v-shape anvil is geometrically adjusted to fit the distorted ring in the final circle and reform automatically the shape of the ring during enlarging forging. This paper has analyzed the reforming process of distorted ring by computer program based on F.E.M. and examined the effect on the precision of ring forging. (author)

  14. arXiv Top-quark pair production cross sections at NNLO+NNLL in pPb collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV

    CERN Document Server

    d'Enterria, David

    Total and fiducial top pair ($t\\bar{t}$) production cross sections in proton-lead (pPb) collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV are computed at next-to-next-to-leading-order (NNLO) accuracy including next-to-next-to-leading-log (NNLL) gluon resummation, using the CT14 and CT10 proton parton distribution functions (PDF), and the EPPS16 and EPS09 nuclear PDF parametrizations for the lead ion. The total cross sections amount to $\\sigma(pPb\\to t\\bar{t}+X) = 59.0 \\pm 5.3$(CT14+EPPS16)$\\,^{+1.6}_{-2.1}$(scale) nb, and $57.5 \\pm \\,^{+4.3}_{-3.3}$(CT10+EPS09)$\\,^{+1.5}_{-2.0}$(scale) nb, with small modifications with respect to the result computed using the free proton PDF alone. The normalized ratio of pPb to pp cross sections (nuclear modification factor) is $R_{pPb} = 1.04 \\,^{\\pm 0.07(EPPS16)}_{\\pm0.03(EPS09)}$. In the lepton+jets decay mode, $t\\bar{t} \\to b\\bar{b} W(\\ell\

  15. File list: Unc.Emb.50.AllAg.8-16h_embryos [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Emb.50.AllAg.8-16h_embryos dm3 Unclassified Embryo 8-16h embryos SRX025491,SRX0...25483,SRX025465,SRX025481 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Emb.50.AllAg.8-16h_embryos.bed ...

  16. Optimization of Thermo-Mechanical Processing for Forging of Newly Developed Creep-Resistant Magnesium Alloy ABaX633

    Directory of Open Access Journals (Sweden)

    Kamineni Pitcheswara Rao

    2017-11-01

    Full Text Available The compressive strength and creep resistance of cast Mg-6Al-3Ba-3Ca (ABaX633 alloy has been measured in the temperature range of 25 to 250 °C, and compared with that of its predecessor ABaX422. The alloy is stronger and more creep-resistant than ABaX422, and exhibits only a small decrease of yield stress with temperature. The higher strength of ABaX633 is attributed to a larger volume fraction of intermetallic particles (Al, Mg2Ca and Mg21Al3Ba2 in its microstructure. Hot deformation mechanisms in ABaX633 have been characterized by developing a processing map in the temperature and strain rate ranges of 300 to 500 °C and 0.0003 to 10 s−1. The processing map exhibits two workability domains in the temperature and strain rate ranges of: (1 380 to 475 °C and 0.0003 to 0.003 s−1, and (2 480–500 °C and 0.003 to 0.5 s−1. The apparent activation energy values estimated in the above two domains (204 and 216 kJ/mol are higher than that for lattice self-diffusion of Mg, which is attributed to the large back-stress that is caused by the intermetallic particles. Optimum condition for bulk working is 500 °C and 0.01 s−1 at which hot workability will be maximum. Flow instability is exhibited at lower temperatures and higher strain rates, as well as at higher temperatures and higher strain rates. The predictions of the processing map on the workability domains, as well as the instability regimes are fully validated by the forging of a rib-web (cup shaped component under optimized conditions.

  17. File list: Unc.Emb.10.AllAg.8-16h_embryos [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Emb.10.AllAg.8-16h_embryos dm3 Unclassified Embryo 8-16h embryos SRX025491,SRX0...25483,SRX026868,SRX026870,SRX025481,SRX025465 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Emb.10.AllAg.8-16h_embryos.bed ...

  18. Medium carbon vanadium steels for closed die forging

    International Nuclear Information System (INIS)

    Jeszensky, Gabor; Plaut, Ronald Lesley

    1993-01-01

    This work analyses the medium carbon micro alloyed vanadium potential for closed die forged production. The steels reach the mechanical resistance requests during cooling after forging, eliminating the subsequent thermal treatment. Those steels also present good fatigue resistance and machinability. The industrial scale experiments are also reported

  19. Gear hot forging process robust design based on finite element method

    International Nuclear Information System (INIS)

    Xuewen, Chen; Won, Jung Dong

    2008-01-01

    During the hot forging process, the shaping property and forging quality will fluctuate because of die wear, manufacturing tolerance, dimensional variation caused by temperature and the different friction conditions, etc. In order to control this variation in performance and to optimize the process parameters, a robust design method is proposed in this paper, based on the finite element method for the hot forging process. During the robust design process, the Taguchi method is the basic robust theory. The finite element analysis is incorporated in order to simulate the hot forging process. In addition, in order to calculate the objective function value, an orthogonal design method is selected to arrange experiments and collect sample points. The ANOVA method is employed to analyze the relationships of the design parameters and design objectives and to find the best parameters. Finally, a case study for the gear hot forging process is conducted. With the objective to reduce the forging force and its variation, the robust design mathematical model is established. The optimal design parameters obtained from this study indicate that the forging force has been reduced and its variation has been controlled

  20. Optimum design of forging process parameters and preform shape under uncertainties

    International Nuclear Information System (INIS)

    Repalle, Jalaja; Grandhi, Ramana V.

    2004-01-01

    Forging is a highly complex non-linear process that is vulnerable to various uncertainties, such as variations in billet geometry, die temperature, material properties, workpiece and forging equipment positional errors and process parameters. A combination of these uncertainties could induce heavy manufacturing losses through premature die failure, final part geometric distortion and production risk. Identifying the sources of uncertainties, quantifying and controlling them will reduce risk in the manufacturing environment, which will minimize the overall cost of production. In this paper, various uncertainties that affect forging tool life and preform design are identified, and their cumulative effect on the forging process is evaluated. Since the forging process simulation is computationally intensive, the response surface approach is used to reduce time by establishing a relationship between the system performance and the critical process design parameters. Variability in system performance due to randomness in the parameters is computed by applying Monte Carlo Simulations (MCS) on generated Response Surface Models (RSM). Finally, a Robust Methodology is developed to optimize forging process parameters and preform shape. The developed method is demonstrated by applying it to an axisymmetric H-cross section disk forging to improve the product quality and robustness

  1. First Results of Energy Saving at Process Redesign of Die Forging Al-Alloys

    International Nuclear Information System (INIS)

    Pepelnjak, Tomaz; Kuzman, Karl; Kokol, Anton

    2011-01-01

    The contribution deals with eco-friendly solutions for shortened production chains of forging light alloys. During the die forging operations a remarkable amount of material goes into the flash and later on into chips during finish machining. These low value side products are rich with embedded energy therefore recycling or reprocessing could be very energy saving procedure.In cooperation with a die forging company a shortened reprocessing cycle has been studied starting from re-melting the forging flash and without additional heating to cast preforms for subsequent die forging. As such preforms have not as good formability characteristics as those done from extruded billets the isothermal forging process has been adopted. First results showed that without cracks and other defects the formability is sufficient for a broad spectrum of forgings.To improve the formability a homogenization process of cast preforms has been implemented. As the process started immediately after casting, amount of additional energy for heating was minimized. To reduce voids forging process was redesigned in a way to assure greater hydrostatic pressures in parts during forging. First results were promising therefore research is going towards improving processes without adding significantly more energy as it is needed for casting with homogenization and die forging.

  2. Ultra-large size austenitic stainless steel forgings for fast breeder reactor 'Monju'

    International Nuclear Information System (INIS)

    Tsukada, Hisashi; Suzuki, Komei; Sato, Ikuo; Miura, Ritsu.

    1988-01-01

    The large SUS 304 austenitic stainless steel forgings for the reactor vessel of the prototype FBR 'Monju' of 280 MWe output were successfully manufactured. The reactor vessel contains the heart of the reactor and sodium coolant at 530 deg C, and its inside diameter is about 7 m, and height is about 18 m. It is composed of 12 large forgings, that is, very thick flanges and shalls made by ring forging and an end plate made by disk forging and hot forming, using a special press machine. The manufacture of these large forgings utilized the results of the basic test on the material properties in high temperature environment and the effect that the manufacturing factors exert on the material properties and the results of the development of manufacturing techniques for superlarge forgings. The problems were the manufacturing techniques for the large ingots of 250 t class of high purity, the hot working techniques for stainless steel of fine grain size, the forging techniques for superlarge rings and disks, and the machining techniques of high precision for particularly large diameter, thin wall rings. The manufacture of these large stainless steel forgings is reported. (Kako, I.)

  3. 77 FR 14445 - Application for a License To Export Steel Forging

    Science.gov (United States)

    2012-03-09

    ... NUCLEAR REGULATORY COMMISSION Application for a License To Export Steel Forging Pursuant to 10 CFR 110.70(b) ``Public Notice of Receipt of an Application,'' please take notice that the Nuclear... head steel February 7, 2012 forging. forging will be XR175 machined into the 11005983 finished vessel...

  4. Mannes of Forging and Perspectives of Knuckle Joint Presses Modernization

    Directory of Open Access Journals (Sweden)

    A. A. Antsifirov

    2014-01-01

    Full Text Available The article raises an issue to enhance technological forging capabilities on the known knuckle joint presses. It provides an illustrated overview of main design types of presses with crank-knuckle, toggle-knuckle, and knuckle joint mechanisms. The article also shows the advantages of the modernization way and improvement just of the active press equipment in terms of quality-to-price ratio, for example, as compared to the similar new foreign press equipment.It gives an overview of features, which provide forging processes owing to kinetic energy accumulated with the moving parts of the known designs of the knuckle joint presses depending on the drive actuating mechanism. Focused attention is drawn to forging on the knuckle joint presses for a time of contact with a work piece to be comparable with the duration of the work piece deformation process on hydraulic forging hammers. This allows us to forge thin-wall products with process automation compared to the forging hammers.Analysis of accumulating processes of kinetic energy by the moving parts of the knuckle joint presses has shown that presses driven by hydraulic cylinders or two screw hydraulic cylinder are the most optimal for technological operations as evidenced by references to domestic and foreign invention certificates and patents. The article presents disadvantages of forging on presses with hydraulic or pneumatic drive. It is a dependence of the deformation force, caused, mainly, by a force of the drive cylinder. The article gives linear movement rate quantities of press moving members depending on the drives of the actuating mechanism. Based on the above analysis of the features to manufacture work pieces on the knuckle joint presses, the article gives the rationale for the relevance of forging in a short period of time, provided that the moving parts of the press accumulate the required kinetic energy. This can be achieved only through modernization and improvement of forging

  5. Optical Forging of Graphene into Three-Dimensional Shapes.

    Science.gov (United States)

    Johansson, Andreas; Myllyperkiö, Pasi; Koskinen, Pekka; Aumanen, Jukka; Koivistoinen, Juha; Tsai, Hung-Chieh; Chen, Chia-Hao; Chang, Lo-Yueh; Hiltunen, Vesa-Matti; Manninen, Jyrki J; Woon, Wei Yen; Pettersson, Mika

    2017-10-11

    Atomically thin materials, such as graphene, are the ultimate building blocks for nanoscale devices. But although their synthesis and handling today are routine, all efforts thus far have been restricted to flat natural geometries, since the means to control their three-dimensional (3D) morphology has remained elusive. Here we show that, just as a blacksmith uses a hammer to forge a metal sheet into 3D shapes, a pulsed laser beam can forge a graphene sheet into controlled 3D shapes in the nanoscale. The forging mechanism is based on laser-induced local expansion of graphene, as confirmed by computer simulations using thin sheet elasticity theory.

  6. Forging of cast Mg-3Sn-2Ca-0.4Al-0.4Si magnesium alloy using processing map

    International Nuclear Information System (INIS)

    Rao, K. P.; Suresh, K.; Prasad, Y. V. R. K.; Hort, N.; Kainer, K. U.

    2016-01-01

    Mg-3Sn-2Ca (TX32) alloy has good creep resistance but limited workability. Minor amounts of Al and Si have been added to TX32 for improving its hot workability. The processing map for the TX32-0.4Al-0.4Si alloy exhibited two workability domains in the temperature and strain rate ranges: (1) 310-415.deg.C/0.0003-0.003 s-1 and (2) 430-500.deg.C/0.003-3 s-1. The alloy exhibited flow instability at temperatures < 350.deg.C at strain rates > 0.01 s-1. The alloy has been forged to produce a cup shape component to validate these findings of processing map. Finite-element (FE) simulation has been performed for obtaining the local variations of strain and strain rate within the forging. The microstructures of the forged components under the optimal domain conditions revealed dynamically recrystallized grains, and those forged in the flow instability regime have fractured and exhibited flow localization bands and cracks. The experimental load stroke curves correlated well with those obtained by FE simulation.

  7. Forging of cast Mg-3Sn-2Ca-0.4Al-0.4Si magnesium alloy using processing map

    Energy Technology Data Exchange (ETDEWEB)

    Rao, K. P.; Suresh, K.; Prasad, Y. V. R. K. [University of Hong Kong, Hong Kong (China); Hort, N.; Kainer, K. U. [Magnesium Innovation Centre, Geesthacht (Germany)

    2016-06-15

    Mg-3Sn-2Ca (TX32) alloy has good creep resistance but limited workability. Minor amounts of Al and Si have been added to TX32 for improving its hot workability. The processing map for the TX32-0.4Al-0.4Si alloy exhibited two workability domains in the temperature and strain rate ranges: (1) 310-415.deg.C/0.0003-0.003 s-1 and (2) 430-500.deg.C/0.003-3 s-1. The alloy exhibited flow instability at temperatures < 350.deg.C at strain rates > 0.01 s-1. The alloy has been forged to produce a cup shape component to validate these findings of processing map. Finite-element (FE) simulation has been performed for obtaining the local variations of strain and strain rate within the forging. The microstructures of the forged components under the optimal domain conditions revealed dynamically recrystallized grains, and those forged in the flow instability regime have fractured and exhibited flow localization bands and cracks. The experimental load stroke curves correlated well with those obtained by FE simulation.

  8. Development of high purity large forgings for nuclear power plants

    International Nuclear Information System (INIS)

    Tanaka, Yasuhiko; Sato, Ikuo

    2011-01-01

    The recent increase in the size of energy plants has been supported by the development of manufacturing technology for high purity large forgings for the key components of the plant. To assure the reliability and performance of the large forgings, refining technology to make high purity steels, casting technology for gigantic ingots, forging technology to homogenize the material and consolidate porosity are essential, together with the required heat treatment and machining technologies. To meet these needs, the double degassing method to reduce impurities, multi-pouring methods to cast the gigantic ingots, vacuum carbon deoxidization, the warm forging process and related technologies have been developed and further improved. Furthermore, melting facilities including vacuum induction melting and electro slag re-melting furnaces have been installed. By using these technologies and equipment, large forgings have been manufactured and shipped to customers. These technologies have also been applied to the manufacture of austenitic steel vessel components of the fast breeder reactors and components for fusion experiments.

  9. Development of high purity large forgings for nuclear power plants

    Science.gov (United States)

    Tanaka, Yasuhiko; Sato, Ikuo

    2011-10-01

    The recent increase in the size of energy plants has been supported by the development of manufacturing technology for high purity large forgings for the key components of the plant. To assure the reliability and performance of the large forgings, refining technology to make high purity steels, casting technology for gigantic ingots, forging technology to homogenize the material and consolidate porosity are essential, together with the required heat treatment and machining technologies. To meet these needs, the double degassing method to reduce impurities, multi-pouring methods to cast the gigantic ingots, vacuum carbon deoxidization, the warm forging process and related technologies have been developed and further improved. Furthermore, melting facilities including vacuum induction melting and electro slag re-melting furnaces have been installed. By using these technologies and equipment, large forgings have been manufactured and shipped to customers. These technologies have also been applied to the manufacture of austenitic steel vessel components of the fast breeder reactors and components for fusion experiments.

  10. ALICE luminosity determination for p-Pb collisions at $\\sqrt{s_{\\rm NN}}=8.16$ TeV

    CERN Document Server

    2018-01-01

    Luminosity determination in ALICE is based on visible cross sections measured in van der Meer scans. In 2016, the Large Hadron Collider provided proton-lead collisions at a centre-of-mass energy of $\\sqrt{s_{\\rm NN}}=8.16$ TeV. There were two scans, one with the proton beam traveling towards the ALICE forward muon spectrometer and the second with the proton beam traveling in the opposite direction. During these scans cross sections were measured for two classes of visible interactions, based on particle detection in the ALICE luminometers: the T0 detector with pseudorapidity coverage $4.6<\\eta< 4.9$, $-3.3<\\eta<-3.0$ and the V0 detector covering $2.8<\\eta< 5.1$, $-3.7<\\eta<-1.7$. This document describes the experimental setup for such measurements and reports their results.

  11. FE-simulation of hot forging with an integrated heat treatment with the objective of residual stress prediction

    Science.gov (United States)

    Behrens, Bernd-Arno; Chugreeva, Anna; Chugreev, Alexander

    2018-05-01

    Hot forming as a coupled thermo-mechanical process comprises numerous material phenomena with a corresponding impact on the material behavior during and after the forming process as well as on the final component performance. In this context, a realistic FE-simulation requires reliable mathematical models as well as detailed thermo-mechanical material data. This paper presents experimental and numerical results focused on the FE-based simulation of a hot forging process with a subsequent heat treatment step aiming at the prediction of the final mechanical properties and residual stress state in the forged component made of low alloy CrMo-steel DIN 42CrMo4. For this purpose, hot forging experiments of connecting rod geometry with a corresponding metallographic analysis and x-ray residual stress measurements have been carried out. For the coupled thermo-mechanical-metallurgical FE-simulations, a special user-defined material model based on the additive strain decomposition method and implemented in Simufact Forming via MSC.Marc solver features has been used.

  12. Development of Oxide Dispersion Strengthened (ODS) Ferritic Steel Through Powder Forging

    Science.gov (United States)

    Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

    2017-04-01

    Oxide dispersion strengthened (ODS) ferritic steels are candidates for cladding tubes in fast breeder nuclear reactors. In this study, an 18%Cr ODS ferritic steel was prepared through powder forging route. Elemental powders with a nominal composition of Fe-18Cr-2 W-0.2Ti (composition in wt.%) with 0 and 0.35% yttria were prepared by mechanical alloying in a Simoloyer attritor under argon atmosphere. The alloyed powders were heated in a mild steel can to 1473 K under flowing hydrogen atmosphere. The can was then hot forged. Steps of sealing, degassing and evacuation are eliminated by using powder forging. Heating ODS powder in hydrogen atmosphere ensures good bonding between alloy powders. A dense ODS alloy with an attractive combination of strength and ductility was obtained after re-forging. On testing at 973 K, a loss in ductility was observed in yttria-containing alloy. The strength and ductility increased with increase in strain rate at 973 K. Reasons for this are discussed. The ODS alloy exhibited a recrystallized microstructure which is difficult to achieve by extrusion. No prior particle boundaries were observed after forging. The forged compacts exhibited isotropic mechanical properties. It is suggested that powder forging may offer several advantages over the traditional extrusion/HIP routes for fabrication of ODS alloys.

  13. KIT(D816V) Induces SRC-Mediated Tyrosine Phosphorylation of MITF and Altered Transcription Program in Melanoma

    DEFF Research Database (Denmark)

    Phung, Bengt; Kazi, Julhash U; Lundby, Alicia

    2017-01-01

    The oncogenic D816V mutation of the KIT receptor is well characterized in systemic mastocytosis and acute myeloid leukemia. Although KIT(D816V) has been found in melanoma, its function and involvement in this malignancy is not understood. Here we show that KIT(D816V) induces tyrosine phosphorylat......The oncogenic D816V mutation of the KIT receptor is well characterized in systemic mastocytosis and acute myeloid leukemia. Although KIT(D816V) has been found in melanoma, its function and involvement in this malignancy is not understood. Here we show that KIT(D816V) induces tyrosine.......Implications: This study demonstrates that an oncogenic tyrosine kinase mutant, KIT(D816V), can alter the transcriptional program of the transcription factor MITF in melanoma Mol Cancer Res; 15(9); 1265-74. ©2017 AACR....

  14. Medium carbon vanadium micro alloyed steels for drop forging

    International Nuclear Information System (INIS)

    Jeszensky, Gabor; Plaut, Ronald Lesley

    1992-01-01

    Growing competitiveness of alternative manufacturing routes requires cost minimization in the production of drop forged components. The authors analyse the potential of medium carbon, vanadium microalloyed steels for drop forging. Laboratory and industrial experiments have been carried out emphasizing deformation and temperature cycles, strain rates and dwell times showing a typical processing path, associated mechanical properties and corresponding microstructures. The steels the required levels of mechanical properties on cooling after forging, eliminating subsequent heat treatment. The machinability of V-microalloyed steels is also improved when compared with plain medium carbon steels. (author)

  15. Study on Manufacturing Process of Hollow Main Shaft by Open Die Forging

    International Nuclear Information System (INIS)

    Kwon, Yong Chul; Kang, Jong Hun; Kim, Sang Sik

    2016-01-01

    The main shaft is one of the key components connecting the rotor hub and gear box of a wind power generator. Typically, main shafts are manufactured by open die forging method. However, the main shaft for large MW class wind generators is designed to be hollow in order to reduce the weight. Additionally, the main shafts are manufactured by a casting process. This study aims to develop a manufacturing process for hollow main shafts by the open die forging method. The design of a forging process for a solid main shaft and hollow shaft was prepared by an open die forging process design scheme. Finite element analyses were performed to obtain the flow stress by a hot compression test at different temperature and strain rates. The control parameters of each forging process, such as temperature and effective strain, were obtained and compared to predict the suitability of the hollow main shaft forging process. Finally, high productivity reflecting material utilization ratio, internal quality, shape, and dimension was verified by the prototypes manufactured by the proposed forging process for hollow main shafts

  16. Study on Manufacturing Process of Hollow Main Shaft by Open Die Forging

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Yong Chul [Gyeongnam Technopark, Changwon (Korea, Republic of); Kang, Jong Hun [Jungwon Univ., Goisan (Korea, Republic of); Kim, Sang Sik [Gyeongsang Natiional Univ., Jinju (Korea, Republic of)

    2016-02-15

    The main shaft is one of the key components connecting the rotor hub and gear box of a wind power generator. Typically, main shafts are manufactured by open die forging method. However, the main shaft for large MW class wind generators is designed to be hollow in order to reduce the weight. Additionally, the main shafts are manufactured by a casting process. This study aims to develop a manufacturing process for hollow main shafts by the open die forging method. The design of a forging process for a solid main shaft and hollow shaft was prepared by an open die forging process design scheme. Finite element analyses were performed to obtain the flow stress by a hot compression test at different temperature and strain rates. The control parameters of each forging process, such as temperature and effective strain, were obtained and compared to predict the suitability of the hollow main shaft forging process. Finally, high productivity reflecting material utilization ratio, internal quality, shape, and dimension was verified by the prototypes manufactured by the proposed forging process for hollow main shafts.

  17. Hot Deformation Behavior and Pulse Current Auxiliary Isothermal Forging of Hot Pressing Sintering TiAl Based Alloys.

    Science.gov (United States)

    Shi, Chengcheng; Jiang, Shaosong; Zhang, Kaifeng

    2017-12-16

    This paper focuses on the fabrication of as-forged Ti46.5Al2Cr1.8Nb-(W, B) alloy via pulse current auxiliary isothermal forging (PCIF). The starting material composed of near gamma (NG) microstructure was fabricated by adopting pre-alloyed powders via hot pressing sintering (HPS) at 1300 °C. Isothermal compression tests were conducted at a strain rate range of 0.001-0.1 s -1 and a temperature range of 1125-1275 °C to establish the constitutive model and processing map. The optimal hot deformation parameters were successfully determined (in a strain rate range of 10 -3 -2.5 × 10 -3 s -1 and temperature range of 1130-1180 °C) based on the hot processing map and microstructure observation. Accordingly, an as-forged TiAl based alloy without cracks was successfully fabricated by PCIF processing at 1175 °C with a nominal strain rate of 10 -3 s -1 . Microstructure observation indicated that complete dynamic recrystallization (DRX) and phase transformation of γ→α₂ occurred during the PCIF process. The elongation of as-forged alloy was 136%, possessing a good secondary hot workability, while the sintered alloy was only 66% when tested at 900 °C with a strain rate of 2 × 10 -4 s -1 .

  18. 30 CFR 816.150 - Roads: general.

    Science.gov (United States)

    2010-07-01

    ... altering the normal flow of water in streambeds or drainage channels; (6) Prevent or control damage to... part of any road shall be located in the channel of an intermittent or perennial stream unless... 816.57 of this chapter. (2) Roads shall be located to minimize downstream sedimentation and flooding...

  19. Optimising mechanical properties of hot forged nickel superalloy 625 components

    Science.gov (United States)

    Singo, Nthambe; Coles, John; Rosochowska, Malgorzata; Lalvani, Himanshu; Hernandez, Jose; Ion, William

    2018-05-01

    Hot forging and subsequent heat treatment were resulting in substandard mechanical properties of nickel superalloy, Alloy 625, components. The low strength was found to be due to inadequate deformation during forging, excessive grain growth and precipitation of carbides during subsequent heat treatment. Experimentation in a drop forging company and heat treatment facility led to the establishment of optimal parameters to minimise grain size and mitigate the adverse effects of carbide precipitation, leading to successful fulfilment of mechanical property specifications. This was achieved by reducing the number of operations, maximising the extent of deformation by changing the slug dimensions and its orientation in the die, and minimising the time of exposure to elevated temperatures in both the forging and subsequent heat treatment processes to avoid grain growth.

  20. Multiparticle correlations and higher order harmonics in pPb collisions at $\\sqrt{s_{_\\text{NN}}} = 8.16~\\mathrm{TeV}$

    CERN Document Server

    CMS Collaboration

    2018-01-01

    The second- and third-order azimuthal anisotropy Fourier harmonics are studied in pPb collisions at $\\sqrt{s_{_\\text{NN}}}=8.16~\\mathrm{TeV}$ over a wide range of event multiplicities. The second-order, ``elliptic'' harmonic moment is obtained through four-, six-, and eight-particle correlations and the third-order, ``triangular'' harmonic moment is studied using four-particle correlations. The data were collected by the CMS experiment during the 2016 LHC run. A sample of peripheral PbPb collisions at $\\sqrt{s_{_{\\text{NN}}}}=5.02~\\mathrm{TeV}$, covering a similar range of event multiplicities to the pPb results, is also analyzed. Theoretical predictions that assume a hydrodynamic evolution of the created medium with initial-state density fluctuations are compared to the experimental results.

  1. Study on isothermal precision forging process of rare earth intensifying magnesium alloy

    International Nuclear Information System (INIS)

    Shan, Debin; Xu, Wenchen; Han, Xiuzhu; Huang, Xiaolei

    2012-01-01

    A three dimensional rigid-plastic finite element model is established to simulate the isothermal precision forging process of the magnesium alloy bracket based on DEFORM 3D in order to analyze the material flow rule and determine the forging process scheme. Some problems such as underfilling and too large forging pressure are predicted and resolved through optimizing the shapes of the billet successfully. Compared to the initial microstructure, the isothermal-forged microstructure of the alloy refines obviously and amounts of secondary phases precipitate on the matrix during isothermal forging process. In subsequent ageing process, large quantities of secondary phases precipitate from α-Mg matrix with increasing ageing time. The optimal comprehensive mechanical properties of the alloy have been obtained after aged at 473 K, 63 h with the ultimate tensile strength, tensile yield strength and elongation 380 MPa, 243 MPa and 4.07% respectively, which shows good potential for application of isothermal forging process of rare earth intensifying magnesium alloy.

  2. Near net shape forging of titanium alloy turbine blade

    International Nuclear Information System (INIS)

    Morita, Akiyasu; Hattori, Shigeo; Tani, Kazuhito; Takemura, Atsushi; Ashida, Yoshio

    1991-01-01

    The isothermal forging process has been developed to produce turbine blades made of near β Ti-alloy Ti-10V-2Fe-3Al. It is important to set the preform at the optimum position of the die in order to get a high precision product. The deformation analysis by using FEM is effective to determine the optimum position. And also it is necessary to avoid buckling induced by the restriction of axial elongation of the material. As a result, Ti-10V-2Fe-3Al blades could be formed precisely by using only one stage of forging, and machining was needed only at the root. The thickness of the oxide layer induced on the surface of the forged blade was only 70μm. The mechanical properties of Ti-10V-2Fe-3Al blades after forging and annealing were superior to those of Ti-6Al-4V blades and were nearly uniform across the length of the blades. (author)

  3. Sensitivity analysis and optimization algorithms for 3D forging process design

    International Nuclear Information System (INIS)

    Do, T.T.; Fourment, L.; Laroussi, M.

    2004-01-01

    This paper presents several approaches for preform shape optimization in 3D forging. The process simulation is carried out using the FORGE3 registered finite element software, and the optimization problem regards the shape of initial axisymmetrical preforms. Several objective functions are considered, like the forging energy, the forging force or a surface defect criterion. Both deterministic and stochastic optimization algorithms are tested for 3D applications. The deterministic approach uses the sensitivity analysis that provides the gradient of the objective function. It is obtained by the adjoint-state method and semi-analytical differentiation. The study of stochastic approaches aims at comparing genetic algorithms and evolution strategies. Numerical results show the feasibility of such approaches, i.e. the achieving of satisfactory solutions within a limited number of 3D simulations, less than fifty. For a more industrial problem, the forging of a gear, encouraging optimization results are obtained

  4. Influence of segregations and hydrogen flakes on the mechanical properties of forged RPV steels

    International Nuclear Information System (INIS)

    Eiselt, C.C.; May, J.; Hein, H.

    2013-01-01

    In the frame of relevant 1970s/80s German research programs (e.g. FKS research program on component safety and others), many investigations on large forgings manufactured from Reactor Pressure Vessel (RPV) materials such as 20 MnMoNi 5 5 and 22 NiMoCr 3 7 have been performed. Lately, after ultrasonic testing hydrogen flakes in connection with segregation zones have been observed in a few RPV forgings. The earlier R and D programs contained a number of special heats, which covered a defined defect state (lower bound heats) with relevance to the recent observations of numerous UT indications in RPV forgings of two PWRs. Therefore, the results of these former research programs were now reviewed. The studies included an evaluation of the effects of macro/micro segregations as well as hydrogen flakes on the mechanical properties. As part of the mechanical technological experiments Charpy impact tests in different orientations (e.g. L-T, T-L and S-T) together with fracture mechanics and large scale tensile tests were carried out in segregated and non segregated material zones. In this context the letters L,T,S indicate the longitudinal, transversal and short transverse (thickness) direction with respect to rolling direction of the forging axis. The first letter indicates the direction of the principal stress, while the second letter stands for the crack propagation direction [1]. Furthermore the irradiation behavior of segregated material regions was analyzed and compared to non segregated material regions. Key results of these analyses indicate that in most cases upper shelf levels are lowered in segregated material parts compared to non segregated areas. In addition the segregations cause a larger scattering of impact energies. A high hydrogen content in combination with segregations has overall detrimental effects on the mechanical properties. However, there seems to be no specific segregation influence on the materials' irradiation reaction.

  5. High yttria ferritic ODS steels through powder forging

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Deepak [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Prakash, Ujjwal, E-mail: ujwalfmt@iitr.ac.in [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Dabhade, Vikram V. [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Laha, K.; Sakthivel, T. [Mechanical Metallurgy Group, IGCAR, Kalpakkam, Tamilnadu 603102 (India)

    2017-05-15

    Oxide dispersion strengthened (ODS) steels are being developed for future nuclear reactors. ODS Fe-18%Cr-2%W-0.2%Ti steels with 0, 0.35, 0.5, 1 and 1.5% Y{sub 2}O{sub 3} (all compositions in weight%) dispersion were fabricated by mechanical alloying of elemental powders. The powders were placed in a mild steel can and forged in a stream of hydrogen gas at 1473 K. The steels were forged again to final density. The strength of ODS steel increased with yttria content. Though this was accompanied by a decrease in tensile elongation, all the steels showed significant ductility. The ductility in high yttria alloys may be attributed to improved inter-particle bonding between milled powders due to reduction of surface oxides by hydrogen. This may permit development of ODS steels with yttria contents higher than the conventional limit of 0.5%. It is suggested that powder forging is a promising route to fabricate ODS steels with high yttria contents and improved ductility. - Highlights: •ODS steels with yttria contents beyond the conventional limit of 0.5 wt% were fabricated by powder forging in a hydrogen atmosphere. •All the alloys exhibited significant ductility. •This may be attributed to improved inter-particle bonding due to reduction of surface oxides by hydrogen. •Strength in excess of 300 MPa was obtained at 973 K for 0.5%, 1% and 1.5% yttria ODS alloys. •Powder forging is a promising route to fabricate ODS steels and permits development of compositions with up to 1.5% yttria.

  6. Close toleranoe forging of chromium steel blades for powerful steam turbines

    International Nuclear Information System (INIS)

    Shastin, Eh.G.; Kositskij, Yu.N.; Lyubchits, G.A.

    1989-01-01

    Work on simulating technological process on die-forging hammer was performed in order to reduce the preparation period bringing technology of close tolerance forging of turbine blades to a commercial level. A special attention was paid to development of accurate forming of forgings of 20Kh13Sh, 12Kh13 and 15Kh11MFSh steels on screw presses with nominal effort equal to 80 and 144 MN

  7. The production of grain oriented lanthanum titanate (La2Ti2O7) ceramics by uniaxial hot-forging process for improved fracture toughness

    International Nuclear Information System (INIS)

    Ceylan, Ali

    2008-01-01

    The layered-structural ceramics, such as lanthanum titanate (La 2 Ti 2 O 7 ), have been known for their good electrical and optical properties at high frequencies and temperatures. However, few studies have been conducted on the mechanical properties of these ceramics. The interest in ceramic hot-forging (HF) has been greatly increased recently due to the enhancement in fracture toughness via bridging effect of oriented grains. In this study, grain oriented lanthanum titanate was produced by the hot-forging process. The characterizations of the samples were achieved by density measurement, scanning electron microscopy (SEM), optical microscopy, X-ray diffraction (XRD), Vickers indentation and three-point bending test. According to X-ray diffraction patterns, the orientation factor (f) was found to be 0.73 for certain hot-forging conditions resulting an improved fracture toughness. The improved fracture toughness of La 2 Ti 2 O 7 (3.2 MPa m 1/2 ) reached to the value of monolithic alumina (Al 2 O 3 ) between 3 and 4 MPa m 1/2

  8. What history reveals about Forge River pollution on Long Island, New York's south shore.

    Science.gov (United States)

    Swanson, R Lawrence; Brownawell, B; Wilson, Robert E; O'Connell, Christine

    2010-06-01

    Fifty years ago, the Forge River and Moriches Bay, of Long Island's south shore lagoonal system, achieved notoriety when their polluted conditions were alluded to in a report of the US President's Science Advisory Committee (1965). The Woods Hole Oceanographic Institution investigated the bay throughout the 1950s, identifying duck farming as the cause of "objectionable", "highly contaminated" conditions of these waters. Much has changed: duck farming declined; the river was dredged to remove polluted sediments, improve navigation; and barrier island inlets stabilized. Yet, the river remains seasonally eutrophic. Why? This paper reviews what occurred in the Forge River watershed. While governments aggressively curtailed the impacts of duck pollution, they failed to manage development and sewage pollution. The Forge experience indicates that watershed management is a continuing governmental responsibility as development accelerates. Otherwise, we will always be looking for that instantaneous remediation that is usually not affordable and is socially contentious.

  9. Numerical simulation and experimental verification of microstructure evolution in large forged pipe used for AP1000 nuclear power plants

    International Nuclear Information System (INIS)

    Wang, Shenglong; Yang, Bin; Zhang, Mingxian; Wu, Huanchun; Peng, Jintao; Gao, Yang

    2016-01-01

    Highlights: • Establish systematically the database of 316LN stainless steel for Deform-3D. • Simulate the microstructure evolution during forging of AP1000 primary coolant pipe. • Carry out full-scale forging experiment for verification in engineering practice. • Get desirable grain size in simulation and experiment. • The variation trends of grain sizes in simulation and experiment are consistent. - Abstract: AP1000 primary coolant pipe is a large special-shaped forged pipe made of 316LN stainless steel. Due to the non-uniform temperature and deformation during its forging, coarse and fine grains usually coexist in the forged pipe, resulting in the heterogeneous microstructure and anisotropic performance. To investigate the microstructure evolution during the entire forging process, in the present research, the database of the 316LN stainless steel was established and a numerical simulation was performed. The results indicate that the middle body section of the forged pipe has an extremely uniform average grain size with the value smaller than 30 μm. The grain sizes in the ends of body sections were ranged from 30 μm to 60 μm. Boss sections have relatively homogeneous microstructure with the average grain size 30 μm to 44 μm. Furthermore, a full-scale hot forging was carried out for verification. Comparison of theoretical and experimental results showed good agreement and hence demonstrated the capabilities of the numerical simulation presented here. It is noteworthy that all grains in the workpiece were confirmed less than 180 μm, which meets the designer’s demands.

  10. Anisotropy effects during dwell-fatigue caused by δ-phase orientation in forged Inconel 718

    Energy Technology Data Exchange (ETDEWEB)

    Saarimäki, Jonas, E-mail: jonas.saarimaki@liu.se [Division of Engineering Materials, Department of Management and Engineering, Linköping University, SE-58183 Linköping (Sweden); Colliander, Magnus Hörnqvist [Department of Applied Physics, Chalmers University of Technology, SE-41296 Göteborg (Sweden); GKN Aerospace Engine Systems, R& T Centre, SE-46181 Trollhättan (Sweden); Moverare, Johan J. [Division of Engineering Materials, Department of Management and Engineering, Linköping University, SE-58183 Linköping (Sweden)

    2017-04-24

    Inconel 718 is a commonly used superalloy for turbine discs in the gas turbine industry. Turbine discs are often subjected to dwell-fatigue as a result of long constant load cycles. The effect of anisotropy on dwell-fatigue cracking in forged turbine discs have not yet been thoroughly investigated. Crack propagation behaviour was characterised using compact tension (CT) samples cut in different orientations from a real turbine disc forging. Samples were also cut in two different thicknesses in order to investigate the influence of plane strain and plane stress condition on the crack propagation rates. The samples were subjected to dwell-fatigue tests at 550 °C with 90 s or 2160 s dwell-times at maximum load. Microstructure characterisation was done using scanning electron microscopy (SEM) techniques such as electron channelling contrast imaging (ECCI), electron backscatter diffraction (EBSD), and light optical microscopy (LOM). The forged alloy exhibits strong anisotropic behaviour caused by the non-random δ-phase orientation. When δ-phases were oriented perpendicular compared to parallel to the loading direction, the crack growth rates were approximately ten times faster. Crack growth occurred preferably in the interface between the γ-matrix and the δ-phase.

  11. Integral forged pump casing for the primary coolant circuit of a nuclear reactor: Development in design, forging technology, and material

    International Nuclear Information System (INIS)

    Austel, W.; Korbe, H.

    1986-01-01

    Developments in the forging of large casings for primary circuit coolant pumps for light water reactors in Germany are demonstrated beginning with the multiple forging fabricated version and ending with the integral forged type. This version is the result of the joint efforts of the pump manufacturer and the forgemaster after a cost-gain evaluation and represents an optimum solution in view of its functional and economical performance and also considering the high requirements for mechanical-technological properties, including homogeneity of the material. The development from 22 NiMoCr 3 7/A 508 Class 2 to 20 MnMoNi 5 5/A 508 Class 3 and their optimization will be demonstrated. This development is based mainly on minimizing the sulfur content and on vacuum carbon deoxidation (VCD), which results in a reduction of the A-segregations, in improving fracture toughness and isotropy, and in the desired fine-grain structure

  12. Application of CAD/CAE/CAM in forging process: a review

    International Nuclear Information System (INIS)

    Ahmad Baharuddin Abdullah; Hamouda, A.M.S.

    2005-01-01

    Forging can be described as the process in which metal is plastically deformed with application of huge pressure. The process not only changes the shape but also improves the properties of the forged parts due to grain size refinement. Conventionally, the empirical trial and error method has been applied, but recently there are various tools are employed to improved product quality and economic of the process. For example, Computer Aided Design (CAD) is widely used in modeling of the process, while Computer Aided Engineering (CAE) tools have been utilized in analyzing the process. To physically demonstrate the process, Computer Aided Manufacturing (CAM) such as CNC machine has been exploited. In order to improve forging process efficiency, an integrated system that combines all advantages of CAD, CAM and CAE need to be developed. This paper presents an overview of computer aided simulation such as CAD, CAE and CAM application in forging process. (Author)

  13. Examples on cold forged aluminium components in automotive industry

    DEFF Research Database (Denmark)

    Bay, Niels; Kolsgaard, A.

    2000-01-01

    The present paper describes the possibilites of applying cold forging for manufacturing of light weight components in aluminium. A short description of the basic cold forming processes forms the basis for describing the great variety in design of cold forged components. Examples are mainly taken ...... from automotive industry but in a few cases also from other industrial sectors to show the possibilities....

  14. Calculation of recovery plasticity in multistage hot forging under isothermal conditions.

    Science.gov (United States)

    Zhbankov, Iaroslav G; Perig, Alexander V; Aliieva, Leila I

    2016-01-01

    A widely used method for hot forming steels and alloys, especially heavy forging, is the process of multistage forging with pauses between stages. The well-known effect which accompanies multistage hot forging is metal plasticity recovery in comparison with monotonic deformation. A method which takes into consideration the recovery of plasticity in pauses between hot deformations of a billet under isothermal conditions is proposed. This method allows the prediction of billet forming limits as a function of deformation during the forging stage and the duration of the pause between the stages. This method takes into account the duration of pauses between deformations and the magnitude of subdivided deformations. A hot isothermal upsetting process with pauses was calculated by the proposed method. Results of the calculations have been confirmed with experimental data.

  15. Material Behavior Based Hybrid Process for Sheet Draw-Forging Thin Walled Magnesium Alloys

    International Nuclear Information System (INIS)

    Sheng, Z.Q.; Shivpuri, R.

    2005-01-01

    Magnesium alloys are conventionally formed at the elevated temperatures. The thermally improved formability is sensitive to the temperature and strain rate. Due to limitations in forming speeds, tooling strength and narrow processing windows, complex thin walled parts cannot be made by traditional warm drawing or hot forging processes. A hybrid process, which is based on the deformation mechanism of magnesium alloys at the elevated temperature, is proposed that combines warm drawing and hot forging modes to produce an aggressive geometry at acceptable forming speed. The process parameters, such as temperatures, forming speeds etc. are determined by the FEM modeling and simulation. Sensitivity analysis under the constraint of forming limits of Mg alloy sheet material and strength of tooling material is carried out. The proposed approach is demonstrated on a conical geometry with thin walls and with bottom features. Results show that designed geometry can be formed in about 8 seconds, this cannot be formed by conventional forging while around 1000s is required for warm drawing. This process is being further investigated through controlled experiments

  16. Effect of Cold Forging on Microstructure and MechanicalProperties of Al/SiC Composites

    Science.gov (United States)

    Hanamantraygouda, M. B.; Shivakumar, B. P., Dr; Siddappa, P. N.; Sampathkumar, L.; Prashanth, L.

    2018-02-01

    The objective of this work was to investigate the effect of cold forging on mechanical properties and microstructural study of Al MMCs, at different wt% of SiC and forging cycle. The Al-SiC composite material was fabricated by stir casting method at different weight percentage of SiC such as 2.5, 5, 7.5 and 10%. Further, the deformation characteristics during open-die forging of Al-SiC composite at cold conditions was investigated. Cast and forged composite material was subjected to hardness test, tensile test and impact test. The grain size, microstructure behaviour was investigated using optical microscope. The results show that hardness and strength of Al-SiC composite increases and ductility decreases as compared to Al alloy in both as-cast and forged conditions. Optical microscope images showed that the distribution of SiC in Al matrix was more homogeneous in a forged composite as compared to cast one and reduction of porosity was found. Further, it showed that due to forging cycle the grain size was reduced by 30% to 35% from initial size.

  17. Finite element simulations and experimental investigations on ductile fracture in cold forging of aluminum alloy

    Science.gov (United States)

    Amiri, Amir; Nikpour, Amin; Saraeian, Payam

    2018-05-01

    Forging is one of the manufacturing processes of aluminium parts which has two major categories: called hot and cold forging. In the cold forging, the dimensional and geometrical accuracy of final part is high. However, fracture may occur in some aluminium alloys during the process because of less workability. Fracture in cold forging can be in the form of ductile, brittle or combination of both depending on the alloy type. There are several criteria for predicting fracture in cold forging. In this study, cold forging process of 6063 aluminium alloy for three different parts is simulated in order to predict fracture. The results of numerical simulations of Freudenthal criterion is in conformity with experimental tests.

  18. Influence of performance improvement of AP1000 nuclear island main equipment forging on manufacturing

    International Nuclear Information System (INIS)

    Liu Zhiying

    2013-01-01

    In order to comply with the 60-year design life of an AP1000 nuclear power station, higher strength and ductility requirements have been made on AP1000 nuclear island SG forgings than on CPR1000 nuclear island main equipment. In addition, bigger size of AP1000 nuclear island SG forgings increases the difficulty of manufacturing them. Insufficient recognition of these changes may cause unstable quality of forgings and possible quality problems in follow-up welding procedure. On the basis of comparison and analysis of AP1000 nuclear island SG forgings and CPR1000 nuclear island forgings, this thesis suggests clear directions for the actions we need to take. (author)

  19. 30 CFR 816.131 - Cessation of operations: Temporary.

    Science.gov (United States)

    2010-07-01

    ..., revegetation, environmental monitoring, and water treatment activities that will continue during the temporary... Section 816.131 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PERMANENT PROGRAM PERFORMANCE STANDARDS PERMANENT PROGRAM PERFORMANCE STANDARDS-SURFACE MINING...

  20. Simulation and analysis of hot forging process for industrial locking gear elevators

    Science.gov (United States)

    Maarefdoust, M.; Kadkhodayan, M.

    2010-06-01

    In this paper hot forging process for industrial locking gear elevators is simulated and analyzed. An increase in demand of industrial locking gear elevators with better quality and lower price caused the machining process to be replaced by hot forging process. Production of industrial locking gear elevators by means of hot forging process is affected by many parameters such as billet temperature, geometry of die and geometry of pre-formatted billet. In this study the influences of billet temperature on effective plastic strain, radius of die corners on internal stress of billet and thickness of flash on required force of press are investigated by means of computer simulation. Three-dimensional modeling of initial material and die are performed by Solid Edge, while simulation and analysis of forging are performed by Super Forge. Based on the computer simulation the required dies are designed and the workpieces are formed. Comparison of simulation results with experimental data demonstrates great compatibility.

  1. Research into Oil-based Colloidal-Graphite Lubricants for Forging of Al-based Alloys

    International Nuclear Information System (INIS)

    Petrov, A.; Petrov, P.; Petrov, M.

    2011-01-01

    The presented paper describes the topical problem in metal forging production. It deals with the choice of an optimal lubricant for forging of Al-based alloys. Within the scope of the paper, the properties of several oil-based colloidal-graphite lubricants were investigated. The physicochemical and technological properties of these lubricants are presented. It was found that physicochemical properties of lubricant compositions have an influence on friction coefficient value and quality of forgings.The ring compression method was used to estimate the friction coefficient value. Hydraulic press was used for the test. The comparative analysis of the investigated lubricants was carried out. The forging quality was estimated on the basis of production test. The practical recommendations were given to choose an optimal oil-based colloidal-graphite lubricant for isothermal forging of Al-based alloy.

  2. Study on the microstructure of the different parts for new aluminum alloy forgings

    International Nuclear Information System (INIS)

    Gao Wei; Zheng Xiaojing; Wu Fu

    2014-01-01

    The mechanical properties of former aluminium alloy forgings cannot achieve technique demand. Because the component, dimension and preparation technology of new aluminum alloy have changed, the microstructure and mechanical properties of forgings are researched. It is concluded that the flowline of forgings has good continuity and uniformity, it does not have a prominent difference on microhardness of different parts. The results prove that the microstructure of forgings has good consistency. The matrix structure of forgings consists of fiber texture and equiaxed structure. The residual second phases, which are harmful to mechanical properties, are observed in the equiaxed structure. The center of equiaxed structure core zone, the edge of equiaxed structure transition zone and equiaxed structure edge zone should be focus on observing test, they are the sampling location of tensile property. (authors)

  3. 75 FR 70689 - Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum-Greenwood Forge Division; Currently...

    Science.gov (United States)

    2010-11-18

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-70,376] Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum- Greenwood Forge Division; Currently Known As Contech Forgings, LLC..., applicable to workers of Kaiser Aluminum Fabricated Products, LLC, Kaiser Aluminum-Greenwood Forge Division...

  4. Prompt and nonprompt J/ψ production and nuclear modification in pPb collisions at sNN=8.16 TeV

    Directory of Open Access Journals (Sweden)

    R. Aaij

    2017-11-01

    Full Text Available The production of J/ψ mesons is studied in proton-lead collisions at the centre-of-mass energy per nucleon pair sNN=8.16 TeV with the LHCb detector at the LHC. The double differential cross-sections of prompt and nonprompt J/ψ production are measured as a function of the J/ψ transverse momentum and rapidity in the nucleon–nucleon centre-of-mass frame. Forward-to-backward ratios and nuclear modification factors are determined. The results are compared with theoretical calculations based on collinear factorisation using nuclear parton distribution functions, on the colour glass condensate or on coherent energy loss models.

  5. Numerical modelling of damage evolution in ingot forging

    DEFF Research Database (Denmark)

    Christiansen, Peter; Martins, Paulo A.F.; Bay, Niels Oluf

    2015-01-01

    The ingot forging process is numerically simulated applying both the Shima-Oyane porous plasticity model as a coupled damage model and the uncoupled normalized Cockcroft & Latham criterion. Four different cases including two different lower die angles (120º and 180º) and two different sizes of feed...... (400mm and 800mm) are analysed. Comparison of the simulation results with recommendations in literature on ingot forging, indicates the normalized Cockcroft & Latham damage criterion to be the most realistic of the two....

  6. Manufacturing and material properties of ultralarge size forgings for advanced BWRPV

    International Nuclear Information System (INIS)

    Suzuki, Komei; Sato, Ikuo; Tsukada, Hisashi

    1994-01-01

    Ultralarge size forgings for the advanced boiling water reactor (ABWR) pressure vessel as represented by the bottom petal made from a 600ton ingot have been developed. The bottom petal is a larger wall thickness ring with 10 integrated nozzles inside and outside the ring. The outer diameter is 7.8m, the height is 1.8m and the wall thickness if 1.1m in the as-forged condition. A very high purity level of P≤qslant0.003% and S≤qslant0.003% can be obtained by the application of double-refining processes to all the molten steel. The forging shows a homogeneous chemical distribution, sound internal qualities and adequate impact properties.This paper summarizes the manufacturing technique and material properties of large size forgings such as the bottom petal, the shell with integrated skirt and the bottom dome. ((orig.))

  7. Investigation of the influence of hybrid layers on the life time of hot forging dies

    Directory of Open Access Journals (Sweden)

    S. Legutko

    2013-04-01

    Full Text Available The paper deals with the issues related in the process of drop forging with special attention paid to the durability of forging tools. It presents the results of industrial investigation of the influence of hybrid layers on hot forging dies. The effectiveness of hybrid layers type nitrided layer/PVD coating applied for extending the life of forging tools whose working surfaces are exposed to such complex exploitation conditions as, among others, cyclically varying high thermal and mechanical loads, as well as intensive abrasion at raised temperature. The examination has been performed on a set of forging tools made of Unimax steel and intended for forging steel rings of gear box synchronizer in the factory FAS in Swarzedz (Poland.

  8. Analysis of Filling and Stresses in the Hot Forging Process Depending on Flange Die Shapes

    International Nuclear Information System (INIS)

    Kim, Jun Hyoung; Kim, Cheol

    2010-01-01

    Hot closed-forging process and the die used for forming an automotive flange were analyzed from the viewpoints of heat transfer, grain-flow lines, and stresses to obtain a forged product without defects such as surface cracks, laps, cold shots, and partial filling. The forging process including up-set, pre-forging, final forging and pressing forces was investigated using finite element analysis. The influence of the preform die and the ratio of the heights of the upper die to lower die on the forging process and die were investigated and a die shape (10 .deg. for the preform die, and 1.5:1 ratio for the final die) suitable to achieve successful forging was determined on the basis of a parametric study. All parametric design requirements such as strength, full filling, and a load limit of 13,000 KN were satisfied for this newly developed flange die. New dies and flanges were fabricated and investigated. Defects such as partial filling and surface cracks were not observed

  9. Manufacturing of ultra-large diameter 20 MnMoNi 5 5 steel forgings for reactor pressure vessels and their properties

    International Nuclear Information System (INIS)

    Onodera, S.; Kawaguchi, S.; Tsukada, H.; Moritani, H.; Suzuki, K.; Sato, I.

    1985-01-01

    As the structural material for RPV typical of increased dimensions, as set of ultra-large diameter steel forgings for a PHWR RPV is presented as outlined below. (1) Material designation: 20 MnMoNi 5 5 (similar to SA508, Cl.3) (2) Size of the forgings: flanges, 8.440 mm OD, a weight of 238 tons for shell flange; shells and torus, 7,920 mm OD, with large height, cover dome, 6,800 mm OD in chord and 460 mm thick; blank before formed to dome is ca. 8,000 mm OD. (3) Chemical composition: particular effort was made for minimizing the tramp elements as P, S, As, Sn, Sb, Cu. (4) Manufacturing, key points: steel making - combined refining and degassing in ladle; ingot making - largest size ingots, including 570 ton and 500 ton ingots; forging - special ''outside-the-press'' forging and forming techniques; heat treatment - prevention of H 2 flaking in normalizing and tempering and handling of the extra-large forgings at water quenching. (5) Metallurgical properties: sufficiently uniform carbon distributions in the forgings; a lowest possible content of hydrogen, non-metallic inclusions and oxygen. Mechanical properties: uniformity in tensile and toughness properties; flaws - only limited number of spots of UT indications under 2 mm EFG (EFS). (orig.)

  10. Physical modeling and numerical simulation of V-die forging ingot with central void

    DEFF Research Database (Denmark)

    Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

    2014-01-01

    Numerical simulation and physical modeling performed on small-scale ingots made from pure lead, having a hole drilled through their centerline to mimic porosity, are utilized to characterize the deformation mechanics of a single open die forging compression stage and to identify the influence...... of the lower V-die angle on porosity closure and forging load requirements of large cast ingots. Results show that a lower V-die angle of 120 provides the best closure of centerline porosity without demanding the highest forging loads or developing unreasonably asymmetric shapes that may create difficulties...... in multi-stage open die forging procedures....

  11. High yttria ferritic ODS steels through powder forging

    Science.gov (United States)

    Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

    2017-05-01

    Oxide dispersion strengthened (ODS) steels are being developed for future nuclear reactors. ODS Fe-18%Cr-2%W-0.2%Ti steels with 0, 0.35, 0.5, 1 and 1.5% Y2O3 (all compositions in weight%) dispersion were fabricated by mechanical alloying of elemental powders. The powders were placed in a mild steel can and forged in a stream of hydrogen gas at 1473 K. The steels were forged again to final density. The strength of ODS steel increased with yttria content. Though this was accompanied by a decrease in tensile elongation, all the steels showed significant ductility. The ductility in high yttria alloys may be attributed to improved inter-particle bonding between milled powders due to reduction of surface oxides by hydrogen. This may permit development of ODS steels with yttria contents higher than the conventional limit of 0.5%. It is suggested that powder forging is a promising route to fabricate ODS steels with high yttria contents and improved ductility.

  12. 76 FR 66996 - Agency Information Collection Activities; Submission for OMB Review; Comment Request; Forging...

    Science.gov (United States)

    2011-10-28

    ... for OMB Review; Comment Request; Forging Machines ACTION: Notice. SUMMARY: The Department of Labor... collection request (ICR) titled, ``Forging Machines,'' to the Office of Management and Budget (OMB) for....218, it is mandatory for covered employers to conduct and to document periodic inspections of forging...

  13. 30 CFR 816.47 - Hydrologic balance: Discharge structures.

    Science.gov (United States)

    2010-07-01

    ...-SURFACE MINING ACTIVITIES § 816.47 Hydrologic balance: Discharge structures. Discharge from sedimentation... shall be controlled, by energy dissipators, riprap channels, and other devices, where necessary, to reduce erosion, to prevent deepening or enlargement of stream channels, and to minimize disturbance of...

  14. Design and Analysis of a Forging Die for Manufacturing of Multiple Connecting Rods

    Science.gov (United States)

    Megharaj, C. E.; Nagaraj, P. M.; Jeelan Pasha, K.

    2016-09-01

    This paper demonstrates to utilize the hammer capacity by modifying the die design such that forging hammer can manufacture more than one connecting rod in a given forging cycle time. To modify the die design study is carried out to understand the parameters that are required for forging die design. By considering these parameters, forging die is designed using design modelling tool solid edge. This new design now can produce two connecting rods in same capacity hammer. The new design is required to validate by verifying complete filing of metal in die cavities without any defects in it. To verify this, analysis tool DEFORM 3D is used in this project. Before start of validation process it is require to convert 3D generated models in to. STL file format to import the models into the analysis tool DEFORM 3D. After importing these designs they are analysed for material flow into the cavities and energy required to produce two connecting rods in new forging die design. It is found that the forging die design is proper without any defects and also energy graph shows that the forging energy required to produce two connecting rods is within the limit of that hammer capacity. Implementation of this project increases the production of connecting rods by 200% in less than previous cycle time.

  15. Development and efficiency assessment of process lubrication for hot forging

    Science.gov (United States)

    Kargin, S.; Artyukh, Viktor; Ignatovich, I.; Dikareva, Varvara

    2017-10-01

    The article considers innovative technologies in testing and production of process lubricants for hot bulk forging. There were developed new compositions of eco-friendly water-graphite process lubricants for hot extrusion and forging. New approaches to efficiency assessment of process lubricants are developed and described in the following article. Laboratory and field results are presented.

  16. Development of strategies for saving energy by temperature reduction in warm forging processes

    Science.gov (United States)

    Varela, Sonia; Santos, Maite; Vadillo, Leire; Idoyaga, Zuriñe; Valbuena, Óscar

    2016-10-01

    This paper is associated to the European policy of increasing efficiency in raw material and energy usage. This policy becomes even more important in sectors consuming high amount of resources, like hot forging industry, where material costs sums up to 50% of component price and energy ones are continuously raising. The warm forging shows a clear potential of raw material reduction (near-net-shape components) and also of energy saving (forging temperature under 1000°C). However and due to the increment of the energy costs, new solutions are required by the forging sector in order to reduce the temperature below 900°C. The reported research is based on several approaches to reduce the forging temperature applied to a flanged shaft of the automotive sector as demonstration case. The developed investigations have included several aspects: raw material, process parameters, tools and dies behavior during forging process and also metallographic evaluation of the forged parts. This paper summarizes analysis of the ductility and the admissible forces of the flanged shaft material Ck45 in as-supplied state (as-rolled) and also in two additional heat treated states. Hot compression and tensile tests using a GLEEBLE 3800C Thermo mechanical simulator have been performed pursuing this target. In the same way, a coupled numerical model based on Finite Element Method (FEM) has been developed to predict the material flow, the forging loads and the stresses on the tools at lower temperature with the new heat treatments of the raw material. In order to validate the previous development, experimental trials at 850 °C and 750 °C were carried out in a mechanical press and the results were very promising.

  17. Effect of precipitates on microstructures and properties of forged Mg-10Gd-2Y-0.5Zn-0.3Zr alloy during ageing process

    International Nuclear Information System (INIS)

    Han, X.Z.; Xu, W.C.; Shan, D.B.

    2011-01-01

    Highlights: · The effect of forging process on microstructure evolution and mechanical properties of Magnesium alloy with rare earth was investigated. · The optimal mechanical properties of the alloy with high strength and enough elongation were obtained after forging and ageing process. · The strength improvement of the alloy after forging and ageing process mainly results from the precipitation of 14H-type LPSO phase. · Strengthening mechanism of the alloy is controlled by the precipitation of β' and 14H-type LPSO phases which can inhibit sliding of dislocations and growth of grain boundaries. - Abstract: The precipitate behavior during forging and ageing process of Mg-10Gd-2Y-0.5Zn-0.3Zr alloy has been investigated by X-ray diffraction, scanning electron microscopy and transmission electron microscopy. The mechanical properties of the alloy after forging and ageing process have been evaluated using Vickers hardness and room-temperature tensile tests. The results show that precipitation of 14H-type long period stacking order (LPSO) phase is the main strengthening phase in the as-forged alloy. The LPSO phase and refinement of grains contribute to the strength improvement of the alloy after forging process. The optimal mechanical properties of the alloy are obtained when it is aged at 200 deg. C for 60 h, which mainly owes to the precipitation of large amounts of β' and 14H-type LPSO phases on the α-Mg matrix. The growth of secondary phases, widening of soft precipitate free zones and coarsening of grains during subsequent ageing process at higher temperature lead to the decrease of mechanical properties of the alloy.

  18. Analysis of the thermo-mechanical deformations in a hot forging tool by numerical simulation

    International Nuclear Information System (INIS)

    L-Cancelos, R.; Varas, F.; Viéitez, I.; Martín, E.

    2016-01-01

    Although programs have been developed for the design of tools for hot forging, its design is still largely based on the experience of the tool maker. This obliges to build some test matrices and correct their errors to minimize distortions in the forged piece. This phase prior to mass production consumes time and material resources, which makes the final product more expensive. The forging tools are usually constituted by various parts made of different grades of steel, which in turn have different mechanical properties and therefore suffer different degrees of strain. Furthermore, the tools used in the hot forging are exposed to a thermal field that also induces strain or stress based on the degree of confinement of the piece. Therefore, the mechanical behaviour of the assembly is determined by the contact between the different pieces. The numerical simulation allows to analyse different configurations and anticipate possible defects before tool making, thus, reducing the costs of this preliminary phase. In order to improve the dimensional quality of the manufactured parts, the work presented here focuses on the application of a numerical model to a hot forging manufacturing process in order to predict the areas of the forging die subjected to large deformations. The thermo-mechanical model developed and implemented with free software (Code-Aster) includes the strains of thermal origin, strains during forge impact and contact effects. The numerical results are validated with experimental measurements in a tooling set that produces forged crankshafts for the automotive industry. The numerical results show good agreement with the experimental tests. Thereby, a very useful tool for the design of tooling sets for hot forging is achieved. (paper)

  19. Analysis of the thermo-mechanical deformations in a hot forging tool by numerical simulation

    Science.gov (United States)

    L-Cancelos, R.; Varas, F.; Martín, E.; Viéitez, I.

    2016-03-01

    Although programs have been developed for the design of tools for hot forging, its design is still largely based on the experience of the tool maker. This obliges to build some test matrices and correct their errors to minimize distortions in the forged piece. This phase prior to mass production consumes time and material resources, which makes the final product more expensive. The forging tools are usually constituted by various parts made of different grades of steel, which in turn have different mechanical properties and therefore suffer different degrees of strain. Furthermore, the tools used in the hot forging are exposed to a thermal field that also induces strain or stress based on the degree of confinement of the piece. Therefore, the mechanical behaviour of the assembly is determined by the contact between the different pieces. The numerical simulation allows to analyse different configurations and anticipate possible defects before tool making, thus, reducing the costs of this preliminary phase. In order to improve the dimensional quality of the manufactured parts, the work presented here focuses on the application of a numerical model to a hot forging manufacturing process in order to predict the areas of the forging die subjected to large deformations. The thermo-mechanical model developed and implemented with free software (Code-Aster) includes the strains of thermal origin, strains during forge impact and contact effects. The numerical results are validated with experimental measurements in a tooling set that produces forged crankshafts for the automotive industry. The numerical results show good agreement with the experimental tests. Thereby, a very useful tool for the design of tooling sets for hot forging is achieved.

  20. Controlled austempering of hammer forgings aimed at pseudo normalized microstructure directly after deformation

    Directory of Open Access Journals (Sweden)

    P. Skubisz

    2017-01-01

    Full Text Available The study concerns cost-effective realization of controlled thermomechanical processing (CTMP of medium-carbon and HSLA steel aimed at producing microstructure and properties equivalent to normalized condition directly after forging. The results of theoretical and physical modeling of hot forging with subsequent heat treating adopted for industrial realization in continuous manner were verified in semi-industrial conditions of a forge plant.

  1. Research on Energy-Saving Production Scheduling Based on a Clustering Algorithm for a Forging Enterprise

    Directory of Open Access Journals (Sweden)

    Yifei Tong

    2016-02-01

    Full Text Available Energy efficiency is a buzzword of the 21st century. With the ever growing need for energy efficient and low-carbon production, it is a big challenge for high energy-consumption enterprises to reduce their energy consumption. To this aim, a forging enterprise, DVR (the abbreviation of a forging enterprise, is researched. Firstly, an investigation into the production processes of DVR is given as well as an analysis of forging production. Then, the energy-saving forging scheduling is decomposed into two sub-problems. One is for cutting and machining scheduling, which is similar to traditional machining scheduling. The other one is for forging and heat treatment scheduling. Thirdly, former forging production scheduling is presented and solved based on an improved genetic algorithm. Fourthly, the latter is discussed in detail, followed by proposed dynamic clustering and stacking combination optimization. The proposed stacking optimization requires making the gross weight of forgings as close to the maximum batch capacity as possible. The above research can help reduce the heating times, and increase furnace utilization with high energy efficiency and low carbon emissions.

  2. The Marine Guanidine Alkaloid Crambescidin 816 Induces Calcium Influx and Cytotoxicity in Primary Cultures of Cortical Neurons through Glutamate Receptors.

    Science.gov (United States)

    Mendez, Aida G; Juncal, Andrea Boente; Silva, Siguara B L; Thomas, Olivier P; Martín Vázquez, Víctor; Alfonso, Amparo; Vieytes, Mercedes R; Vale, Carmen; Botana, Luís M

    2017-07-19

    Crambescidin 816 is a guanidine alkaloid produced by the sponge Crambe crambe with known antitumoral activity. While the information describing the effects of this alkaloid in central neurons is scarce, Cramb816 is known to block voltage dependent calcium channels being selective for L-type channels. Moreover, Cramb816 reduced neuronal viability through an unknown mechanism. Here, we aimed to describe the toxic activity of Cramb816 in cortical neurons. Since calcium influx is considered the main mechanism responsible for neuronal cell death, the effects of Cramb816 in the cytosolic calcium concentration of cortical neurons were studied. The alkaloid decreased neuronal viability and induced a dose-dependent increase in cytosolic calcium that was also related to the presence of calcium in the extracellular media. The increase in calcium influx was age dependent, being higher in younger neurons. Moreover, this effect was prevented by glutamate receptor antagonists, which did not fully block the cytotoxic effect of Cramb816 after 24 h of treatment but completely prevented Cramb816 cytotoxicity after 10 min exposure. Therefore, the findings presented herein provide new insights into the cytotoxic effect of Cramb816 in cortical neurons.

  3. 46 CFR 176.816 - Miscellaneous systems and equipment.

    Science.gov (United States)

    2010-10-01

    ... 100 GROSS TONS) INSPECTION AND CERTIFICATION Material Inspections § 176.816 Miscellaneous systems and equipment. At each initial and subsequent inspection for certification the owner or managing operator shall be prepared to test and make available for inspection all items in the ship's outfit, such as ground...

  4. Improvement of mechanical properties of zirconia-toughened alumina by sinter forging

    NARCIS (Netherlands)

    He, Y.; Winnubst, Aloysius J.A.; Verweij, H.; Burggraaf, Anthonie; Burggraaf, A.J.

    1994-01-01

    ZTA powder with a composition of 85 wt% alumina/15 wt% zirconia was prepared by a gel precipitation method. Sinter forging was performed with this powder to enhance the mechanical properties of ZTA materials. The influence of processing flaws on mechanical properties of sinter forged materials and

  5. Precipitation-hardening stainless steel bars, shapes, and forgings (ASME SA-564 with additional requirements)

    International Nuclear Information System (INIS)

    1975-05-01

    A standard prescribing requirements for precipitation-hardening stainless steel bars, shapes, and forgings (ASME SA-564 with additional requirements) for nuclear and associated applications is presented. This standard supersedes RDT M 7-6T, dated January 1974. (U.S.)

  6. Comparative Thermal Aging Effects on PM-HIP and Forged Inconel 690

    Science.gov (United States)

    Bullens, Alexander L.; Bautista, Esteban; Jaye, Elizabeth H.; Vas, Nathaniel L.; Cain, Nathan B.; Mao, Keyou; Gandy, David W.; Wharry, Janelle P.

    2018-03-01

    This study compares thermal aging effects in Inconel 690 (IN690) produced by forging and powder metallurgy with hot isostatic pressing (PM-HIP). Isothermal aging is carried out over 400-800°C for up to 1000 h and then metallography and nanoindentation are utilized to relate grain microstructure with hardness and yield strength. The PM-HIP IN690 maintains a constant grain size through all aging conditions, while the forged IN690 exhibits limited grain growth at the highest aging temperature and longest aging time. The PM-HIP IN690 exhibits comparable mechanical integrity as the forged material throughout aging: hardness and yield strength are unchanged with 100 h aging, but increase after 1000 h aging at all temperatures. In both the PM-HIP and forged IN690, the Hall-Petch relationship for Ni-based superalloys predicts yield strength for 0-100 h aged specimens, but underestimates yield strength in the 1000 h aged specimens because of thermally induced precipitation.

  7. Geologic setting of the proposed Fallon FORGE Site, Nevada: Suitability for EGS research and development

    Science.gov (United States)

    Faulds, James E.; Blankenship, Douglas; Hinz, Nicholas H.; Sabin, Andrew; Nordquist, Josh; Hickman, Stephen H.; Glen, Jonathan; Kennedy, Mack; Siler, Drew; Robinson-Tait, Ann; Williams, Colin F.; Drakos, Peter; Calvin, Wendy M.

    2015-01-01

    The proposed Fallon FORGE site lies within and adjacent to the Naval Air Station Fallon (NASF) directly southeast of the town of Fallon, Nevada, within the large basin of the Carson Sink in west-central Nevada. The site is located on two parcels that include land owned by the NASF and leased and owned by Ormat Nevada, Inc. The Carson Sink in the vicinity of the Fallon site is covered by Quaternary deposits, including alluvial fan, eolian, and lacustrine sediments. Four wells penetrate the entire Neogene section and bottom in Mesozoic basement. Late Miocene to Quaternary basin-fill sediments are 0.5 to >1 km thick and overlie Oligocene-Miocene volcanic and lesser sedimentary rocks. The volcanic section is 0.5 to 1.0 km thick and dominated by Miocene mafic lavas. The Neogene section rests nonconformably on heterogeneous Mesozoic basement, which consists of Triassic-Jurassic metamorphic rocks intruded by Cretaceous granitic plutons. The structural framework is dominated by a gently west-tilted half graben cut by moderately to steeply dipping N- to NNEstriking normal faults that dip both east and west. Quaternary faults have not been observed within the proposed FORGE site. Fallon was selected for a potential FORGE site due to its extensional tectonic setting, abundance of available data, existing infrastructure, and documented temperatures, permeability, and lithologic composition of potential reservoirs that fall within the ranges specified by DOE for FORGE. Since the early 1970s, more than 45 wells have been drilled for geothermal exploration within the area. Four exploration wells within the FORGE site are available for use in the project. Several additional wells are available for monitoring outside the central FORGE site within the NASF and Ormat lease area, including numerous temperature gradient holes. There is an existing, ten-station micro-seismic earthquake (MEQ) array that has been collecting data since 2001; the MEQ array can be expanded to encompass the

  8. Manufacturing and properties of closure head forging integrated with flange for PWR reactor pressure vessel

    International Nuclear Information System (INIS)

    Tomoharu Sasaki; Iku Kurihara; Etsuo Murai; Yasuhiko Tanaka; Koumei Suzuki

    2003-01-01

    Closure head forging (SA508, Gr.3 Cl.1) integrated with flange for PWR reactor pressure vessel has been developed. This is intended to enhance structural integrity of closure head resulted in elimination of ISI, by eliminating weld joint between closure head and flange in the conventional design. Manufacturing procedures have been established so that homogeneity and isotropy of the material properties can be assured in the closure head forging integrated with flange. Acceptance tensile and impact test specimens are taken and tested regarding the closure head forging integrated with flange as very thick and complex forgings. This paper describes the manufacturing technologies and material properties of the closure head forging integrated with flange. (orig.)

  9. Design of the Driving and Clamp Rotation Hydraulic Control System for the Heavy Load Forging Manipulator

    Directory of Open Access Journals (Sweden)

    Li Geqiang

    2015-01-01

    Full Text Available The manipulator was equipped with full hydraulic drive. We designed the hydraulic systems for the driving and clamping rotation. We used a fuzzy PID control strategy to design the electro-hydraulic proportional control system. We built a united simulation model based on the co-simulation of MATLAB/Simulink and AMEsim. A mathematical model of the system was also established. We did separate simulations of the system’s dynamic characteristics for fast forging and normal forging working conditions. The parameters were optimized. The field test shows that the steady-state error of the hydraulic system is small and the system response is fast. The system’s rapid response speed, high precision, and stability under heavy load were realized.

  10. Fatigue in cold-forging dies: Tool life analysis

    DEFF Research Database (Denmark)

    Skov-Hansen, P.; Bay, Niels; Grønbæk, J.

    1999-01-01

    In the present investigation it is shown how the tool life of heavily loaded cold-forging dies can be predicted. Low-cycle fatigue and fatigue crack growth testing of the tool materials are used in combination with finite element modelling to obtain predictions of tool lives. In the models...... the number of forming cycles is calculated first to crack initiation and then during crack growth to fatal failure. An investigation of a critical die insert in an industrial cold-forging tool as regards the influence of notch radius, the amount and method of pre-stressing and the selected tool material...

  11. Deposition and characterization of (Cd sub(x) Zn sub(1-x)) S thin films

    International Nuclear Information System (INIS)

    Ferreira, C.L.

    1984-01-01

    Thin films of (Cd sub(x) Zn sub(1-x)) S were deposited on the substrates of soda-lime glass and borosilicate glass by coevaporation of CdS and ZnS, using the technique of hot wall. The temperatures for substrate (200 0 C), wall (350 0 C), CdS source (900 0 -1000 0 C) and ZnS source (900 0 -1200 0 C) were found to be optimum for formation of the films with deposition rates in the range of 0.5 μm.min -1 . The films obtained were with Wurtzite structure, with the crystallographic planes oriented in (001) direction. A linear variation of the parameter C 0 of hexagonal lattice with the concentration of Zn, in the range of 20% to 60%, was observed. For lower and higher concentration outside this range there was a tendency of saturation of C 0 . Measurements of Hall voltage and resistivity demonstrated the mobility and carrier concentration in the range of 10-40 cm 2 v -1 sec -1 and 1.45 x 10 19 - 3.83 x 10 20 cm -3 , respectively, whereas the resistivity of the films ranged from 2.11 x 10 -2 Ω.cm for the Zn concentration variation from 20% to 70%. Measurements of optical absorption revealed linear variation of refractive index of the films with Zn concentration for the wavelenght in the range of 0.5 to 2.0 μm. (Cd sub(x) Zn sub(1-x)) S films with 0.7 2 S. (Author) [pt

  12. The FORGE (Fate Of Repository Gases) pan European project

    International Nuclear Information System (INIS)

    Shaw, Richard

    2010-01-01

    -scaling allowing the optimisation of concepts through detailed scenario analysis. The FORGE partners are committed to training and CPD through a broad portfolio of training opportunities and initiatives which form a significant part of the project. The FORGE project is divided into five work packages. - WP 1 Treatment of gas in performance assessment; - WP 2 Gas generation; - WP 3 Engineered barrier systems; - WP 4 Disturbed host rock formations; - WP 5 Undisturbed host rock formations. There are modelling activities in all of these work packages and a Modelling Co-ordinator specifically to overview all aspects of this work thus ensuring appropriate focus, facilitating the cross-flow of ideas and concepts between WP's is an integral part of the project. This will also ensure best practice is shared between all participants and teams. Further details on the FORGE project and its outcomes can be accessed at www.FORGEproject.org. (author)

  13. Design and verification of thermomechanical parameters of P/M Ti6Al4V alloy forging

    Energy Technology Data Exchange (ETDEWEB)

    Wojtaszek, Marek, E-mail: mwojtasz@metal.agh.edu.pl; Śleboda, Tomasz

    2014-12-05

    Highlights: • Thermomechanical parameters of P/M Ti6Al4V alloy processing were determined. • The use of the mixture of elemental powders allows reducing manufacturing costs. • Numerical modelling allowed to elaborate favourable parameters of forging. • The industrial trials of hot forging of P/M Ti6Al4V alloy were successful. - Abstract: This work is focused on the design of technology of forging high-quality Ti6Al4V alloy by means of powder metallurgy methods. A mixture of elemental powders, with the chemical composition of that of Ti6Al4V alloy, was used as a starting material for the investigation. Powder mixtures were fully densified by hot compaction under precisely controlled conditions. The mechanical properties of the obtained compacts were examined. The mechanical behaviour of the investigated alloy powder compacts was evaluated by compression test under various thermomechanical conditions using Gleeble simulator. The microstructure of powder compacts as well as P/M alloy samples deformed in compression tests was examined. All data obtained from the experimental tests were applied as boundary conditions for numerical simulation of forging of selected forgings. Basing on the results of both plastometric tests and simulations, thermomechanical parameters of the investigated alloy forging were determined. Designed parameters of forging technology were verified by forging trials performed in industrial conditions. The quality of the obtained forgings was examined by means of computed tomography.

  14. Design and verification of thermomechanical parameters of P/M Ti6Al4V alloy forging

    International Nuclear Information System (INIS)

    Wojtaszek, Marek; Śleboda, Tomasz

    2014-01-01

    Highlights: • Thermomechanical parameters of P/M Ti6Al4V alloy processing were determined. • The use of the mixture of elemental powders allows reducing manufacturing costs. • Numerical modelling allowed to elaborate favourable parameters of forging. • The industrial trials of hot forging of P/M Ti6Al4V alloy were successful. - Abstract: This work is focused on the design of technology of forging high-quality Ti6Al4V alloy by means of powder metallurgy methods. A mixture of elemental powders, with the chemical composition of that of Ti6Al4V alloy, was used as a starting material for the investigation. Powder mixtures were fully densified by hot compaction under precisely controlled conditions. The mechanical properties of the obtained compacts were examined. The mechanical behaviour of the investigated alloy powder compacts was evaluated by compression test under various thermomechanical conditions using Gleeble simulator. The microstructure of powder compacts as well as P/M alloy samples deformed in compression tests was examined. All data obtained from the experimental tests were applied as boundary conditions for numerical simulation of forging of selected forgings. Basing on the results of both plastometric tests and simulations, thermomechanical parameters of the investigated alloy forging were determined. Designed parameters of forging technology were verified by forging trials performed in industrial conditions. The quality of the obtained forgings was examined by means of computed tomography

  15. Manufacturing of large and integral-type steel forgings for nuclear steam supply system components

    International Nuclear Information System (INIS)

    Kawaguchi, S.; Tsukada, H.; Suzuki, K.; Sato, I.; Onodera, S.

    1986-01-01

    Forgings for the reactor pressure vessel (RPV) of the pressurized heavy water reactor (PHWR) 700 MWe, which is composed of seven major parts and nozzles totaling about 965 tons, were successfully developed. These forgings are: 1. Flanges: an outside diameter of 8440 mm and a weight of 238 tons max, requiring an ingot of 570 tons. 2. Shells and torus: an outside diameter of about 8000 mm with large height. 3. Cover dome: a diameter of 6800 mm and a thickness of 460 mm, requiring a blank forging before forming of 8000 mm in diameter and 550 m thick. The material designation is 20Mn-Mo-Ni 5 5 (equivalent to SA508, Class 3). In this paper, the manufacturing of and the properties of such large and integral forgings are discussed, including an overview of manufacturing processes for ultralarge-sized forgings over the last two decades

  16. New design of process for cold forging to improve multi-stage gas fitting

    Directory of Open Access Journals (Sweden)

    Han-Sung Huang

    2016-04-01

    Full Text Available This work develops a process that solves the problem of the formation of cracks inside forged gas fittings in the cold forging process that arises from poor forging process design. DEFORM-3D forming software was utilized, and macroscopic experiments with optical microscopy and scanning electron microscopy were conducted to investigate the processed structures and the distribution therein of metal flow lines, and to find the internal micro-cracks to determine whether the cold forging process is reasonable. Analytical results herein demonstrate that the stress and strain inside the gas fitting can be elucidated using metal forming software. Together with experimental results, they demonstrate that a concentration of stress damages the workpiece in the forming process. Moreover, as metal flow lines become narrower, the workpiece becomes more easily damaged. Consequently, the improved cold forging process that is described in this work should be utilized to reduce the occurrence of fine cracks and defects. Planning for proper die design and production, increasing the quality of products, and reducing the number of defective products promote industrial competitiveness.

  17. Structure and magnetic properties of (Nd1-xErx)3Fe25Cr4.0 (0 ≤ x ≤ 0.8) compounds

    International Nuclear Information System (INIS)

    Luo Hongzhi; Jia Lin; Li Yangxian; Meng Fanbin; Shen Jiang; Chen Nanxian; Wu Guangheng; Yang Fuming

    2004-01-01

    The structure and magnetic properties of (Nd 1-x Er x ) 3 Fe 25 Cr 4.0 compounds with x = 0-0.8 have been investigated using x-ray powder diffraction (XRD) and magnetic measurements. It has been found that all the compounds crystallize in a Nd 3 (Fe,Ti) 29 -type structure. Substitution of Er for Nd leads to a contraction of the unit-cell volume. The Curie temperature, T c , and the saturation magnetization, M s , of (Nd 1-x Er x ) 3 Fe 25 Cr 4.0 decrease monotonically with increasing Er content. The easy magnetization direction (EMD) of Nd 3 Fe 25 Cr 4.0 at room temperature is close to the [040] direction but may be a little out of the basal plane. With increasing Er content, the EMD changes closer to the [40-2] direction and the tilt angle increases. Both the XRD patterns and ac susceptibility indicate the appearance of a spin reorientation for x = 0-0.4 as the temperature decreases from room temperature to 77 K. The spin reorientation temperature, T sr , increases monotonically with increasing Er content from 158 K for x = 0 to 198 K for x = 0.4. A first order magnetization process (FOMP) occurs for all the compounds, and the critical field of the FOMP decreases with increasing Er content from 6.6 T for x = 0 to 2.0 T for x = 0.7

  18. Minimization of Residual Stress in an Al-Cu Alloy Forged Plate by Different Heat Treatments

    Science.gov (United States)

    Dong, Ya-Bo; Shao, Wen-Zhu; Jiang, Jian-Tang; Zhang, Bao-You; Zhen, Liang

    2015-06-01

    In order to improve the balance of mechanical properties and residual stress, various quenching and aging treatments were applied to Al-Cu alloy forged plate. Residual stresses determined by the x-ray diffraction method and slitting method were compared. The surface residual stress measured by x-ray diffraction method was consistent with that measured by slitting method. The residual stress distribution of samples quenched in water with different temperatures (20, 60, 80, and 100 °C) was measured, and the results showed that the boiling water quenching results in a 91.4% reduction in residual stress magnitudes compared with cold water quenching (20 °C), but the tensile properties of samples quenched in boiling water were unacceptably low. Quenching in 80 °C water results in 75% reduction of residual stress, and the reduction of yield strength is 12.7%. The residual stress and yield strength level are considerable for the dimensional stability of aluminum alloy. Quenching samples into 30% polyalkylene glycol quenchants produced 52.2% reduction in the maximum compressive residual stress, and the reduction in yield strength is 19.7%. Moreover, the effects of uphill quenching and thermal-cold cycling on the residual stress were also investigated. Uphill quenching and thermal-cold cycling produced approximately 25-40% reduction in residual stress, while the effect on tensile properties is quite slight.

  19. Managing Tensions And Forging Creative Synergies Between ...

    African Journals Online (AJOL)

    Managing Tensions And Forging Creative Synergies Between Indigenous And Modern Settlement Planning Concepts And Practices: Lessons For The Design And Planning For Sustainable Settlements And Built-Forms In Southern Africa.

  20. Crambescidin 816 induces calcium influx though glutamate receptors in primary cultures of cortical neurons

    Directory of Open Access Journals (Sweden)

    Víctor Martín Vázquez

    2014-06-01

    In summary, our data suggest that the cytotoxic effect of 10 μM Cramb816 in cortical neurons may be related to an increase in the cytosolic calcium concentration elicited by the toxin, which is shown to be mediated by glutamate receptor activation. Further studies analyzing the effect of glutamate receptor blockers on the cytotoxic effect of Cramb816 are needed to confirm this hypothesis.

  1. Prompt photon production in $\\sqrt{s_\\mathrm{NN}} = 8.16$ TeV $p$+Pb collisions with ATLAS

    CERN Document Server

    The ATLAS collaboration

    2017-01-01

    The inclusive production cross-section for isolated, prompt photons in $p$+Pb collisions at $\\sqrt{s_\\mathrm{NN}} = 8.16$~TeV is studied with the ATLAS detector at the LHC using a data set with an integrated luminosity of $162$~nb$^{-1}$. The cross-section is measured as a function of photon transverse energy from $25$ to $500$~GeV and over nearly five units of pseudorapidity, including kinematic regions in both the downstream proton-- and nucleus--going directions. Results are reported in the nucleon--nucleon center of mass collision frame. The nuclear modification factor $R_{p\\mathrm{Pb}}$ is reported using a extrapolation, derived using NLO pQCD, of a previous measurement of photon production in $pp$ collisions at $8$~TeV. The cross-sections and $R_{p\\mathrm{Pb}}$ values are compared to the results of a next-to-leading order perturbative QCD calculation and to the expectations based on a picture of the energy loss of partons incoming to the hard scattering. At large nucleus-going rapidity, the cross-sectio...

  2. 21 CFR 1020.40 - Cabinet x-ray systems.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Cabinet x-ray systems. 1020.40 Section 1020.40 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... are all x-ray systems designed primarily for the inspection of carry-on baggage at airline, railroad...

  3. Study of the structural and mechanical properties of the alloy U-0.2V (weight percent) forged in the α phase

    International Nuclear Information System (INIS)

    Couterne, A.; Guillaume, C.

    1980-01-01

    The effects of forging carried out in the 2 phase on the structural properties of the alloy U-0.2V (evtl.%) carburized or not have been studied. A carbon content of the order of 300 x 10 6 , contrary to the one used for the cast alloy, is neither detrimental to the micrographic structure nor to the mechanical properties of the alloy. The forged plates have a semicrystalline structure with alternative, formed bands, on the one hand by small recrystallization grains, on the other by quite deformed coarse grains. The preferential orientations developed resume to a fibrous structure. The fiber axis, practically the [002] axis, is parallell to the normal to the surface of the forged disc. This result implies a good isotropy of the dilatometric and mechanical properities in the whole plane parallel to the disc faces. A correlation has been made between the found structure and the thermal expansion of the material. Furthermore, the mechanical characteristics reach an excellent level (Rsup(M) approx. 900 MPa, A approx. 38%). (orig.)

  4. 40x40: Curriculum for Academic Excellence and Holistic Development

    Science.gov (United States)

    Cárdenas, Alejandra Natalia

    2016-01-01

    The arts school partnerships under the policy "40x40" in Bogotá-Colombia are an example of the international interest in new ways to redress social and educational disadvantages. The main purpose of the policy is to improve education by gradually extending school daytime. This vignette explores three important issues for the…

  5. Distribution of Microstructure and Vickers Hardness in Spur Bevel Gear Formed by Cold Rotary Forging

    Directory of Open Access Journals (Sweden)

    Wuhao Zhuang

    2014-11-01

    Full Text Available Cold rotary forging is a novel metal forming technology which is widely used to produce the high performance gears. Investigating the microstructure and mechanical property of cold rotary forged gears has a great significance in improving their service performance. In this study, the grain morphology in different regions of the spur bevel gear which is processed by cold rotary forging is presented. And the distribution regulars of the grain deformation and Vickers hardness in the transverse and axial sections of the gear tooth are studied experimentally. A three-dimensional rigid-plastic FE model is developed to simulate the cold rotary forging process of a spur bevel gear under the DEFORM-3D software environment. The variation of effective strain in the spur bevel gear has been investigated so as to explain the distribution regulars of the microstructure and Vickers hardness. The results of this research thoroughly reveal the inhomogeneous deformation mechanisms in cold rotary forging of spur bevel gears and provide valuable guidelines for improving the performance of cold rotary forged spur bevel gears.

  6. 76 FR 30200 - Forging Machines; Extension of the Office of Management and Budget's (OMB) Approval of...

    Science.gov (United States)

    2011-05-24

    ...] Forging Machines; Extension of the Office of Management and Budget's (OMB) Approval of Information... extend OMB approval of the information collection requirements contained in the Forging Machines Standard... to reduce employees' risk of death or serious injury by ensuring that forging machines used by them...

  7. Effect of Forging Allowance Value on the Power Consumption of Machining Process

    Directory of Open Access Journals (Sweden)

    L. D. Mal'kova

    2015-01-01

    Full Text Available The paper aim is to develop and study possible energy-efficiency measures for machined forgings drawing on analysis of the impact of the allowance for machining and its scatter.The most sophisticated option to take into consideration the effect of the cut depth is the work-piece machining in which the forging allowance value results from the blank production.Research of power consumption was conducted for turning the cylindrical surface of 144 mm length and  1,5 33 0,5   diameter on forgings of the work-pieces "screw of steering control" made from steel 60PP. A radial dimension allowance at said cylindrical surface at six points of the five sections was sized to assess the allowance value dispersion. The size of the sample measurements at the control points was n = 600. Statistic processing has shown normal law of distribution and sample homogeneity.To analyze the results of experiments was calculated a range of allowances for this workpiece. Calculated minimum and maximum allowance per one side for rough lathing were, respectively, 0.905 mm and 1.905mm. It was found that 77% points under control lie in calculated range of allowance values. And there are no points out of the range on lesser side that proves a lack of rejects; but there are points out of the range on the bigger side, that will require additional costs for machining the specified surface, including the cost of electricity.There were three power consumption calculations based on factory- recommended duty: for processing the entire sample of forgings with an average allowance, for machining forgings allowances of which are within the recommended design range of allowance, and for processing the entire sample of forgings with a minimum value of allowance.It was found that elimination of allowance values which are outside the recommended range enables to reduce the power consumption, at least, by 6%, and the overall power consumption for processing the measured forgings

  8. Computer Οptimization of Geometric Form of Tool and Preform for Closed-die Forging of Compressor Blade Simulator

    Directory of Open Access Journals (Sweden)

    A. V. Botkin

    2014-07-01

    Full Text Available Using the software package DEFORM 3D when developing technology of isothermal forging workpiece blades it is possible to reduce the pre-production time, to improve the quality of forgings and increase lifetime of forging dies. Computer modeling allows to predict the formation of such defects during forging as notches and wrinkles, underfilling of die impression, to estimate tool loads. Preform shape and angular position of the blade simulator were optimized in order to minimize the lateral forces generated during the forging operation.

  9. Manufacture of large monoblock LP rotor forgings and their quality

    International Nuclear Information System (INIS)

    Suzuki, Akira; Kinoshita, Shushi; Kohno, Masayoshi; Miyakawa, Mutsuhiro; Kikuchi, Hideo

    1986-01-01

    This paper describes the manufacturing and the quality of large monoblock low pressure rotors forged from 360 ton and 420 ton ingots. To obtain good and homogenous mechanical properties throughout a rotor, a computer was used to determine the heat treatment conditions. It was found that the technique was very effective at predicting mechanical properties of a monoblock rotor. Mechanical properties including the fracture toughness and fatigue crack propagation characteristics of monoblock rotor forgings proved satisfactory. (author)

  10. Identification of forged Bank of England £20 banknotes using IR spectroscopy.

    Science.gov (United States)

    Sonnex, Emily; Almond, Matthew J; Baum, John V; Bond, John W

    2014-01-24

    Bank of England notes of £20 denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. An aim of this work was to develop a non-destructive method so that a small, compact Fourier transform infrared spectrometer (FT-IR) instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 cm(-1) arising from νasym (CO3(2-)) from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine £20 notes were observed in the ν(OH) (ca. 3500 cm(-1)), ν(C-H) (ca. 2900 cm(-1)) and ν(C=O) (ca. 1750 cm(-1)) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. Identification of forged Bank of England £20 banknotes using IR spectroscopy

    Science.gov (United States)

    Sonnex, Emily; Almond, Matthew J.; Baum, John V.; Bond, John W.

    2014-01-01

    Bank of England notes of £20 denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. An aim of this work was to develop a non-destructive method so that a small, compact Fourier transform infrared spectrometer (FT-IR) instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 cm-1 arising from νasym (CO32-) from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine £20 notes were observed in the ν(OH) (ca. 3500 cm-1), ν(Csbnd H) (ca. 2900 cm-1) and ν(Cdbnd O) (ca. 1750 cm-1) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper.

  12. Intersubjective decision-making for computer-aided forging technology design

    Science.gov (United States)

    Kanyukov, S. I.; Konovalov, A. V.; Muizemnek, O. Yu.

    2017-12-01

    We propose a concept of intersubjective decision-making for problems of open-die forging technology design. The intersubjective decisions are chosen from a set of feasible decisions using the fundamentals of the decision-making theory in fuzzy environment according to the Bellman-Zadeh scheme. We consider the formalization of subjective goals and the choice of membership functions for the decisions depending on subjective goals. We study the arrangement of these functions into an intersubjective membership function. The function is constructed for a resulting decision, which is chosen from a set of feasible decisions. The choice of the final intersubjective decision is discussed. All the issues are exemplified by a specific technological problem. The considered concept of solving technological problems under conditions of fuzzy goals allows one to choose the most efficient decisions from a set of feasible ones. These decisions correspond to the stated goals. The concept allows one to reduce human participation in automated design. This concept can be used to develop algorithms and design programs for forging numerous types of forged parts.

  13. The relationship between UT reported size and actual size of the defects in rotor forgings

    International Nuclear Information System (INIS)

    Seong, Un Hak; Kim, Jeong Tae; Park, Yun Sik

    2003-01-01

    In order to evaluate the reliability of rotor forgings, it is very important to know the actual size of the defects in the rotor forgings. The determination of the defect size requires the accurate non-destructive measurement. However, there may be some differences between the reported size with the ultrasonic non-destructive testing method and the actual size of defects. These differences may be a severe cause of errors in evaluation of rotor forgings. So, the calculated size with 'Master Curve' considering safety factor, which is usually larger than the reported size, has been used in evaluation of rotor forgings. The relation between the EFBH (Equivalent Flat Bottom Hole) size measured by non-destructive method and the actual size by destructive method in many rotors manufactured at Doosan was investigated. In this investigation 'Master Curve' compensating the differences between UT reported size and actual size of defects in our rotor forgings was obtainable. The applicability of this 'Master Curve' as a way of calculating the actual defect size was also investigated. For the evaluation of rotor forgings, it is expected that this 'Master Curve' may be used to determine the accurate actual size of defects.

  14. The relationship between UT reported size and actual size of the defects in rotor forgings

    International Nuclear Information System (INIS)

    Seong, Un Hak; Kim, Jeong Tae; Park, Yun Sik

    2003-01-01

    In order to evaluate the reliability of rotor forgings, it is very important to know the actual size of the defects in the rotor forgings. The determination of the defect size requires the accurate non-destructive measurement. However, there may be some difference between the reported size with ultrasonic non-destructive testing method and the actual size of defects. These differences may be a severe cause of errors in evaluation of rotor forgings. So, the calculated size with 'Master Curve' considering safety factor, which is usually larger than the reported size, has been used in evaluation of rotor forgings. The relation between the EFBH (Equivalent Flat Bottom Hole) size measured by non-destructive method and the actual size by destructive method in many rotors manufactured at Doosan was investigated. In this investigation, 'Master Curve' compensating the differences between UT reported size and actual size of defects in our rotor forgings was obtainable. The applicability of this 'Master Curve' as a way of calculating the actual defect size was also investigated. For the evaluation of rotor forgings, it is expected that this 'Master Curve' may be used to determine the accurate actual size of defects.

  15. Nickel-base alloy forgings for advanced high temperature power plants

    Energy Technology Data Exchange (ETDEWEB)

    Donth, B.; Diwo, A.; Blaes, N.; Bokelmann, D. [Saarschmiede GmbH Freiformschmiede, Voelklingen (Germany)

    2008-07-01

    The strong efforts to reduce the CO{sub 2} emissions lead to the demand for improved thermal efficiency of coal fired power plants. An increased thermal efficiency can be realised by higher steam temperatures and pressures in the boiler and the turbine. The European development aims for steam temperatures of 700 C which requires the development and use of new materials and also associated process technology for large components. Temperatures of 700 C and above are too high for the application of ferritic steels and therefore only Nickel-Base Alloys can fulfill the required material properties. In particular the Nickel-Base Alloy A617 is the most candidate alloy on which was focused the investigation and development in several German and European programs during the last 10 years. The goal is to verify and improve the attainable material properties and ultrasonic detectability of large Alloy 617 forgings for turbine rotors and boiler parts. For many years Saarschmiede has been manufacturing nickel and cobalt alloys and is participating the research programs by developing the manufacturing routes for large turbine rotor forgings up to a maximum diameter of 1000 mm as well as for forged tubes and valve parts for the boiler side. The experiences in manufacturing and testing of very large forgings made from nickel base alloys for 700 C steam power plants are reported. (orig.)

  16. Forge: a short pulse x-ray diagnostic development facility

    International Nuclear Information System (INIS)

    Stradling, G.L.; Hurry, T.R.; Denbow, E.R.; Selph, M.M.; Ameduri, F.P.

    1985-01-01

    A new short pulse x-ray calibration facility has been brought on line at Los Alamos. This facility is being used for the development, testing and calibration of fast x-ray diagnostic systems. The x-ray source consists of a moderate size, sub-nanosecond laser focused at high intensity on an appropriate target material to generate short pulses of x-ray emission from the resulting plasma. Dynamic performance parameters of fast x-ray diagnostic instruments, such as x-ray streak cameras, can be conveniently measured using this facility

  17. Structural changes of radial forging die surface during service under thermo-mechanical fatigue

    International Nuclear Information System (INIS)

    Nematzadeh, Fardin; Akbarpour, Mohammad Reza; Kokabi, Amir Hosein; Sadrnezhaad, Seyed Khatiboleslam

    2009-01-01

    Radial forging is one of the modern open die forging techniques and has a wide application in producing machine parts. During operation at high temperatures, severe temperature change associated with mechanical loads and the resultant wearing of the die surface lead to intense variation in strain on the die surface. Therefore, under this operating condition, thermo-mechanical fatigue (TMF) occurs on the surface of the radial forging die. TMF decreases the life of the die severely. In the present research, different layers were deposited on a 1.2714 steel die by SMAW and GTAW, with a weld wire of UDIMET 520. The microstructure of the radial forging die surface was investigated during welding and service using an optical microscope and scanning electron microscope. The results revealed that, after welding, the structure of the radial forging die surface includes the γ matrix with a homogeneous distribution of fine semi-spherical carbides. The weld structure consisted mostly of columnar dendrites with low grain boundaries. Also, microstructural investigation of the die surface during operation showed that the weld structure of the die surface has remained without any considerable change. Only dendrites were deformed and broken. Moreover, grain boundaries of the dendrites were revealed during service.

  18. Identification of Forged Bank of England 20 Gbp Banknotes Using IR Spectroscopy

    Science.gov (United States)

    Sonnex, Emily

    2014-06-01

    Bank of England notes of 20 GBP denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. A principal aim of this work was to develop a method so that a small, compact ATR FTIR instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 wn from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine 20 GBP notes were observed in the ν(OH) (ca. 3500 wn), ν(C-H) (ca. 2900 wn) and ν(C=O) (ca. 1750 wn) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper. Further to this, with an announcement by the Bank of England to produce polymer banknotes in the future, the work has been extended using Australian polymer banknotes to show that the method would be transferable.

  19. The Forging of a White Gay Aesthetic at the Saint, 1980–84

    Directory of Open Access Journals (Sweden)

    Tim Lawrence

    2011-06-01

    Full Text Available Based on original interviews with key protagonists and documentary research, the article examines the way in which the DJs who worked at the Saint forged a white gay aesthetic across the first half of the 1980s. A private party located in the East Village, New York, the Saint attracted a privileged white male crowd, and this group's position within the emerging culture of neoliberalism, along with the deepening impact of the AIDS epidemic, encouraged its spinners to sever their ties with sounds that were associated with blackness. However, if Saint DJs rejected a high proportion of records that were being released by New York's independents, and also snubbed Chicago house when it broke in 1985, their forging of an aesthetic that emphasised seamless transitions, often between records that contained similar sonic qualities, preempted the style of mixing that would be popularised in house music culture.

  20. Elliptic flow of charm and strange hadrons in high-multiplicity pPb collisions at $ {\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 8.16 TeV

    CERN Document Server

    Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Escalante Del Valle, Alberto; Flechl, Martin; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hrubec, Josef; Jeitler, Manfred; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Taurok, Anton; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Pieters, Maxim; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Marchesini, Ivan; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Bilin, Bugra; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Kalsi, Amandeep Kaur; Lenzi, Thomas; Luetic, Jelena; Postiau, Nicolas; Starling, Elizabeth; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Wang, Qun; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Trocino, Daniele; Tytgat, Michael; Verbeke, Willem; Vermassen, Basile; Vit, Martina; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; David, Pieter; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correia Silva, Gilson; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Calligaris, Luigi; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Marinov, Andrey; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Jing; Li, Linwei; Li, Qiang; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Wang, Yi; Avila, Carlos; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Ayala, Edy; Carrera Jarrin, Edgar; Mahmoud, Mohammed; Mohammed, Yasser; Salama, Elsayed; Bhowmik, Sandeep; Carvalho Antunes De Oliveira, Alexandra; Dewanjee, Ram Krishna; Ehataht, Karl; Kadastik, Mario; Raidal, Martti; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Leloup, Clément; Locci, Elizabeth; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Granier de Cassagnac, Raphael; Kucher, Inna; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Cherepanov, Vladimir; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lattaud, Hugues; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Zhang, Sijing; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Rauch, Max Philip; Schomakers, Christian; Schulz, Johannes; Teroerde, Marius; Wittmer, Bruno; Zhukov, Valery; Albert, Andreas; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Esch, Thomas; Fischer, Robert; Ghosh, Saranya; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Keller, Henning; Knutzen, Simon; Mastrolorenzo, Luca; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Schmidt, Alexander; Teyssier, Daniel; Flügge, Günter; Hlushchenko, Olena; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Sert, Hale; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Babounikau, Illia; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bertsche, David; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Danilov, Vladyslav; De Wit, Adinda; Defranchis, Matteo Maria; Diez Pardos, Carmen; Domínguez Damiani, Daniela; Eckerlin, Guenter; Eichhorn, Thomas; Elwood, Adam; Eren, Engin; Gallo, Elisabetta; Geiser, Achim; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Haranko, Mykyta; Harb, Ali; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Knolle, Joscha; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Meyer, Mareike; Missiroli, Marino; Mittag, Gregor; Mnich, Joachim; Myronenko, Volodymyr; Pflitsch, Svenja Karen; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Schütze, Paul; Schwanenberger, Christian; Shevchenko, Rostyslav; Singh, Akshansh; Stefaniuk, Nazar; Tholen, Heiner; Vagnerini, Antonio; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Benecke, Anna; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Kasieczka, Gregor; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Kutzner, Viktor; Lange, Johannes; Marconi, Daniele; Multhaup, Jens; Niedziela, Marek; Nowatschin, Dominik; Perieanu, Adrian; Reimers, Arne; Rieger, Oliver; Scharf, Christian; Schleper, Peter; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Troendle, Daniel; Usai, Emanuele; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Faltermann, Nils; Freund, Benedikt; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Katkov, Igor; Kudella, Simon; Mildner, Hannes; Mitra, Soureek; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Paspalaki, Garyfallia; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Kontaxakis, Pantelis; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Vellidis, Konstantinos; Kousouris, Konstantinos; Papakrivopoulos, Ioannis; Tsipolitis, Georgios; Evangelou, Ioannis; Foudas, Costas; Gianneios, Paraskevas; Katsoulis, Panagiotis; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Tsitsonis, Dimitrios; Csanad, Mate; Filipovic, Nicolas; Major, Péter; Nagy, Marton Imre; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Vámi, Tamás Álmos; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Tiwari, Praveen Chandra; Bahinipati, Seema; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chauhan, Sushil; Chawla, Ridhi; Dhingra, Nitish; Gupta, Rajat; Kaur, Anterpreet; Kaur, Amandeep; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Lohan, Manisha; Mehta, Ankita; Sandeep, Kaur; Sharma, Sandeep; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Gola, Mohit; Keshri, Sumit; Malhotra, Shivali; Naimuddin, Md; Priyanka, Priyanka; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bharti, Monika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Bhowmik, Debabrata; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Mondal, Kuntal; Nandan, Saswati; Purohit, Arnab; Rout, Prasant Kumar; Roy, Ashim; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Singh, Bipen; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Ravindra Kumar Verma, Ravindra; Aziz, Tariq; Bhat, Muzamil Ahmad; Dugad, Shashikant; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sahoo, Niladribihari; Sarkar, Tanmay; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Di Florio, Adriano; Errico, Filippo; Fiore, Luigi; Gelmi, Andrea; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Di Mattia, Alessandro; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Latino, Giuseppe; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Ferro, Fabrizio; Ravera, Fabio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Di Guida, Salvatore; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Crescenzo, Antonia; Fabozzi, Francesco; Fienga, Francesco; Galati, Giuliana; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Voevodina, Elena; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Bragagnolo, Alberto; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Lujan, Paul; Margoni, Martino; Meneguzzo, Anna Teresa; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Tiko, Andres; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bianchini, Lorenzo; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Pandolfi, Francesco; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Cometti, Simona; Costa, Marco; Covarelli, Roberto; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Soldi, Dario; Staiano, Amedeo; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Vazzoler, Federico; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Kim, Hyunsoo; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Eysermans, Jan; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Bheesette, Srinidhi; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Asghar, Muhammad Irfan; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Traczyk, Piotr; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavine, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sosnov, Dmitry; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Stolin, Viatcheslav; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chistov, Ruslan; Danilov, Mikhail; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Tarkovskii, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Ershov, Alexander; Gribushin, Andrey; Kaminskiy, Alexandre; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Dimova, Tatyana; Kardapoltsev, Leonid; Shtol, Dmitry; Skovpen, Yuri; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Godizov, Anton; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Slabospitskii, Sergei; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Babaev, Anton; Baidali, Sergei; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Alcaraz Maestre, Juan; Bachiller, Irene; Barrio Luna, Mar; Brochero Cifuentes, Javier Andres; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Triossi, Andrea; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Rodríguez Bouza, Víctor; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Duarte Campderros, Jordi; Fernandez, Marcos; Fernández Manteca, Pedro José; Garcia-Ferrero, Juan; García Alonso, Andrea; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Prieels, Cédric; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; Cucciati, Giacomo; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Fasanella, Daniele; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Kornmayer, Andreas; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Malgeri, Luca; Mannelli, Marcello; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pantaleo, Felice; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pitters, Florian Michael; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Tosi, Mia; Treille, Daniel; Tsirou, Andromachi; Veckalns, Viesturs; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Chernyavskaya, Nadezda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Klijnsma, Thomas; Lustermann, Werner; Manzoni, Riccardo Andrea; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Pigazzini, Simone; Quittnat, Milena; Reichmann, Michael; Ruini, Daniele; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Brzhechko, Danyyl; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Neutelings, Izaak; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Chang, Yu-Hsiang; Cheng, Kai-yu; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Hou, George Wei-Shu; Li, You-ying; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Bat, Ayse; Boran, Fatma; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Sunar Cerci, Deniz; Tali, Bayram; Tok, Ufuk Guney; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Atakisi, Ismail Okan; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Agaras, Merve Nazlim; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Komurcu, Yildiray; Sen, Sercan; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Penning, Bjoern; Sakuma, Tai; Smith, Dominic; Smith, Vincent J; Taylor, Joseph; Titterton, Alexander; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Linacre, Jacob; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Auzinger, Georg; Bainbridge, Robert; Bloch, Philippe; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Di Maria, Riccardo; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Komm, Matthias; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Martelli, Arabella; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Strebler, Thomas; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Mackay, Catherine Kirsty; Morton, Alexander; Reid, Ivan; Teodorescu, Liliana; Zahid, Sema; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Madrid, Christopher; Mcmaster, Brooks; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Coubez, Xavier; Cutts, David; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Breedon, Richard; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Ko, Winston; Kukral, Ota; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Stolp, Dustin; Taylor, Devin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Zhang, Fengwangdong; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Karapostoli, Georgia; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Citron, Matthew; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; Gouskos, Loukas; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Wang, Sicheng; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Spiropulu, Maria; Vlimant, Jean-Roch; Wilkinson, Richard; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Sun, Menglei; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; MacDonald, Emily; Mulholland, Troy; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Cheng, Yangyang; Chu, Jennifer; Datta, Abhisek; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kortelainen, Matti J; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Savoy-Navarro, Aurore; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Cadamuro, Luca; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Shi, Kun; Sperka, David; Wang, Jian; Wang, Sean-Jiun; Joshi, Yagya Raj; Linn, Stephan; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Rahmani, Mehdi; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Dittmer, Susan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Mills, Corrinne; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Alhusseini, Mohammad; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Hung, Wai Ting; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Rogan, Christopher; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Kim, Doyeong; Maravin, Yurii; Mendis, Dalath Rachitha; Mitchell, Tyler; Modak, Atanu; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Baron, Owen; Belloni, Alberto; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Wong, Kak; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bauer, Gerry; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Harris, Philip; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Stephans, George; Sumorok, Konstanty; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Zhaozhong, Shi; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Golf, Frank; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Kharchilava, Avto; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Barberis, Emanuela; Freer, Chad; Hortiangtham, Apichart; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Wamorkar, Tanvi; Wang, Bingran; Wisecarver, Andrew; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Bucci, Rachael; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Li, Wenzhao; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Siddireddy, Prasanna; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wightman, Andrew; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Ling, Ta-Yung; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Kalogeropoulos, Alexis; Lange, David; Lucchini, Marco Toliman; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Salfeld-Nebgen, Jakob; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Gutay, Laszlo; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Mahakud, Bibhuprasad; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xiao, Rui; Xie, Wei; Cheng, Tongguang; Dolen, James; Parashar, Neeti; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Guilbaud, Maxime; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tran, Benjamin; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Dulemba, Joseph Lynn; Fallon, Colin; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Taus, Rhys; Verzetti, Mauro; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Luo, Sifu; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Ruiz Alvarez, José David; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Verweij, Marta; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Carlsmith, Duncan; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Woods, Nathaniel

    2018-01-01

    The elliptic azimuthal anisotropy coefficient ($v_2$) is measured for charm ($ {\\mathrm{D^0}} $) and strange ($ {\\mathrm{K^0_S}} $, $ \\Lambda $, $ \\Xi^-$, and $ \\Omega^-$) hadrons, using a data sample of pPb collisions collected by the CMS experiment, at a nucleon-nucleon center-of-mass energy ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 8.16 TeV. A significant positive $v_2$ signal from long-range azimuthal correlations is observed for all particle species in high-multiplicity pPb collisions. The measurement represents the first observation of possible long-range collectivity for open heavy flavor hadrons in small systems. The results suggest that charm quarks have a smaller $v_2$ than the lighter quarks, probably reflecting a weaker collective behavior. This effect is not seen in the larger PbPb collision system at ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 TeV, also presented.

  1. Manufacturing of Nanostructured Rings from Previously ECAE-Processed AA5083 Alloy by Isothermal Forging

    Directory of Open Access Journals (Sweden)

    C. J. Luis

    2013-01-01

    Full Text Available The manufacturing of a functional hollow mechanical element or ring of the AA5083 alloy previously equal channel angular extrusion (ECAE processed, which presents a submicrometric microstructure, is dealt with. For this purpose, the design of two isothermal forging dies (preform and final shape is carried out using the design of experiments (DOE methodology. Moreover, after manufacturing the dies and carrying out tests so as to achieve real rings, the mechanical properties of these rings are analysed as well as their microstructure. Furthermore, a comparison between the different forged rings is made from ECAE-processed material subjected to different heat treatments, previous to the forging stage. On the other hand, the ring forging process is modelled through the use of finite element simulation in order to improve the die design and to study the force required for the isothermal forging, the damage value, and the strain the material predeformed by ECAE has undergone. With this present research work, it is intended to improve the knowledge about the mechanical properties of nanostructured material and the applicability of this material to industrial processes that allow the manufacturing of functional parts.

  2. Elliptic flow of charm and strange hadrons in high-multiplicity pPb collisions at $\\sqrt{s_{_{NN}}} = 8.16~\\mathrm{TeV}$

    CERN Document Server

    CMS Collaboration

    2018-01-01

    First measurements of the elliptic flow of prompt D$^{0}$ mesons in comparison to $\\mathrm{K^0_S}$, $\\Lambda$, $\\Xi^{-}$, and $\\Omega^{-}$ hadrons in pPb collisions at $\\sqrt{s_{_{NN}}} = 8.16~\\mathrm{TeV}$ are reported. The results are based on data collected by the CMS experiment at the LHC and are presented for particles at midrapidity with transverse momentum up to 8 GeV/c after correcting for the contribution of back-to-back jet correlations. The results are compared to PbPb collision data at $\\sqrt{s_{_{NN}}} = 5.02~\\mathrm{TeV}$ for $30-50\\%$ centrality. A significant elliptic flow ($v_2$) signal is observed for all particles, in very high-multiplicity ($\\sim 200$ charged particles) pPb events. When divided by the number of constituent quarks and studied as function of the transverse kinetic energy per quark, the D$^{0}$ $v_2$ values are observed to be significantly smaller than those of light flavor particles, an effect not observed in PbPb collisions. These results show a weaker collective flow assoc...

  3. On the quench sensitivity of 7010 aluminum alloy forgings in the overaged condition

    Energy Technology Data Exchange (ETDEWEB)

    Tiryakioğlu, Murat, E-mail: m.tiryakioglu@unf.edu [School of Engineering, University of North Florida, Jacksonville, FL 32224 (United States); Robinson, Jeremy S. [Department of Mechanical, Aeronautical and Biomedical Engineering, University of Limerick, Limerick (Ireland); Eason, Paul D. [School of Engineering, University of North Florida, Jacksonville, FL 32224 (United States)

    2014-11-17

    The quench sensitivity of an overaged 7010 alloy forging was characterized by tensile and Vickers hardness tests, as well as scanning electron microscopy. Longitudinal tensile specimens, excised from a rectilinear open die forging were cooled from the solution treatment temperature following thirty-two different cooling paths including interrupted and delayed quenches. SEM analysis of the microstructure showed that quench precipitates were (i) Al{sub 2}CuMg (S) which nucleated heterogeneously on grain boundaries and (ii) Mg(Zn,Cu,Al){sub 2} (η) on grain boundaries, dispersoid bands, subgrain boundaries as well as in the aluminum matrix. The quench sensitivity of the alloy's yield strength and Vickers hardness was modeled simultaneously by quadruple-C curves, using an improved methodology for Quench Factor Analysis. The four C-curves used in the model represented loss of solute by (i) precipitation of S on grain boundaries, and precipitation of η (ii) on grain boundaries and dispersoid bands, (iii) on subgrain boundaries and (iv) in the matrix. The model yielded coefficient of determination (R{sup 2}) values of 0.967 and 0.974 for yield strength and Vickers hardness, respectively. The model and the implications of the results are discussed in this paper.

  4. Prospective evaluation of the diagnostic value of sensitive KIT D816V mutation analysis of blood in adults with suspected systemic mastocytosis

    DEFF Research Database (Denmark)

    Kielsgaard Kristensen, Thomas; Vestergaard, H; Bindslev-Jensen, C

    2017-01-01

    BACKGROUND: Sensitive KIT D816V mutation analysis of blood has been proposed to guide bone marrow (BM) investigation in suspected systemic mastocytosis (SM). The aim of this prospective study was for the first time to compare the D816V status of the "screening blood sample" used to guide BM biopsy...... in suspected SM to the outcome of the subsequent BM investigation. METHODS: Fifty-eight adult patients with suspected SM were included. The outcome of sensitive KIT D816V analysis of blood was compared to the result of the BM investigation. RESULTS: Screening blood samples from 44 of 58 patients tested D816V...... patients did not fulfill any diagnostic SM criteria (excluding tryptase criterion). Of the 48 SM patients, 90% tested D816V-positive. Thirteen SM patients presented with Hymenoptera venom-induced anaphylaxis, no skin lesions, and baseline serum tryptase ≤20 ng/mL. Of these, 92% tested D816V...

  5. Numerical analysis of In_xGa_1_−_xN/SnS and Al_xGa_1_−_xN/SnS heterojunction solar cells

    International Nuclear Information System (INIS)

    Lin, Shuo; Li, Xirong; Pan, Huaqing; Chen, Huanting; Li, Xiuyan; Li, Yan; Zhou, Jinrong

    2016-01-01

    Highlights: • In_xGa_1_−_xN/SnS and Al_xGa_1_−_xN/SnS solar cells are studied by numerical analysis. • Performances of In_xGa_1_−_xN/SnS solar cells enhanced with decreasing In content. • The electron barrier leads to the degraded efficiency of Al_xGa_1_−_xN/SnS solar cells. • GaN/SnS solar cell exhibits the highest efficiency 26.34%. - Abstract: In this work the photovoltaic properties of In_xGa_1_−_xN/SnS and Al_xGa_1_−_xN/SnS heterojunction solar cells are studied by numerical analysis. The photovoltaic performances of In_xGa_1_−_xN/SnS solar cells are enhanced with the decreasing In content and the GaN/SnS solar cell exhibits the highest efficiency. The efficiencies of GaN/SnS solar cell improve with the increased SnS thickness and the reduced GaN thickness. For the Al_xGa_1_−_xN/SnS solar cells, there is electron barrier in the Al_xGa_1_−_xN/SnS interface. The electron barrier becomes larger with increasing Al content and lead to the degraded efficiency of Al_xGa_1_−_xN/SnS solar cells. The simulation contributes to designing and fabricating SnS solar cells.

  6. [A method of temperature measurement for hot forging with surface oxide based on infrared spectroscopy].

    Science.gov (United States)

    Zhang, Yu-cun; Qi, Yan-de; Fu, Xian-bin

    2012-05-01

    High temperature large forging is covered with a thick oxide during forging. It leads to a big measurement data error. In this paper, a method of measuring temperature based on infrared spectroscopy is presented. It can effectively eliminate the influence of surface oxide on the measurement of temperature. The method can measure the surface temperature and emissivity of the oxide directly using the infrared spectrum. The infrared spectrum is radiated from surface oxide of forging. Then it can derive the real temperature of hot forging covered with the oxide using the heat exchange equation. In order to greatly restrain interference spectroscopy through included in the received infrared radiation spectrum, three interference filter system was proposed, and a group of optimal gap parameter values using spectral simulation were obtained. The precision of temperature measurement was improved. The experimental results show that the method can accurately measure the surface temperature of high temperature forging covered with oxide. It meets the requirements of measurement accuracy, and the temperature measurement method is feasible according to the experiment result.

  7. Synthesis of metals chalcogenides nano-particles from H{sub 2}X (X=S, Se, Te) produced electrochemically; Synthese de nanoparticules de chalcogenures de metaux a partir de H{sub 2}X (X=S, Se, Te) produit electrochimiquement

    Energy Technology Data Exchange (ETDEWEB)

    Bastide, S.; Tena-Zaera, R.; Alleno, E.; Godart, C.; Levy-Clement, C. [Centre National de la Recherche Scientifique (CNRS), Lab. de Chimie Metallurgique des Terres Rares, 94 - Thiais (France); Hodes, G. [Weizmann Institute of Science, Rehovot (Israel)

    2006-07-01

    In this work, an electrochemical method to produce H{sub 2}X (X=S, Se, Te) hydrides in a controlled way (without being able to store them) and to transfer them directly in the synthesis reactor has been perfected. By this method, the use of H{sub 2}Te has been possible. The method uses the reduction of the elementary chalcogenide in acid medium. The Te being conductor, it can be directly used as electrode, on the other hand S and Se are insulators. Nevertheless, graphite-S or Se conducing composite electrodes can also be used. When the electrolyte composition (pH, salts presence) is well adjusted, the essential of the cathodic current is consumed by the chalcogenide reduction (low evolution of H{sub 2}) with faradic yields of about 100% for H{sub 2}S and H{sub 2}Se and 40% for HeTe. The use of H{sub 2}X allows the synthesis of nano-particles of metals chalcogenides directly by reaction with dissolved metallic salts in aqueous or organic medium and precipitation. Thus it has been possible to prepare all the CdX compounds under the form of nano-particles of diameter between 3 and 5 nm by bubbling of the gaseous hydrides in aqueous acetate solutions of Cd. In producing concomitantly H{sub 2}S and H{sub 2}Se, nano-particles of solid solutions CdS{sub x}Se{sub 1-x} have been synthesized too. (O.M.)

  8. Modelling and Testing of Friction in Forging

    DEFF Research Database (Denmark)

    Bay, Niels

    2007-01-01

    Knowledge about friction is still limited in forging. The theoretical models applied presently for process analysis are not satisfactory compared to the advanced and detailed studies possible to carry out by plastic FEM analyses and more refined models have to be based on experimental testing...

  9. Forging Inclusive Solutions: Experiential Earth Charter Education

    Science.gov (United States)

    Hill, Linda D.

    2010-01-01

    Forging Inclusive Solutions describes the aims, methodology and outcomes of Inclusive Leadership Adventures, an experiential education curriculum for exploring the Earth Charter. Experiential education builds meaningful relationships, skills, awareness and an inclusive community based on the Earth Charter principles. When we meet people where they…

  10. AdS3 xw (S3 x S3 x S1) solutions of type IIB string theory

    International Nuclear Information System (INIS)

    Donos, Aristomenis; Gauntlett, Jerome P.; Imperial College, London; Sparks, James

    2008-10-01

    We analyse a recently constructed class of local solutions of type IIB supergravity that consist of a warped product of AdS 3 with a sevendimensional internal space. In one duality frame the only other nonvanishing fields are the NS three-form and the dilaton. We analyse in detail how these local solutions can be extended to globally well-defined solutions of type IIB string theory, with the internal space having topology S 3 x S 3 x S 1 and with properly quantised three-form flux. We show that many of the dual (0,2) SCFTs are exactly marginal deformations of the (0,2) SCFTs whose holographic duals are warped products of AdS 3 with seven-dimensional manifolds of topology S 3 x S 2 x T 2 . (orig.)

  11. Inclusive J/$\\psi$ production at forward and backward rapidity in p-Pb collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV

    CERN Document Server

    Acharya, Shreyasi; The ALICE collaboration; Adamova, Dagmar; Adolfsson, Jonatan; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Al-turany, Mohammad; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alfaro Molina, Jose Ruben; Ali, Yasir; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altenkamper, Lucas; Altsybeev, Igor; Andrei, Cristian; Andreou, Dimitra; Andrews, Harry Arthur; Andronic, Anton; Angeletti, Massimo; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Anwar, Rafay; Apadula, Nicole; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barioglio, Luca; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartsch, Esther; Bastid, Nicole; Basu, Sumit; Batigne, Guillaume; Batyunya, Boris; Batzing, Paul Christoph; Bazo Alba, Jose Luis; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhaduri, Partha Pratim; Bhasin, Anju; Bhat, Inayat Rasool; Bhatt, Himani; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Antonio; Bianchi, Livio; Bianchi, Nicola; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Boca, Gianluigi; Bock, Friederike; Bogdanov, Alexey; Boldizsar, Laszlo; Bombara, Marek; Bonomi, Germano; Bonora, Matthias; Borel, Herve; Borissov, Alexander; Borri, Marcello; Botta, Elena; Bourjau, Christian; Bratrud, Lars; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Soto Camacho, Rabi; Camerini, Paolo; Capon, Aaron Allan; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Chandra, Sinjini; Chang, Beomsu; Chang, Wan; Chapeland, Sylvain; Chartier, Marielle; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Chowdhury, Tasnuva; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Concas, Matteo; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Costanza, Susanna; Crkovska, Jana; Crochet, Philippe; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Dani, Sanskruti; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Franz Degenhardt, Hermann; Deisting, Alexander; Deloff, Andrzej; Delsanto, Silvia; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Ruzza, Benedetto; Arteche Diaz, Raul; Dietel, Thomas; Dillenseger, Pascal; Ding, Yanchun; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Van Doremalen, Lennart Vincent; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dudi, Sandeep; Duggal, Ashpreet Kaur; Dukhishyam, Mallick; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Ersdal, Magnus Rentsch; Espagnon, Bruno; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Fabbietti, Laura; Faggin, Mattia; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Fernandez Tellez, Arturo; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiorenza, Gabriele; Flor, Fernando; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Ganoti, Paraskevi; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; De Leone Gay, Maria Beatriz; Germain, Marie; Ghosh, Jhuma; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Greiner, Leo Clifford; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Gronefeld, Julius Maximilian; Grosa, Fabrizio; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Guernane, Rachid; Guerzoni, Barbara; Guittiere, Manuel; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Habib, Michael Karim; Hadjidakis, Cynthia Marie; Hamagaki, Hideki; Hamar, Gergoe; Hamid, Mohammed; Hamon, Julien Charles; Hannigan, Ryan; Haque, Md Rihan; Harris, John William; Harton, Austin Vincent; Hassan, Hadi; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Gonzalez Hernandez, Emma; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hills, Christopher; Hippolyte, Boris; Hohlweger, Bernhard; Horak, David; Hornung, Sebastian; Hosokawa, Ritsuya; Hota, Jyotishree; Hristov, Peter Zahariev; Huang, Chun-lu; Hughes, Charles; Huhn, Patrick; Humanic, Thomas; Hushnud, Hushnud; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Iddon, James Philip; Iga Buitron, Sergio Arturo; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Islam, Md Samsul; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jaelani, Syaefudin; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Jena, Chitrasen; Jercic, Marko; Jimenez Bustamante, Raul Tonatiuh; Jin, Muqing; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karczmarczyk, Przemyslaw; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Ketzer, Bernhard Franz; Khabanova, Zhanna; Khan, Ahsan Mehmood; Khan, Shaista; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kielbowicz, Miroslaw Marek; Kileng, Bjarte; Kim, Byungchul; Kim, Daehyeok; Kim, Dong Jo; Kim, Eun Joo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Se Yong; Kim, Taejun; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Varga-kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Konyushikhin, Maxim; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kralik, Ivan; Kravcakova, Adela; Kreis, Lukas; Krivda, Marian; Krizek, Filip; Kruger, Mario; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lai, Yue Shi; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Larionov, Pavel; Laudi, Elisa; Lavicka, Roman; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Leon Monzon, Ildefonso; Levai, Peter; Li, Xiaomei; Li, Xing Long; Lien, Jorgen Andre; Lietava, Roman; Lim, Bong-hwi; Lindal, Svein; Lindenstruth, Volker; Lindsay, Scott William; Lippmann, Christian; Lisa, Michael Annan; Litichevskyi, Vladyslav; Liu, Alwina; Ljunggren, Hans Martin; Llope, William; Lodato, Davide Francesco; Loginov, Vitaly; Loizides, Constantinos; Loncar, Petra; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Luhder, Jens Robert; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Maevskaya, Alla; Mager, Magnus; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Malik, Qasim Waheed; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez, Jacobb Lee; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Masson, Erwann; Mastroserio, Annalisa; Mathis, Andreas Michael; Toledo Matuoka, Paula Fernanda; Matyja, Adam Tomasz; Mayer, Christoph; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Meninno, Elisa; Mercado-perez, Jorge; Meres, Michal; Soncco Meza, Carlos; Mhlanga, Sibaliso; Miake, Yasuo; Micheletti, Luca; Mieskolainen, Matti Mikael; Mihaylov, Dimitar Lubomirov; Mikhaylov, Konstantin; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Auro Prasad; Mohanty, Bedangadas; Khan, Mohammed Mohisin; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Arratia Munoz, Miguel Ignacio; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Myers, Corey James; Myrcha, Julian Wojciech; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Narayan, Amrendra; Naru, Muhammad Umair; Nassirpour, Adrian Fereydon; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Nesbo, Simon Voigt; Neskovic, Gvozden; Ng, Fabian; Nicassio, Maria; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oh, Hoonjung; Ohlson, Alice Elisabeth; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Pachmayer, Yvonne Chiara; Pacik, Vojtech; Pagano, Davide; Paic, Guy; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Panebianco, Stefano; Papikyan, Vardanush; Pareek, Pooja; Park, Jonghan; Parkkila, Jasper Elias; Parmar, Sonia; Passfeld, Annika; Pathak, Surya Prakash; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira, Luis Gustavo; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrovici, Mihai; Petta, Catia; Peretti Pezzi, Rafael; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Pisano, Silvia; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pliquett, Fabian; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Pozdniakov, Valeriy; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Punin, Valery; Putschke, Jorn Henning; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reshetin, Andrey; Revol, Jean-pierre; Reygers, Klaus Johannes; Riabov, Viktor; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rode, Sudhir Pandurang; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogalev, Roman; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Rokita, Przemyslaw Stefan; Ronchetti, Federico; Dominguez Rosas, Edgar; Roslon, Krystian; Rosnet, Philippe; Rossi, Andrea; Rotondi, Alberto; Roukoutakis, Filimon; Roy, Christelle Sophie; Roy, Pradip Kumar; Vazquez Rueda, Omar; Rui, Rinaldo; Rumyantsev, Boris; Rustamov, Anar; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Saha, Sumit Kumar; Sahoo, Baidyanath; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandoval, Andres; Sarkar, Amal; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Sas, Mike Henry Petrus; Scapparone, Eugenio; Scarlassara, Fernando; Schaefer, Brennan; Scheid, Horst Sebastian; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Marten Ole; Schmidt, Martin; Schmidt, Nicolas Vincent; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sett, Priyanka; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shahoyan, Ruben; Shaikh, Wadut; Shangaraev, Artem; Sharma, Anjali; Sharma, Ankita; Sharma, Meenakshi; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shimomura, Maya; Shirinkin, Sergey; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singh, Randhir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Sputowska, Iwona Anna; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Stocco, Diego; Storetvedt, Maksim Melnik; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terrevoli, Cristina; Teyssier, Boris; Thakur, Dhananjaya; Thakur, Sanchari; Thomas, Deepa; Thoresen, Freja; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Topilskaya, Nataliya; Toppi, Marco; Rojas Torres, Solangel; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Tropp, Lukas; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Trzcinski, Tomasz Piotr; Trzeciak, Barbara Antonina; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Umaka, Ejiro Naomi; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Vercellin, Ermanno; Vergara Limon, Sergio; Vermunt, Luuk; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Wagner, Boris; Wang, Hongkai; Wang, Mengliang; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wegrzynek, Adam; Weiser, Dennis Franz; Wenzel, Sandro Christian; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Willsher, Emily; Windelband, Bernd Stefan; Witt, William Edward; Xu, Ran; Yalcin, Serpil; Yamakawa, Kosei; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correa Zanoli, Henrique Jose; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zhalov, Mikhail; Zhang, Xiaoming; Zhang, Yonghong; Zhang, Zuman; Zhao, Chengxin; Zherebchevskii, Vladimir; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Ya; Zichichi, Antonino; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann; Zou, Shuguang

    2018-01-01

    Inclusive J/$\\psi$ production is studied in p-Pb interactions at a centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{NN}}$ = 8.16 TeV, using the ALICE detector at the CERN LHC. The J/$\\psi$ meson is reconstructed, via its decay to a muon pair, in the centre-of-mass rapidity intervals 2.03 < $y_{cms}$ < 3.53 and −4.46 < $y_{cms}$ < −2.96, where positive and negative $y_{cms}$ refer to the p-going and Pb-going direction, respectively. The transverse momentum coverage is $p_{T}$ < 20 GeV/$c$. In this paper, $y_{cms}$- and $p_{T}$-differential cross sections for inclusive J/$\\psi$ production are presented, and the corresponding nuclear modification factors RpPb are shown. Forward results show a suppression of the J/ψ yield with respect to pp collisions, concentrated in the region $p_{T}$ $\\lesssim$ 5 GeV/$c$. At backward rapidity no significant suppression is observed. The results are compared to previous measurements by ALICE in p-Pb collisions at $\\sqrt{s_{NN}}$ = 5.02 TeV and to...

  12. Finite element analysis for temperature distributions in a cold forging

    International Nuclear Information System (INIS)

    Kim, Dong Bum; Lee, In Hwan; Cho, Hae Yong; Kim, Sung Wook; Song, In Chul; Jeon, Byung Cheol

    2013-01-01

    In this research, the finite element method is utilized to predict the temperature distributions in a cold-forging process for a cambolt. The cambolt is mainly used as a part of a suspension system of a vehicle. The cambolt has an off-centered lobe that manipulates the vertical position of the knuckle and wheel to a slight degree. The cambolt requires certain mechanical properties, such as strength and endurance limits. Moreover, temperature is also an important factor to realize mass production and improve efficiency. However, direct measurement of temperature in a forging process is infeasible with existing technology; therefore, there is a critical need for a new technique. Accordingly, in this study, a thermo-coupled finite element method is developed for predicting the temperature distribution. The rate of energy conversion to heat for the workpiece material is determined, and the temperature distribution is analyzed throughout the forging process for a cambolt. The temperatures associated with different punch speeds are also studied, as well as the relationships between load, temperature, and punch speed. Experimental verification of the technique is presented.

  13. Finite element analysis for temperature distributions in a cold forging

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dong Bum; Lee, In Hwan; Cho, Hae Yong [Chungbuk National University, Cheongju (Korea, Republic of); Kim, Sung Wook [Yanbian National University, Yanbian (China); Song, In Chul; Jeon, Byung Cheol [Sunil dyfas, Jincheon (Korea, Republic of)

    2013-10-15

    In this research, the finite element method is utilized to predict the temperature distributions in a cold-forging process for a cambolt. The cambolt is mainly used as a part of a suspension system of a vehicle. The cambolt has an off-centered lobe that manipulates the vertical position of the knuckle and wheel to a slight degree. The cambolt requires certain mechanical properties, such as strength and endurance limits. Moreover, temperature is also an important factor to realize mass production and improve efficiency. However, direct measurement of temperature in a forging process is infeasible with existing technology; therefore, there is a critical need for a new technique. Accordingly, in this study, a thermo-coupled finite element method is developed for predicting the temperature distribution. The rate of energy conversion to heat for the workpiece material is determined, and the temperature distribution is analyzed throughout the forging process for a cambolt. The temperatures associated with different punch speeds are also studied, as well as the relationships between load, temperature, and punch speed. Experimental verification of the technique is presented.

  14. A material based approach to creating wear resistant surfaces for hot forging

    Science.gov (United States)

    Babu, Sailesh

    Tools and dies used in metal forming are characterized by extremely high temperatures at the interface, high local pressures and large metal to metal sliding. These harsh conditions result in accelerated wear of tooling. Lubrication of tools, done to improve metal flow drastically quenches the surface layers of the tools and compounds the tool failure problem. This phenomenon becomes a serious issue when parts forged at complex and are expected to meet tight tolerances. Unpredictable and hence uncontrolled wear and degradation of tooling result in poor part quality and premature tool failure that result in high scrap, shop downtime, poor efficiency and high cost. The objective of this dissertation is to develop a computer-based methodology for analyzing the requirements hot forging tooling to resist wear and plastic deformation and wear and predicting life cycle of forge tooling. Development of such is a system is complicated by the fact that wear and degradation of tooling is influenced by not only the die material used but also numerous process controls like lubricant, dilution ratio, forging temperature, equipment used, tool geometries among others. Phenomenological models available u1 the literature give us a good thumb rule to selecting materials but do not provide a way to evaluate pits performance in field. Once a material is chosen, there are no proven approaches to create surfaces out of these materials. Coating approaches like PVD and CVD cannot generate thick coatings necessary to withstand the conditions under hot forging. Welding cannot generate complex surfaces without several secondary operations like heat treating and machining. If careful procedures are not followed, welds crack and seldom survive forging loads. There is a strong need for an approach to selectively, reliably and precisely deposit material of choice reliably on an existing surface which exhibit not only good tribological properties but also good adhesion to the substrate

  15. KIT D816V mutation-positive cell fractions in lesional skin biopsies from adults with systemic mastocytosis

    DEFF Research Database (Denmark)

    Kielsgaard Kristensen, Thomas; Broesby-Olsen, Sigurd; Vestergaard, Hanne

    2013-01-01

    Most adults with systemic mastocytosis (SM) carry the somatic KIT D816V mutation, but the occurrence of the mutation in lesional skin remains to be characterized.......Most adults with systemic mastocytosis (SM) carry the somatic KIT D816V mutation, but the occurrence of the mutation in lesional skin remains to be characterized....

  16. Effect of raw materials and hardening process on hardness of manually forged knife

    Science.gov (United States)

    Balkhaya, Suwarno

    2017-06-01

    Knives are normally made by forging process either using a machine or traditional method by means of hammering process. This present work was conducted to study the effects of steel raw materials and hardening process on the hardness of manually forged knives. The knife samples were made by traditional hammering (forging) process done by local blacksmith. Afterward, the samples were heat treated with two different hardening procedures, the first was based on the blacksmith procedure and the second was systematically done at the laboratory. The forging was done in the temperature ranged between 900-950°C, while the final temperature ranged between 650-675°C. The results showed that knives made of spring steel and heat treated in simulated condition at the laboratory obtained higher level of hardness, i.e. 62 HRC. In general, knives heat treated by local blacksmith had lower level of hardness that those obtained from simulated condition. Therefore, we concluded that the traditional knife quality in term of hardness can be improved by optimizing the heat treatment schedule.

  17. Fabrication Improvement of Cold Forging Hexagonal Nuts by Computational Analysis and Experiment Verification

    Directory of Open Access Journals (Sweden)

    Shao-Yi Hsia

    2015-01-01

    Full Text Available Cold forging has played a critical role in fasteners and has been applied to the automobile industry, construction industry, aerospace industry, and living products so that cold forging presents the opportunities for manufacturing more products. By using computer simulation, this study attempts to analyze the process of creating machine parts, such as hexagonal nuts. The DEFORM-3D forming software is applied to analyze the process at various stages in the computer simulation, and the compression test is also used for the flow stress equation in order to compare the differences between the experimental results and the equation that is built into the computer simulation software. At the same time, the metallography and hardness of experiments are utilized to understand the cold forging characteristics of hexagonal nuts. The research results would benefit machinery businesses to realize the forging load and forming conditions at various stages before the fastener formation. In addition to planning proper die design and production, the quality of the produced hexagonal nuts would be more stable to promote industrial competitiveness.

  18. Influence of the Constitutive Flow Law in FEM Simulation of the Radial Forging Process

    Directory of Open Access Journals (Sweden)

    Olivier Pantalé

    2013-01-01

    Full Text Available Radial forging is a widely used forming process for manufacturing hollow products in transport industry. As the deformation of the workpiece, during the process, is a consequence of a large number of high-speed strokes, the Johnson-Cook constitutive law (taking into account the strain rate seems to be well adapted for representing the material behavior even if the process is performed under cold conditions. But numerous contributions concerning radial forging analysis, in the literature, are based on a simple elastic-plastic formulation. As far as we know, this assumption has yet not been validated for the radial forging process. Because of the importance of the flow law in the effectiveness of the model, our purpose in this paper is to analyze the influence of the use of an elastic-viscoplastic formulation instead of an elastic-plastic one for modeling the cold radial forging process. In this paper we have selected two different laws for the simulations: the Johnson-Cook and the Ludwik ones, and we have compared the results in terms of forging force, product's thickness, strains, stresses, and CPU time. For the presented study we use an AISI 4140 steel, and we denote a fairly good agreement between the results obtained using both laws.

  19. Sensitive KIT D816V mutation analysis of blood as a diagnostic test in mastocytosis

    DEFF Research Database (Denmark)

    Kielsgaard Kristensen, Thomas; Vestergaard, Hanne; Bindslev-Jensen, Carsten

    2014-01-01

    The recent progress in sensitive KIT D816V mutation analysis suggests that mutation analysis of peripheral blood (PB) represents a promising diagnostic test in mastocytosis. However, there is a need for systematic assessment of the analytical sensitivity and specificity of the approach in order...... to establish its value in clinical use. We therefore evaluated sensitive KIT D816V mutation analysis of PB as a diagnostic test in an entire case-series of adults with mastocytosis. We demonstrate for the first time that by using a sufficiently sensitive KIT D816V mutation analysis, it is possible to detect...... the mutation in PB in nearly all adult mastocytosis patients. The mutation was detected in PB in 78 of 83 systemic mastocytosis (94%) and 3 of 4 cutaneous mastocytosis patients (75%). The test was 100% specific as determined by analysis of clinically relevant control patients who all tested negative. Mutation...

  20. Self-adaptive multimethod optimization applied to a tailored heating forging process

    Science.gov (United States)

    Baldan, M.; Steinberg, T.; Baake, E.

    2018-05-01

    The presented paper describes an innovative self-adaptive multi-objective optimization code. Investigation goals concern proving the superiority of this code compared to NGSA-II and applying it to an inductor’s design case study addressed to a “tailored” heating forging application. The choice of the frequency and the heating time are followed by the determination of the turns number and their positions. Finally, a straightforward optimization is performed in order to minimize energy consumption using “optimal control”.

  1. Tailorable Burning Behavior of Ti14 Alloy by Controlling Semi-Solid Forging Temperature.

    Science.gov (United States)

    Chen, Yongnan; Yang, Wenqing; Zhan, Haifei; Zhang, Fengying; Huo, Yazhou; Zhao, Yongqing; Song, Xuding; Gu, Yuantong

    2016-08-16

    Semi-solid processing (SSP) is a popular near-net-shape forming technology for metals, while its application is still limited in titanium alloy mainly due to its low formability. Recent works showed that SSP could effectively enhance the formability and mechanical properties of titanium alloys. The processing parameters such as temperature and forging rate/ratio, are directly correlated with the microstructure, which endow the alloy with different chemical and physical properties. Specifically, as a key structural material for the advanced aero-engine, the burn resistant performance is a crucial requirement for the burn resistant titanium alloy. Thus, this work aims to assess the burning behavior of Ti14, a kind of burn resistant alloy, as forged at different semi-solid forging temperatures. The burning characteristics of the alloy are analyzed by a series of burning tests with different burning durations, velocities, and microstructures of burned sample. The results showed that the burning process is highly dependent on the forging temperature, due to the fact that higher temperatures would result in more Ti₂Cu precipitate within grain and along grain boundaries. Such a microstructure hinders the transport of oxygen in the stable burning stage through the formation of a kind of oxygen isolation Cu-enriched layer under the burn product zone. This work suggests that the burning resistance of the alloy can be effectively tuned by controlling the temperature during the semi-solid forging process.

  2. On the domestically-made heavy forging for reactor pressure vessels of PWR nuclear power plant

    International Nuclear Information System (INIS)

    Pan Xiren; Zhang Chen.

    1988-01-01

    The present situation of the foreign heavy forgings for nuclear reactor pressure vessels and the heavy forgings condition which is used for the Qinshan 300MWe nuclear power plant are described. Some opinions of domestic products is proposed

  3. Forged HITEMAL: Al-based MMCs strengthened with nanometric thick Al{sub 2}O{sub 3} skeleton

    Energy Technology Data Exchange (ETDEWEB)

    Balog, Martin, E-mail: ummsbama@savba.sk [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia); Krizik, Peter; Nosko, Martin; Hajovska, Zuzana [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia); Victoria Castro Riglos, Maria [Centro Atómico Bariloche, Av. Bustillo 9.500, 8400 Bariloche, Río Negro (Argentina); Rajner, Walter [New Materials Development GmbH, Römerstrasse 28, 83410 Laufen, Leobendorf (Germany); Liu, De-Shin [National Chung Cheng University, 168 University Rd., Min-Hsiung, 62102 Chia-Yi, Taiwan (China); Simancik, Frantisek [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia)

    2014-09-08

    Bulk Al–Al{sub 2}O{sub 3} metal matrix composites (MMCs) named HITEMAL (high temperature aluminum) were fabricated in situ by forging compaction of five different types of gas-atomized commercial purity Al powders with a mean particle size in the range of 1–9 µm. As-forged HITEMAL consisted of (sub)micrometric Al grains (matrix) decorated with nanometric thick amorphous Al{sub 2}O{sub 3} (a-Al{sub 2}O{sub 3}) skeleton. Low-angle grain boundaries (LAGBs) free of Al{sub 2}O{sub 3} were located in the Al grain interior. The Al grain size and the portion of LAGBs increased with the increase in the relative powder surface area. As-forged HITEMAL shows excellent thermal stability up to 400 °C for 24 h. Annealing at temperatures ≥450 °C led to crystallization and morphological transformation from a-Al{sub 2}O{sub 3} skeleton to nanometric γ-Al{sub 2}O{sub 3} particles. Owing to the pinning effect of Al{sub 2}O{sub 3} phase, no Al grain growth took place during annealing up to 500 °C. HITEMAL showed attractive mechanical properties especially when tested at 300 °C (yield strength up to 220 MPa, Young's modulus up to 58 GPa). Despite the presence of a nearly continuous a-Al{sub 2}O{sub 3} skeleton along adjacent Al grains, forged HITEMAL materials had reasonable room temperature elongation of 7–26%. HITEMAL's elongation decreased as the Al grain size decreased and with increased testing temperature. The loss in elongation (uniform and total) was attributed to the inhomogeneous flow, which occurred due to high densities of high angle grain boundaries (dislocation sinks) and small content of LAGBs. The strength of HITEMAL stemmed from grain boundary mediated strengthening mechanisms. The results showed a positive deviation from the Hall–Petch plot, which is typical behavior of ultrafine-grained metals. Transformation of a-Al{sub 2}O{sub 3} skeleton to γ-Al{sub 2}O{sub 3} particles led to deterioration of the HITEMAL strength and Young's modulus.

  4. Backward can extrusion with conical,rotating punch as a cold forging tribology test

    DEFF Research Database (Denmark)

    Ceron, Ermanno; Bay, Niels; Tetsuo, A.

    2011-01-01

    with an analysis of the sliding velocity distribution along the punch nose. The latter is determined by FE analysis of the test. Results show friction stress for unalloyed low C-steel provided with different types of lubricants, e.g. phosphate coating plus soap, phosphate coating plus MoS2 and single bathe...... lubrication with PULS. The new test is so severe, that it is possible to break down the best lubrication systems for cold forging, such as phosphate coating plus soap and MoS2....

  5. THE FORMING OF MAGNESIUM ALLOY FORGINGS FOR AIRCRAFT AND AUTOMOTIVE APPLICATIONS

    Directory of Open Access Journals (Sweden)

    Anna Dziubińska

    2016-09-01

    Full Text Available The paper presents the theoretical and technological aspects of forming magnesium alloy parts for aircraft and automotive applications. The main applications of magnesium alloys in the aircraft and automotive industries are discussed. In addition, the forging technology for magnesium alloys is generally described, with a particular emphasis on wrought alloys. A brief outline of the state of the art in the forging of magnesium alloys is given based on a survey of the specialist literature and the results of previous research by the authors.

  6. Adapted diffusion processes for effective forging dies

    Science.gov (United States)

    Paschke, H.; Nienhaus, A.; Brunotte, K.; Petersen, T.; Siegmund, M.; Lippold, L.; Weber, M.; Mejauschek, M.; Landgraf, P.; Braeuer, G.; Behrens, B.-A.; Lampke, T.

    2018-05-01

    Hot forging is an effective production method producing safety relevant parts with excellent mechanical properties. The economic efficiency directly depends on the occurring wear of the tools, which limits service lifetime. Several approaches of the presenting research group aim at minimizing the wear caused by interacting mechanical and thermal loads by using enhanced nitriding technology. Thus, by modifying the surface zone layer it is possible to create a resistance against thermal softening provoking plastic deformation and pronounced abrasive wear. As a disadvantage, intensely nitrided surfaces may possibly include the risk of increased crack sensitivity and therefore feature the chipping of material at the treated surface. Recent projects (evaluated in several industrial applications) show the high technological potential of adapted treatments: A first approach evaluated localized treatments by preventing areas from nitrogen diffusion with applied pastes or other coverages. Now, further ideas are to use this principle to structure the surface with differently designed patterns generating smaller ductile zones beneath nitrided ones. The selection of suitable designs is subject to certain geo-metrical requirements though. The intention of this approach is to prevent the formation and propagation of cracks under thermal shock conditions. Analytical characterization methods for crack sensitivity of surface zone layers and an accurate system of testing rigs for thermal shock conditions verified the treatment concepts. Additionally, serial forging tests using adapted testing geometries and finally, tests in the industrial production field were performed. Besides stabilizing the service lifetime and decreasing specific wear mechanisms caused by thermal influences, the crack behavior was influenced positively. This leads to a higher efficiency of the industrial production process and enables higher output in forging campaigns of industrial partners.

  7. Manufacturing and material properties of forgings for reactor pressure vessel of high temperature engineering test reactor

    International Nuclear Information System (INIS)

    Sato, I.; Suzuki, K.

    1994-01-01

    For the reactor pressure vessel (RPV) of high temperature engineering test reactor (HTTR) which has been developed by Japan Atomic Energy Research Institute (JAERI), 2 1/4Cr-1Mo steel is used first in the world. Material confirmation test has been carried out to demonstrate good applicability of forged low Si 2 1/4Cr-1Mo steel to the RPV of HTTR. Recently, JSW has succeeded in the manufacturing of large size ring forgings and large size forged cover dome integrated with nozzles for stand pipe for the RPV. This paper describes the results of the material confirmation test as well as the manufacturing and material properties of the large forged cover dome integrated with nozzles for stand pipe. (orig.)

  8. Electro sinter forging of titanium disks

    DEFF Research Database (Denmark)

    Cannella, Emanuele; Nielsen, Chris Valentin; Bay, Niels Oluf

    by measuring the electrical resistance during the sintering process [5], since low electrical resistance corresponds to high density. It is, however, necessary to be aware that increased temperature, on the other hand, increases the resistance. SEM micrographs and Computed Tomography (CT) are carried out......Electro sinter forging (ESF) is a new sintering process based on the principle of electrical Joule heating. In the present work, middle frequency direct current (MFDC) was flowing through the powder compact, which was under mechanical pressure. The main parameters are the high electrical current......, up to 10 kA, and the low voltage, 1-2 V, resulting in heat generation in the powder. Figure 1 shows the experimental setup. The punches were made of a conductive material; namely a copper alloy. The die, which has to be electrically insulating, was made of alumina. The ESF process takes 3-4s...

  9. Forging a unique nursing partnership with China.

    Science.gov (United States)

    Munn, Flavia

    2017-07-12

    When members of a London nursing faculty forged a learning partnership with a Chinese counterpart they likely did not expect to be discussing the benefits of using Florence Nightingale lamps to decorate hospital walls. But there is nothing ordinary about the collaboration between King's College London and Nanjing Health School.

  10. Ferromagnetic resonance studies on (Co40Fe40B20)x(SiO2)1-x granular magnetic films

    International Nuclear Information System (INIS)

    Yildiz, F.; Kazan, S.; Aktas, B.; Tarapov, S.I.; Tagirov, L.; Granovsky, B.

    2006-01-01

    Magnetic properties of granular (Co 40 Fe 40 B 20 ) x (SiO 2 ) 1-x thin films (x=0.37-0.53) have been studied by ferromagnetic resonance (FMR) technique. Samples have been prepared by ion-beam deposition of Co-Fe-B particles and SiO 2 on sitall ceramic substrate. The FMR measurements have been done for different orientations of DC magnetic field with respect to the sample plane. It was found that the deduced value of effective magnetization from FMR data of the thin granular film is reduced by the volume-filling factor of the bulk saturation magnetization. The overall magnetization changes from 152 to 515G depending on the ratio of the magnetic nanoparticles in the SiO 2 matrix. From angular measurements an induced in-plane uniaxial anisotropy has been obtained due to the preparation of the film conditions as well

  11. Modelling of Damage During Hot Forging of Ingots

    DEFF Research Database (Denmark)

    Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

    2013-01-01

    Ductile damage modelling in the ingot forging process is discussed. Advantages and disadvantages of both coupled and uncoupled ductile damage models are presented. Some uncoupled damage models are examined in greater detail regarding their applicability to different processes, where hydrostatic...

  12. Forged hollows (alloy 617) for PNP-hot gas collectors

    International Nuclear Information System (INIS)

    Hofmann, F.

    1984-01-01

    When the partners in the PNP-Project decided to manufacture components, such as gas collectors, from material of type alloy 617, the problem arose that required semi-fabricated products, especially forged hollows weighing several tons each, were not available. As VDM (Vereinigte Deutsche Metallwerke AG) had already experience in production of other semi-fabricated products of this alloy, attempts were made based on this knowledge, to develop manufacturing methods for forged hollows. The aim was to produce hollows as long as possible, and to keep the welding cost minimum. Welded seams are always critical during fabrication, as well as during later inspection under actual operating conditions. The three stage plan used to perform the above task illustrates the development aims is described

  13. Production of a 304 stainless steel nuclear reactor forging from a very large electroslag refined ingot

    International Nuclear Information System (INIS)

    Watkins, E.J.; Tihansky, E.L.

    1986-01-01

    A four-loop, upper barrel flange forging for a nuclear reactor was produced from what the authors believe to be the largest 304H grade stainless steel electroslag refined (ESR) ingot ever refined. The ingot was refined in a 1524-mm-diameter, ingot withdrawal-type ESR furnace using a lime-bearing slag, low-frequency a-c power, and dry air protection. Five electrodes were remelted in order to produce the desired ingot weight. The ingot was subsequently forged in a five-step operation on a 6800-metric-ton press to produce the desired barrel flange configuration. Testing of the finished machined forging revealed excellent tensile ductility, excellent ultrasonic penetrability, and good chemical uniformity with no macrosegregation. Overall quality was judged to be superior to previously produced, conventionally melted forgings

  14. (Bi, Pb).sub.2, Sr.sub.2 Ca.sub.2 Cu.sub.3 O.sub.x superconductor and method of making same utilizing sinter-forging

    Science.gov (United States)

    Chen, Nan; Goretta, Kenneth C.; Lanagan, Michael T.

    1998-01-01

    A (BiPb).sub.2 Sr.sub.2 Ca.sub.2 Cu.sub.3 O.sub.x (Bi223) superconductor with high J.sub.c, phase purity, density and mechanical strength is formed from Bi2223 powder which is synthesized from a mixture of Bi.sub.2 O.sub.3, PbO, SrCO.sub.3, CaCo.sub.3 and CuO. The mixture is milled, then dried and calcined to synthesize the Bi2223 powder with the desired phase purity. The calcination is performed by heating the dried mixture for 50 hours at 840.degree. C. The partially synthesized powder is then milled for 1-4 hours before calcining further for another 50 hours at 855.degree. C. to complete the synthesis. After calcination, the Bi2223 powder is cold pressed to a predetermined density and sinter forged under controlled temperature and time to form a Bi2223 superconductor with the desired superconducting properties.

  15. (Bi, Pb){sub 2}Sr{sub 2}Ca{sub 2}Cu{sub 3}O{sub x} superconductor and method of making same utilizing sinter-forging

    Science.gov (United States)

    Chen, N.; Goretta, K.C.; Lanagan, M.T.

    1998-10-13

    A (BiPb){sub 2}Sr{sub 2}Ca{sub 2}Cu{sub 3}O{sub x}(Bi223) superconductor with high J{sub c}, phase purity, density and mechanical strength is formed from Bi2223 powder which is synthesized from a mixture of Bi{sub 2}O{sub 3}, PbO, SrCO{sub 3}, CaCo{sub 3} and CuO. The mixture is milled, then dried and calcined to synthesize the Bi2223 powder with the desired phase purity. The calcination is performed by heating the dried mixture for 50 hours at 840 C. The partially synthesized powder is then milled for 1--4 hours before calcining further for another 50 hours at 855 C to complete the synthesis. After calcination, the Bi2223 powder is cold pressed to a predetermined density and sinter forged under controlled temperature and time to form a Bi2223 superconductor with the desired superconducting properties. 5 figs.

  16. Forging Oxide-Dispersion-Strengthened Superalloys

    Science.gov (United States)

    Harf, F. H.; Glasgow, T. K.; Moracz, D. J.; Austin, C. M.

    1986-01-01

    Cladding of mild steel prevents surface cracking when alloy contacts die. Continual need for improvements in properties of alloys capable of withstanding elevated temperatures. Accomplished by using oxide-dispersion-strengthed superalloys such as Inconel Alloy MA 6000. Elevated tensile properties of forged alloy equal those of hot-rolled MA 6000 bar. Stress-rupture properties somewhat lower than those of bar stock but, at 1,100 degrees C, exceed those of strongest commercial single crystal, directionally solidified and conventionally cast superalloys.

  17. Highlight: Forging the new Indonesia-Canada partnership | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    15 avr. 2016 ... Canada's Centre for International Governance Innovation and Indonesia's Centre for Strategic and International Studies organized the Indonesia-Canada Bilateral Forum, Innovation and Change: Forging the New Indonesia-Canada Partnership. IDRC co-sponsored the meeting, held May 26-27, 2015.

  18. Manufacturing involving forging of multiple objects in contact

    DEFF Research Database (Denmark)

    Nielsen, Chris Valentin; Zhang, W.; Martins, P.A.F.

    and dissimilar materials. While being plastically deformed against each other under increasing forging load, the parts dynamically develop their mutual contact interfaces. Comparisons of the final geometry as well as force-displacement curves are evaluated. The potential of simulated applications are discussed...

  19. Acoustical enrichment during early postnatal development changes response properties of inferior colliculus neurons in rats

    Czech Academy of Sciences Publication Activity Database

    Bureš, Zbyněk; Bartošová, Jolana; Lindovský, Jiří; Chumak, Tetyana; Popelář, Jiří; Syka, Josef

    2014-01-01

    Roč. 40, č. 11 (2014), s. 3674-3683 ISSN 0953-816X R&D Projects: GA ČR(CZ) GAP303/12/1347; GA ČR(CZ) GBP304/12/G069; GA MŠk EE2.3.30.0018 Institutional support: RVO:68378041 Keywords : attention-dependent plasticity * auditory system * critical period Subject RIV: FH - Neurology Impact factor: 3.181, year: 2014

  20. 8x40 Gb/s RZ all-optical broadcasting utilizing an electroabsorption modulator

    DEFF Research Database (Denmark)

    Xu, Lin; Chi, Nan; Yvind, Kresten

    2004-01-01

    We experimentally demonstrate all-optical broadcasting through simultaneous 8 × 40 Gb/s wavelength conversion in the RZ format based on cross absorption modulation in an electroabsorption modulator. The original intensity-modulated information is successfully duplicated onto eight wavelengths...

  1. Friction and wear in hot forging of steels

    International Nuclear Information System (INIS)

    Daouben, E.; Dubar, L.; Dubar, M.; Deltombe, R.; Dubois, A.; Truong-Dinh, N.; Lazzarotto, L.

    2007-01-01

    In the field of hot forging of steels, the mastering of wear phenomena enables to save cost production, especially concerning tools. Surfaces of tools are protected thanks to graphite. The existing lubrication processes are not very well known: amount and quality of lubricant, lubrication techniques have to be strongly optimized to delay wear phenomena occurrence. This optimization is linked with hot forging processes, the lubricant layers must be tested according to representative friction conditions. This paper presents the first part of a global study focused on wear phenomena encountered in hot forging of steels. The goal is the identification of reliable parameters, in order to bring knowledge and models of wear. A prototype testing stand developed in the authors' laboratory is involved in this experimental analysis. This test is called Warm and Hot Upsetting Sliding Test (WHUST). The stand is composed of a heating induction system and a servo-hydraulic system. Workpieces taken from production can be heated until 1200 deg. C. A nitrided contactor representing the tool is heated at 200 deg. C. The contactor is then coated with graphite and rubs against the workpiece, leaving a residual track on it. Friction coefficient and surface parameters on the contactor and the workpiece are the most representative test results. The surface parameters are mainly the sliding length before defects occurrence, and the amplitude of surface profile of the contactor. The developed methodology will be first presented followed by the different parts of the experimental prototype. The results of experiment show clearly different levels of performance according to different lubricants

  2. Superplastic forging nitride ceramics

    Science.gov (United States)

    Panda, P.C.; Seydel, E.R.; Raj, R.

    1988-03-22

    A process is disclosed for preparing silicon nitride ceramic parts which are relatively flaw free and which need little or no machining, said process comprising the steps of: (a) preparing a starting powder by wet or dry mixing ingredients comprising by weight from about 70% to about 99% silicon nitride, from about 1% to about 30% of liquid phase forming additive and from 1% to about 7% free silicon; (b) cold pressing to obtain a preform of green density ranging from about 30% to about 75% of theoretical density; (c) sintering at atmospheric pressure in a nitrogen atmosphere at a temperature ranging from about 1,400 C to about 2,200 C to obtain a density which ranges from about 50% to about 100% of theoretical density and which is higher than said preform green density, and (d) press forging workpiece resulting from step (c) by isothermally uniaxially pressing said workpiece in an open die without initial contact between said workpiece and die wall perpendicular to the direction of pressing and so that pressed workpiece does not contact die wall perpendicular to the direction of pressing, to substantially final shape in a nitrogen atmosphere utilizing a temperature within the range of from about 1,400 C to essentially 1,750 C and strain rate within the range of about 10[sup [minus]7] to about 10[sup [minus]1] seconds[sup [minus]1], the temperature and strain rate being such that surface cracks do not occur, said pressing being carried out to obtain a shear deformation greater than 30% whereby superplastic forging is effected.

  3. Targeted ultradeep next-generation sequencing as a method for KIT D816V mutation analysis in mastocytosis

    DEFF Research Database (Denmark)

    Kielsgaard Kristensen, Thomas; Broesby-Olsen, Sigurd; Vestergaard, Hanne

    2016-01-01

    mutation levels. In this study, we established an NGS-based KIT mutation analysis and analyzed the sensitivity of D816V detection using the Ion Torrent platform. Eighty-two individual NGS analyses were included in the study. All samples were also analyzed using highly sensitive KIT D816V mutation...

  4. Production of A356 aluminum alloy wheels by thixo-forging combined with a low superheat casting process

    Directory of Open Access Journals (Sweden)

    Wang Shuncheng

    2013-09-01

    Full Text Available The A356 aluminum alloy wheels were produced by thixo-forging combined with a low superheat casting process. The as-cast microstructure, microstructure evolution during reheating and the mechanical properties of thixo-forged wheels made from the A356 aluminum alloy were studied. The results show that the A356 aluminum alloy round billet with fine, uniform and non-dendritic grains can be obtained when the melt is cast at 635 篊. When the round billet is reheated at 600 篊 for 60 min, the non-dendritic grains are changed into spherical ones and the round billet can be easily thixo-forged into wheels. The tensile strength, yield strength and elongation of the thixo-forged wheels with T6 heat treatment are 327.6 MPa, 228.3 MPa and 7.8%, respectively, which are higher than those of a cast wheel. It is suggested that the thixo-forging combined with the low superheat casting process is an effective technique to produce aluminum alloy wheels with high mechanical properties.

  5. strength and ductility of forged 1200 aluminum alloy reinforced

    African Journals Online (AJOL)

    eobe

    duced cylindrical shape samples, which were homogenized at 420 ... and properties of deformed materials depend on other factors ... after the surfaces were ground with emery paper of ... Figure 2: Maximum elongation of forged and annealed.

  6. Current steel forgings and their properties for steam generator of nuclear power plant

    Energy Technology Data Exchange (ETDEWEB)

    Sasaki, Tomoharu; Murai, Etsuo; Sato, Ikuo [Japan Steel Works Ltd., Muroran, Hokkaido (Japan). Muroran Plant; Suzuki, Kimiaki; Kusuhashi, Mikio; Tsukada, Hisashi [Japan Steel Works Ltd., Tokyo (Japan)

    2001-06-01

    On the steel forging (SF) elements for steam generator (SG) of the pressurized water type light water reactor (PWR), from a viewpoint of upgrading in their improvements of design and materials, here were described on three materials such as integrated steel forgings, high strength steel forgings, and vacuum carbon deoxidisation (VCD) steel forgings. On production of SG, by using the integrated SF, not only structural soundness of SG is upgraded, but also inspections containing inspections under production and usage become easier, to bring minimization of maintenance inspection and reduction of exposure under operation. And, in order to reduce weight of SG and upgrade seismic resistance, SA508, a Cl.3a high strength SF (620 MPa class in tensile strength) is used for some nuclear plants. Here were introduced material properties of this SF and described its chemical components and heat treatment condition. And, as a method to reduce macro- and micro-segregation of materials and to upgrade homogeneity of material property, a method combined deoxidisation of steel due to carbon monoxide reaction with crystal grain minimization due to addition of aluminum was investigated. In addition, properties of a low Si-SA508 Cl.3 steel using this method was compared with that of usual SA508 Cl.3 steel. (G.K.)

  7. Qualitative Research of AZ31 Magnesium Alloy Aircraft Brackets Produced by a New Forging Method

    Directory of Open Access Journals (Sweden)

    Dziubińska A.

    2016-06-01

    Full Text Available The paper reports a selection of numerical and experimental results of a new closed-die forging method for producing AZ31 magnesium alloy aircraft brackets with one rib. The numerical modelling of the new forming process was performed by the finite element method.The distributions of stresses, strains, temperature and forces were examined. The numerical results confirmed that the forgings produced by the new forming method are correct. For this reason, the new forming process was verified experimentally. The experimental results showed good agreement with the numerical results. The produced forgings of AZ31 magnesium alloy aircraft brackets with one rib were then subjected to qualitative tests.

  8. Evaluation of intergranular corrosion rate and microstructure of forged 316L round bar

    International Nuclear Information System (INIS)

    Lim, H. K.; Kim, Y. S.

    2009-01-01

    When austenitic stainless steels are heat treated in the range of 500∼850 .deg. C, the alloys are sensitized due to the formation of chromium carbide at grain boundaries and then intergranular corrosion occurs. This paper aims to evaluate the intergranular corrosion rate and microstructural change of forged 316L stainless steel. To analyze the microstructure by forging conditions, ferrite phase, sigma phase, intergranular precipitation were observed. In order to evaluate the intergranular corrosion rate. Huey test was performed by ASTM A262. On the base of microstructural observation, ferrite and sigma phases were not detected, and also intergranular precipitation was not revealed in optical microscopic observation. By ASTM A262 Practice A, step structure was shown in all forging conditions. Intergranular corrosion rate gradually increased by Huey test periods but average corrosion rate was under 0.03 mm/month

  9. Evaluation of intergranular corrosion rate and microstructure of forged 316L round bar

    Energy Technology Data Exchange (ETDEWEB)

    Lim, H. K.; Kim, Y. S. [Andong National University, Andong (Korea, Republic of)

    2009-12-15

    When austenitic stainless steels are heat treated in the range of 500{approx}850 .deg. C, the alloys are sensitized due to the formation of chromium carbide at grain boundaries and then intergranular corrosion occurs. This paper aims to evaluate the intergranular corrosion rate and microstructural change of forged 316L stainless steel. To analyze the microstructure by forging conditions, ferrite phase, sigma phase, intergranular precipitation were observed. In order to evaluate the intergranular corrosion rate. Huey test was performed by ASTM A262. On the base of microstructural observation, ferrite and sigma phases were not detected, and also intergranular precipitation was not revealed in optical microscopic observation. By ASTM A262 Practice A, step structure was shown in all forging conditions. Intergranular corrosion rate gradually increased by Huey test periods but average corrosion rate was under 0.03 mm/month.

  10. Numerical simulation of the dynamic recrystallization behaviour in hot precision forging helical gears

    Directory of Open Access Journals (Sweden)

    Feng Wei

    2015-01-01

    Full Text Available In hot precision forging helical gears, the dynamic recrystallization phenomena will occur, which affect the microstructure of the formed part and in turn decide their mechanical properties. To investigate the effect of deformation temperature on the dynamic recrystallization in hot precision forging helical gears, a three dimensional (3D finite element (FE model was created by coupling the thermo-mechanical model with the microstructure evolution model developed based on the hot compressive experimental data of 20CrMnTiH steel. The hot precision forging process was simulated and the effect laws of the deformation temperature on the microstructure evolution the formed part were investigated. The results show that the dynamic recrystallization volume fraction and the average grain sizes increased with the increasing deformation temperature and the higher deformation temperature is beneficial to dynamic recrystallization and grain refinement.

  11. The effects of composition and thermal path on hot ductility of forging steels

    Science.gov (United States)

    Connolly, Brendan M.

    This work examines the effects of composition and thermal path on the hot ductility of several forging steels with varied aluminum and nitrogen content. The primary mechanisms and controlling factors related to hot ductility are identified with a focus on the role of precipitates and segregation. The unique thermal paths and solidification structures of large cross-section forging ingots are discussed. Hot ductility testing is performed in a manner that approximates industrial conditions experienced by large cross-section forging ingots. A computer model for precipitation of aluminum nitride and vanadium nitride in austenite is presented. Industrial material is examined for comparison to experimental findings. It is found that increased aluminum and nitrogen content coarsens the as-solidified structure. The combined effects of microsegregation and uphill diffusion during deformation allow for carbide precipitation at prior austenite grain boundaries which reduces the hot ductility.

  12. Daily Magnetograms for 1978 from the AFGL (Air Force Geophysics Laboratory) Network.

    Science.gov (United States)

    1985-01-08

    rj4TE Y rCCE#i~nT * 9 vEflEL(6-1"i( LI"ISI( td HEUs 813 7..8... ... .... M 5 3 ... . .. .. .... .. . .. ... .. .. ... .... .. .. .. . .. .. I?’ a 7...Y LS 7 .. .. . .. . . . .. . . . . . . . . .. . - ’ - S U E . . ... . . . .. . . . .. . . . . . . .. . .. . . 534S 4349QO L.~ El jIjI -2 td [w1.2...8M) iHQ ’~LTP FLMAfEOEO EUR FLUNG.ATE X CLVRC8ET 40 HIfMO1SLAM’TVUOR DIVISION 18S33 172707 81%6 TPA 2595 .’g 977 FL-ttTY-C4FLVA()T 40 tbMTES-LAS#1’VUOR

  13. Determination of D816V mutation in the c-kIt gene in the Slovenian patients with acute myeloid leukemia and systemic mastocytosis

    Directory of Open Access Journals (Sweden)

    Martina Fink

    2012-12-01

    Full Text Available Background: D816V mutation in the C-KIT gene is present in more than 90 % of patients with systemic mastocytosis (SM and 2–7 % of patients with acute myeloid leukemia (AML. D816V mutation is caused by the substitution of adenine with thymine at 2447 nucleotide sequence in the C-KIT gene. This nucleotide substitution causes the replacment of aspartate acid by valine at codon 816 of the KIT protein. KIT protein with D816V mutation acts as constitutively active tyrosine kinase that promotes cell proliferation and inhibits apoptosis. The purpose of our study was to determine the incidence of D816V mutation in the C-KIT gene in Slovenian patients with AML and in patients with suspected systemic mastocytosis. Patients and methods: In the retrospective study, 71 patients with AML and 25 patients with suspected systemic mastocytosis were included. D816V mutation in the C-KIT gene was determined by polymerase chain reaction (PCR and the resulting PCR products were analyzed by agarose gel electrophoresis. Results: D816V mutation in KIT protein was determined in 7 % of patients with AML and in 32 % patients with suspected systemic mastocytosis. Conclusions: Identification of D816V mutation in the C-KIT gene must always be performed in patients with suspected systemic mastocytosis. The determination of this mutation contributes to the diagnosis and treatment selection. The finding of D816V mutation in the C-KIT gene in patients with AML and concomitant genetic modifications RUNX-RUNX1T1 (typical translocation t(8; 21 (q22, q22 or CBFB-MYH11, which is the result of inversion on chromosome 16–(inv (16 (p13, q22, however, indicates a faster, more aggressive course of the disease and predicts a worse outcome. The finding of the mutation in other patients with AML may indicate the presence of concomitant AML and SM, which was not found in our patients.

  14. Ultrasonic phased arrays for nondestructive inspection of forgings

    International Nuclear Information System (INIS)

    Wuestenberg, H.; Rotter, B.; Klanke, H.P.; Harbecke, D.

    1993-01-01

    Ultrasonic examinations on large forgings like rotor shafts for turbines or components for nuclear reactors are carried out at various manufacturing stages and during in-service inspections. During the manufacture, most of the inspections are carried out manually. Special in-service conditions, such as those at nuclear pressure vessels, have resulted in the development of mechanized scanning equipment. Ultrasonic probes have improved, and well-adapted sound fields and pulse shapes and based on special imaging procedures for the representation of the reportable reflectors have been applied. Since the geometry of many forgings requires the use of a multitude of angles for the inspections in-service and during manufacture, phased-array probes can be used successfully. The main advantages of the phased-array concept, e.g. the generation of a multitude of angles with the typical increase of redundancy in detection and quantitative evaluation and the possibility to produce pictures of defect situations, will be described in this contribution

  15. 30 CFR 816.15 - Casing and sealing of drilled holes: Permanent.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: Permanent...-SURFACE MINING ACTIVITIES § 816.15 Casing and sealing of drilled holes: Permanent. When no longer needed... exploration hole, other drilled hole or borehole, well, and other exposed underground opening shall be capped...

  16. 30 CFR 816.73 - Disposal of excess spoil: Durable rock fills.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Disposal of excess spoil: Durable rock fills...-SURFACE MINING ACTIVITIES § 816.73 Disposal of excess spoil: Durable rock fills. The regulatory authority may approve the alternative method of disposal of excess durable rock spoil by gravity placement in...

  17. Numerical modeling of axi-symmetrical cold forging process by ``Pseudo Inverse Approach''

    Science.gov (United States)

    Halouani, A.; Li, Y. M.; Abbes, B.; Guo, Y. Q.

    2011-05-01

    The incremental approach is widely used for the forging process modeling, it gives good strain and stress estimation, but it is time consuming. A fast Inverse Approach (IA) has been developed for the axi-symmetric cold forging modeling [1-2]. This approach exploits maximum the knowledge of the final part's shape and the assumptions of proportional loading and simplified tool actions make the IA simulation very fast. The IA is proved very useful for the tool design and optimization because of its rapidity and good strain estimation. However, the assumptions mentioned above cannot provide good stress estimation because of neglecting the loading history. A new approach called "Pseudo Inverse Approach" (PIA) was proposed by Batoz, Guo et al.. [3] for the sheet forming modeling, which keeps the IA's advantages but gives good stress estimation by taking into consideration the loading history. Our aim is to adapt the PIA for the cold forging modeling in this paper. The main developments in PIA are resumed as follows: A few intermediate configurations are generated for the given tools' positions to consider the deformation history; the strain increment is calculated by the inverse method between the previous and actual configurations. An incremental algorithm of the plastic integration is used in PIA instead of the total constitutive law used in the IA. An example is used to show the effectiveness and limitations of the PIA for the cold forging process modeling.

  18. Investigation of multifunctional properties of Mn{sub 50}Ni{sub 40x}Co{sub x}Sn{sub 10} (x = 0–6) Heusler alloys

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, Jyoti; Suresh, K.G., E-mail: suresh@phy.iitb.ac.in

    2015-01-25

    Highlights: • Mn{sub 50}Ni{sub 40x}Co{sub x}Sn{sub 10} Heusler alloys exhibit multifunctional properties. • Co doping results decrease in martensitic transition temperature and increase in T{sub C}{sup A}. • Ferromagnetic coupling increases with increase in Co concentration. • Large positive ΔS{sub M} of 10.5 J/kg K and large RCP of 125 J/kg was obtained for x = 1. • Large exchange bias field of 833 Oe was observed for Mn{sub 50}Ni{sub 39}Co{sub 1}Sn{sub 10} alloy. - Abstract: A series of Co doped Mn{sub 50}Ni{sub 40x}Co{sub x}Sn{sub 10} (x = 0, 1, 2, 2.5, 3, 4 and 6) Heusler alloys has been investigated for their structural, magnetic, magnetocaloric and exchange bias properties. The martensitic transition temperatures are found to decrease with the increase in Co concentration due to the decrease in valence electron concentration (e/a ratio). The Curie temperature of austenite phase increases significantly with increasing Co concentration. A large positive magnetic entropy change (ΔS{sub M}) of 8.6 and 10.5 J/kg K, for a magnetic field change of 50 kOe is observed for x = 0 and 1 alloys, and ΔS{sub M} values decreases for higher Co concentrations. The relative cooling power shows a monotonic increase with the increase in Co concentration. Large exchange bias fields of 920 Oe and 833 Oe have been observed in the alloys with compositions x = 0 and 1, after field cooling in presence of 10 kOe. The unidirectional anisotropy arising at the interface between the frustrated and ferromagnetic phases is responsible for the large exchange bias observed in these alloys. With increase in Co, the magnetically frustrated phase diminishes in strength, giving rise to a decrease in the exchange bias effect for larger Co concentration. The exchange bias fields observed for compositions x = 0 and 1, in the present case are larger than that reported for Co doped Ni–Mn–Z (Z = Sn, Sb, and Ga) alloys. Temperature and cooling field dependence of the exchange bias

  19. The Investigations of Friction under Die Surface Vibration in Cold Forging Process

    DEFF Research Database (Denmark)

    Jinming, Sha

    investigation, and the second stage is to design and manufacture a more practical tool system which can be used to forging some industrial components with larger capacity. The high performance and power piezoelectric actuator stack as the vibration source will be used for designing the vibration system in order...... to 50% with vibration being applied in forming process. Furthermore, by using finite element method, a series of the simulations of the cold forging process under die surface excitation have been implemented in order to further understand the influence of vibration on friction, especially the influence...

  20. Performance Assessment Method for a Forged Fingerprint Detection Algorithm

    Science.gov (United States)

    Shin, Yong Nyuo; Jun, In-Kyung; Kim, Hyun; Shin, Woochang

    The threat of invasion of privacy and of the illegal appropriation of information both increase with the expansion of the biometrics service environment to open systems. However, while certificates or smart cards can easily be cancelled and reissued if found to be missing, there is no way to recover the unique biometric information of an individual following a security breach. With the recognition that this threat factor may disrupt the large-scale civil service operations approaching implementation, such as electronic ID cards and e-Government systems, many agencies and vendors around the world continue to develop forged fingerprint detection technology, but no objective performance assessment method has, to date, been reported. Therefore, in this paper, we propose a methodology designed to evaluate the objective performance of the forged fingerprint detection technology that is currently attracting a great deal of attention.

  1. Plane strain forging of a niobium micro-alloyed steel

    International Nuclear Information System (INIS)

    Balancin, O.; Ferran L, G.; Rio de Janeiro Univ.

    1984-01-01

    Various termomechanical treatments were carried out on a niobium micro-alloyed steel and a low carbon steel as reference material, using an apparatus for hot phane strain forging. Control of processing variables and the presence of niobium strongly modify the austenite microstructure, which upon decomposition produces various phases such as polygonal and acicular ferrite and martensite, alone or together in variable proportions. Corresponding to this diversity of structures there is a wide variation in mechanical properties at room temperature: the initial yield point varies from 310 to 650 MPa and the reduction of area in uniaxial tension from 82 to 57% for the niobium steel. These results show that hot forging a niobium micro-alloyed steel may be a suitable manufacturing process for satisfying a wide range of specifications in a final product with low equivalent carbon. (Author) [pt

  2. Design of a forging processing route for a gas turbine compressor disc in IMI 834

    International Nuclear Information System (INIS)

    Clark, G.S.

    1993-01-01

    The microstructure in all parts of a modern gas turbine compressor disc must be carefully controlled to give the optimum balance for resistance to creep and fatigue. This is particularly true for advanced titanium alloys such as IMI834. Dynamic recrystallisation during high temperature deformation and static recrystallisation and grain growth during heat treatment, all have a profound effect on the grain structure of the disc. These processes are affected by temperature, rate of deformation and various microstructural features. These may include the size and volume fraction of primary alpha particles and current beta grain size. The construction of a computer model to simulate the forging process must therefore take all these factors into account to fully simulate the mechanical and microstructural behaviour of the material during processing. This requires a complete characterisation of the material to formulate mechanical and microstructural constitutive equations for use in a visco-plastic finite element forging model. Similarly the forging equipment must be fully characterised so that forging processes can be accurately simulated. (orig.)

  3. Near-liquidus forging, partial remelting and thixoforging of an AZ91D + Y magnesium alloy

    International Nuclear Information System (INIS)

    Zhao Zude; Chen Qiang; Hu Chuankai; Huang Shuhai; Wang Yuanqing

    2009-01-01

    A new route, near-liquidus forging plus partial remelting, has been developed for obtaining globular microstructures. Firstly, a material is formed by near-liquidus forging for obtaining a fine dendritic microstructure. Globular microstructure can be produced by reheating the material into the semi-solid temperature range for a period of time. In this paper, an AZ91D alloy with the addition of yttrium was prepared by near-liquidus forging. Microstructure evolution during partial remelting was studied at temperatures and for times. Tensile mechanical properties of thixoforged components were also determined. It is shown that the fine dendritic structure firstly evolves into a blocky structure during partial remelting. With prolonged holding time, the blocky structure disintegrates into polygonal solid particles. Prolonging time and increasing temperature promote a faster spheroidization. Good mechanical properties are obtained for the thixoforged AZ91D alloy with the addition of yttrium prepared by near-liquidus forging, with a yield strength of 160.9 MPa and a ultimate tensile strength of 301.7 MPa and a elongation to fracture of 9.734%.

  4. Current forgings and their properties for steam generator of nuclear plant

    International Nuclear Information System (INIS)

    Tsukada, Hisashi; Suzuki, Komei; Kusuhashi, Mikio; Sato, Ikuo

    1997-01-01

    Current steel forgings for steam generator (SG) of PWR plant are reviewed in the aspect of design and material improvement. The following three items are introduced. The use of integral type steel forgings for the fabrication of steam generator enhances the structural integrity and makes easier fabrication and inspection including in-service inspection. The following examples of current integral type forgings developed by the Japan Steel Works, Ltd. (JSW) are introduced: (1) primary head integrated with nozzles, manways and supports; (2) steam drum head integrated with nozzle and handhole; (3) conical shell integrated with cylindrical sections and handholes. In order to decrease the weight of steam generator, the high strength materials such as SA508, Cl.3a steel have been adopted in some cases. The properties of this steel are introduced and the chemistry and heat treatment condition are discussed. As one of the methods to minimize the macro- and micro-segregations, the use of vacuum carbon deoxidation (VCD), i.e. deoxidization of steel by gaseous CO reaction, with addition of Al for grain refining was investigated. The properties of SA508, Cl.3 steels with Low Si content are compared with those of conventional one

  5. Current forgings and their properties for steam generator of nuclear plant

    Energy Technology Data Exchange (ETDEWEB)

    Tsukada, Hisashi; Suzuki, Komei; Kusuhashi, Mikio; Sato, Ikuo [Japan Steel Works Ltd., Muroran (Japan)

    1997-12-31

    Current steel forgings for steam generator (SG) of PWR plant are reviewed in the aspect of design and material improvement. The following three items are introduced. The use of integral type steel forgings for the fabrication of steam generator enhances the structural integrity and makes easier fabrication and inspection including in-service inspection. The following examples of current integral type forgings developed by the Japan Steel Works, Ltd. (JSW) are introduced: (1) primary head integrated with nozzles, manways and supports; (2) steam drum head integrated with nozzle and handhole; (3) conical shell integrated with cylindrical sections and handholes. In order to decrease the weight of steam generator, the high strength materials such as SA508, Cl.3a steel have been adopted in some cases. The properties of this steel are introduced and the chemistry and heat treatment condition are discussed. As one of the methods to minimize the macro- and micro-segregations, the use of vacuum carbon deoxidation (VCD), i.e. deoxidization of steel by gaseous CO reaction, with addition of Al for grain refining was investigated. The properties of SA508, Cl.3 steels with Low Si content are compared with those of conventional one.

  6. Void consolidation during open-die forging for ultralarge rotor shafts. (1. Formulation of void-closing behavior)

    International Nuclear Information System (INIS)

    Ono, Shin-ichi; Minami, Katsuyuki; Ochiai, Tomoyuki; Iwadate, Tadao; Nakata, Shin-ichi.

    1995-01-01

    Open-die forging experiments using different die geometries under hot isothermal conditions and three-dimensional simulations using rigid-plastic finite-element method were performed to formulate a void-closing behavior using only two factors; the integral of hydrostatic stress and the equivalent strain. First, upsetting, side-upsetting and V-shape die cogging of several cylinders with a spherical void at the center are carried out and the information on the void volume reduction is obtained. Seconds, the same forgings, but without voids is treated numerically and the development of stress and strain at the location of voids is investigated. Then, by combining these results, and using regression analysis, it is found that the void volume reduction is expressed as a polynomial function of the two factors. When the polynomial function is used, various forging methods can be evaluated quantitatively in terms of void-closing behavior. Therefore it is beneficial to optimize the forging process for a large rotor shaft. (author)

  7. Effect of Forging Parameters on Low Cycle Fatigue Behaviour of Al/Basalt Short Fiber Metal Matrix Composites

    Directory of Open Access Journals (Sweden)

    R. Karthigeyan

    2013-01-01

    Full Text Available This paper deals with metal matrix composites (MMCs of Al 7075 alloy containing different weight percentage (2.5, 5, 7.5, and 10 basalt short fiber reinforcement and unreinforced matrix alloy. The samples were produced by the permanent stir casting technique. The casting ingots were cut into blanks to be forged in single stage and double stage, using MN press and graphite-based lubricant. The microstructures and fatigue properties of the matrix alloy and MMC samples were investigated in the as cast state and in the single and double stage forging operations. The microstructure results showed that the forged sample had a uniform distribution of the basalt short fiber throughout the specimens. Evaluation of the fatigue properties showed that the forged samples had higher values than those of the as cast counterparts. After forging, the enhancement of the fatigue strength of the matrix alloy was so significant and high in the case of 2.5 and 5.0 wt. percentage basalt short fiber reinforced MMC, and there was no enhancement in 7.5 and 10 weight percentages short fiber reinforced MMCs. The fracture damage was mainly due to decohesion at the matrix-fiber interface.

  8. Effect of forging parameters on low cycle fatigue behaviour of Al/basalt short fiber metal matrix composites.

    Science.gov (United States)

    Karthigeyan, R; Ranganath, G

    2013-01-01

    This paper deals with metal matrix composites (MMCs) of Al 7075 alloy containing different weight percentage (2.5, 5, 7.5, and 10) basalt short fiber reinforcement and unreinforced matrix alloy. The samples were produced by the permanent stir casting technique. The casting ingots were cut into blanks to be forged in single stage and double stage, using MN press and graphite-based lubricant. The microstructures and fatigue properties of the matrix alloy and MMC samples were investigated in the as cast state and in the single and double stage forging operations. The microstructure results showed that the forged sample had a uniform distribution of the basalt short fiber throughout the specimens. Evaluation of the fatigue properties showed that the forged samples had higher values than those of the as cast counterparts. After forging, the enhancement of the fatigue strength of the matrix alloy was so significant and high in the case of 2.5 and 5.0 wt. percentage basalt short fiber reinforced MMC, and there was no enhancement in 7.5 and 10 weight percentages short fiber reinforced MMCs. The fracture damage was mainly due to decohesion at the matrix-fiber interface.

  9. Analysis of residual stress in subsurface layers after precision hard machining of forging tools

    Directory of Open Access Journals (Sweden)

    Czan Andrej

    2018-01-01

    Full Text Available This paper is focused on analysis of residual stress of functional surfaces and subsurface layers created by precision technologies of hard machining for progressive constructional materials of forging tools. Methods of experiments are oriented on monitoring of residual stress in surface which is created by hard turning (roughing and finishing operations. Subsequently these surfaces were etched in thin layers by electro-chemical polishing. The residual stress was monitored in each etched layer. The measuring was executed by portable X-ray diffractometer for detection of residual stress and structural phases. The results significantly indicate rise and distribution of residual stress in surface and subsurface layers and their impact on functional properties of surface integrity.

  10. Analytical and experimental evaluation of a proposed self-forging fragment munition

    International Nuclear Information System (INIS)

    Tuft, D.B.; Folsom, E.N.

    1982-01-01

    Analytical and experimental tools have been used to study the formation of a proposed self-forging fragment projectile. The primary objective of this study is the determination of the interior and exterior shape of the fully formed fragment, and to determine if the fragment tumbles in flight. In addition, it is of interest to compare computer predictions to experimental results. An experiment was performed using high speed photography and high-energy flash x-ray radiography to study liner and case motion and projectile formation. Fabrication and assembly tolerances were closely controlled in an effort to eliminate tolerances as a possible source of fragment instability. X-ray film-density contours were analyzed to determine the fully formed fragment interior and exterior shape. Down-range yaw screens showed fragment tumbling in flight. The computed fragment shape was compared to experimental results and it was found that a retaining ring in the computational model near the liner periphery had a significant effect on the final computed fragment shape. With the retaining ring in the computational model and full two-way sliding between all material interfaces, the final computed fragment showed very good agreement with the experiment on both exterior and interior shapes

  11. 76 FR 52313 - Heavy Forged Hand Tools (i.e., Axes & Adzes, Bars & Wedges, Hammers & Sledges, and Picks...

    Science.gov (United States)

    2011-08-22

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-803] Heavy Forged Hand Tools (i.e... Administration, Department of Commerce. SUMMARY: As a result of the determinations by the Department of Commerce... on heavy forged hand tools (i.e., [[Page 52314

  12. Shape optimization of metal forming and forging products using the stress equivalent static loads calculated from a virtual model

    International Nuclear Information System (INIS)

    Jang, Hwan Hak; Jeong, Seong Beom; Park, Gyung Jin

    2012-01-01

    A shape optimization is proposed to obtain the desired final shape of forming and forging products in the manufacturing process. The final shape of a forming product depends on the shape parameters of the initial blank shape. The final shape of a forging product depends on the shape parameters of the billet shape. Shape optimization can be used to determine the shape of the blank and billet to obtain the appropriate final forming and forging products. The equivalent static loads method for non linear static response structural optimization (ESLSO) is used to perform metal forming and forging optimization since nonlinear dynamic analysis is required. Stress equivalent static loads (stress ESLs) are newly defined using a virtual model by redefining the value of the material properties. The examples in this paper show that optimization using the stress ESLs is quite useful and the final shapes of a forming and forging products are identical to the desired shapes

  13. Family Health and Financial Literacy--Forging the Connection

    Science.gov (United States)

    Braun, Bonnie; Kim, Jinhee; Anderson, Elaine A.

    2009-01-01

    Families are at-risk of or experiencing a diminished quality of living and life in current economic times and difficult decisions are required. Health and financial literacy are the basis for wise personal and public decision making. Family and consumer sciences (FCS) professionals can forge connections between health and financial literacy to…

  14. Forge, Arquillian, Swarm and Spring Boot: All play and no effort makes Simon a productive boy

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    During this live coding session, Simon will shine some light on a range productivity tools that make software development a pleasure rather than a chore. Simon will live code 2 applications; a Java EE application, with JBoss Forge which uses JPA, Bean Validation, REST and Angular. We’ll test this application using Arquillian from within JBoss Forge. We’ll also show how a Java EE microservice can be developed in Forge and run using JBoss Swarm. The second application will be developed on Spring Boot and using JRebel we’ll rapidly develop and run a Spring application. Attendees will learn how to write code productively using tools designed for developers.

  15. Phase transition in Smsub(1-x)Gdsub(x)S and Smsub(1-x)Tmsub(x)S solid solutions under pressure

    International Nuclear Information System (INIS)

    Kaminskij, V.V.; Stepanov, N.N.; Romanova, M.V.

    1985-01-01

    Experiments are conducted on studying the effect of the n quantity on Psub(pt) (phase transition pressure) for SmS and systems of solid solutions Smsub(1-x)Gdsub(x)S and Smsub(1-x)Tmsub(x)S with conductivity electron concentrations approximately 10 19 -10 21 cm -3 corresponding to the semiconducting phase of these solutions. The investigated monocrystal samples have been prepared by the method of planar crystallization from the melt, have been chipped off over the cleavage planes [100], their characteristic sizes not exceeding 2 mm. Samples of the Smsub(1-x)Tmsub(x)S system were polycrystalline and they had characteristic dimensions of approximately 3mm. Concentration of conductivity electrons has been determined from measurements of the Hall constant. Hydrostatic compression of the samples has been exercised in a piston high-pressure chamber at T=300 K. The observed electric conductivity jump determined by the standard d.c. compensation technique was a criterion of the presence of the phase transition to the metal state. Dependences of Psub(pt) in SmS base solid solutions with approximately 10 19 -10 21 cm -3 concentration of conductivity electrons have similar tendency in behaviour: a certain increase in the phase transition pressure with n growth and then its drop at n approaching concentrations corresponding to compositions close to critical ones for the semiconductor-metal phase transition in any system of solid solutions. If the first mechanism prevails at small as then further on the second mechanism swelling by a power law with a high index plays the main role

  16. Optimization of the Hot Forging Processing Parameters for Powder Metallurgy Fe-Cu-C Connecting Rods Based on Finite Element Simulation

    Science.gov (United States)

    Li, Fengxian; Yi, Jianhong; Eckert, Jürgen

    2017-12-01

    Powder forged connecting rods have the problem of non-uniform density distributions because of their complex geometric shape. The densification behaviors of powder metallurgy (PM) connecting rod preforms during hot forging processes play a significant role in optimizing the connecting rod quality. The deformation behaviors of a connecting rod preform, a Fe-3Cu-0.5C (wt pct) alloy compacted and sintered by the powder metallurgy route (PM Fe-Cu-C), were investigated using the finite element method, while damage and friction behaviors of the material were considered in the complicated forging process. The calculated results agree well with the experimental results. The relationship between the processing parameters of hot forging and the relative density of the connecting rod was revealed. The results showed that the relative density of the hot forged connecting rod at the central shank changed significantly compared with the relative density at the big end and at the small end. Moreover, the relative density of the connecting rod was sensitive to the processing parameters such as the forging velocity and the initial density of the preform. The optimum forging processing parameters were determined and presented by using an orthogonal design method. This work suggests that the processing parameters can be optimized to prepare a connecting rod with uniform density distribution and can help to better meet the requirements of the connecting rod industry.

  17. Influence of Solution Treatment Temperature on Microstructural Properties of an Industrially Forged UNS S32750/1.4410/F53 Super Duplex Stainless Steel (SDSS Alloy

    Directory of Open Access Journals (Sweden)

    Vasile Dănuț Cojocaru

    2017-06-01

    Full Text Available In this present study, the influence of solution annealing temperature on microstructural properties of a forged Super Duplex Stainless Steel (SDSS was investigated by SEM-BSE (Scanning Electron Microscopy-Backscattered Electrons and SEM-EBSD (Scanning Electron Microscopy-Electron Backscatter Diffraction techniques. A brief solution treatment was applied to the forged super duplex alloy, at different temperatures between 800 °C and 1100 °C, with a constant holding time of 0.6 ks (10 min. Microstructural characteristics such as nature, weight fraction, distribution and morphology of constituent phases, average grain-size and grain misorientation were analysed in relation to the solution annealing temperature. Experimental results have shown that the constituent phases in the SDSS alloy are δ-Fe, γ-Fe and σ (Cr-Fe and that their properties are influenced by the solution treatment temperature. SEM examinations revealed microstructural modifications induced by the Cr rich precipitates along the δ/γ and δ/δ grain boundaries, which may significantly affect the toughness and the corrosion resistance of the alloy. Solution annealing at 1100 °C led to complete dissolution of σ (Cr-Fe phase, the microstructure being formed of primary δ-Fe and γ-Fe. The orientation relationship between δ/δ, γ/γ and δ/γ grains was determined by electron back scattering diffraction (EBSD. Both primary constituent phase’s microhardness and global microhardness were determined.

  18. A two-step superplastic forging forming of semi-continuously cast AZ70 magnesium alloy

    Directory of Open Access Journals (Sweden)

    Pan Wang

    2015-03-01

    Full Text Available A two-step technology combined forging with superplastic forming has been developed to enhance the forgeability of semi-continuously cast AZ70 magnesium alloy and realize the application of the as-cast magnesium alloy in large deformation bullet shell. In the first step, fine-grained microstructure preforms that are suitable for superplastic forming were obtained by reasonably designing the size of the initial blanks with the specific height-to-diameter ratio, upsetting the blanks and subsequent annealing. In the second step, the heat treated preforms were forged into the end products at the superplastic conditions. The end products exhibit high quality surface and satisfied microstructure. Consequently, this forming technology that not only avoids complicating the material preparation but also utilizes higher strain rate superplastic provides a near net-shaped novel method on magnesium forging forming technology using as-cast billet.

  19. Forming of Hollow Shaft Forging From Titanium Alloy Ti6Al4V by Means of Rotary Compression

    Directory of Open Access Journals (Sweden)

    Tomczak J.

    2015-04-01

    Full Text Available This paper presents chosen results of theoretical-experimental works concerning forming of hollow shafts forgings from titanium alloys, which are applied in aviation industry. At the first stage of conducted analysis, the forging forming process was modeled by means of finite element method. Calculations were made using software Simufact Forming. On the basis of performed simulations optimal parameters of rotary compression process were determined. Next, experimental tests of forging forming in laboratory conditions were made. For the research needs, a forging aggregate, designed by the Authors, was used. Conducted research works confirmed the possibility of metal forming (by means of rotary compression of hollow shafts from hard workable titanium alloys. Numerous advantages of rotary compression process, make it attractive both for low series production (aircraft industry and for mass production (automotive industry.

  20. Structural features of spin-coated thin films of binary As{sub x}S{sub 100−x} chalcogenide glass system

    Energy Technology Data Exchange (ETDEWEB)

    Cook, J. [Austin Peay State University, Clarksville, TN 37075 (United States); Slang, S. [Faculty of Chemical Technology, University of Pardubice, 53210 Pardubice (Czech Republic); Golovchak, R. [Austin Peay State University, Clarksville, TN 37075 (United States); Jain, H. [International Materials Institute for New Functionality in Glass, Lehigh University, Bethlehem, PA 18015 (United States); Vlcek, M. [Faculty of Chemical Technology, University of Pardubice, 53210 Pardubice (Czech Republic); Kovalskiy, A., E-mail: kovalskyya@apsu.edu [Austin Peay State University, Clarksville, TN 37075 (United States)

    2015-08-31

    Spin-coating technology offers a convenient method for fabricating photostable chalcogenide glass thin films that are especially attractive for applications in IR optics. In this paper we report the structure of spin-coated As{sub x}S{sub 100−x} (x = 30, 35, 40) thin films as determined using high resolution X-ray photoelectron spectroscopy (XPS) and Raman spectroscopy, especially in relation to composition (i.e. As/S ratio) and preparation process variables. It was observed that As atoms during preparation have a tendency to precipitate out in close to stoichiometric compositions. The mechanism of bonding between the inorganic matrix and organic residuals is discussed based on the experimental data. A weak interaction between S ions and amine-based clusters is proposed as the basis of structural organization of the organic–inorganic interface. - Highlights: • As–S spin-coated chalcogenide thin films with different As/S were fabricated. • XPS measurements support the cluster-like structure of spin-coated films. • As{sub 2}O{sub 3} was confirmed as the composition of precipitate formed during dissolution. • Lack of As–As bonds explains the observed photostability of the thin films.

  1. Development of forging technology for PWR primary piping

    International Nuclear Information System (INIS)

    Morin, F.; Badeau, J.P.; Lambs, R.

    1996-01-01

    The purpose of this presentation is to give information on the changes in the design and manufacture of Primary Piping for electronuclear boilers of the Pressurized Water Reactor type (PWR) which has resulted in the making of one-piece forged lines including stub pipes and arcs. The optimization of these items is aimed at improving the life of the new power stations as well as guaranteeing their safety, while reducing inspection and maintenance requirements in service. The demonstration of the manufacturing feasibility has just been completed. It has taken material form in the installation, on the CIVAUX 1 section, of the first one-piece cold leg in the world. It will shortly be followed by the installation on the CIVAUX 2 section of a complete loop of bent forged pipes. Therefore, this new know-how is going to be incorporated in the French Rules (RCC-M) and can be directly taken into consideration both in the next work to be done and in the design and definition of a future nuclear reactor

  2. Numerical optimization of die geometry in open die forging

    DEFF Research Database (Denmark)

    Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

    2013-01-01

    This paper deals with numerical optimization of open die forging of large metallic ingots made by casting implying risk of defects, e.g. central pores. Different material hardening properties and die geometries are combined in order to investigate, which geometry gives rise to maximum closure...

  3. The effect of strain distribution on microstructural developments during forging in a newly developed nickel base superalloy

    Energy Technology Data Exchange (ETDEWEB)

    Buckingham, R.C. [Institute of Structural Materials, Swansea University, Bay Campus, Fabian Way, Swansea SA1 8EN (United Kingdom); Argyrakis, C.; Hardy, M.C. [Rolls-Royce plc, PO Box 31, Derby DE24 8BJ (United Kingdom); Birosca, S., E-mail: 522042@swansea.ac.uk [Institute of Structural Materials, Swansea University, Bay Campus, Fabian Way, Swansea SA1 8EN (United Kingdom)

    2016-01-27

    In the current study, the effect of strain distribution in a simple forging geometry on the propensity for recrystallization, and its impact on mechanical properties has been investigated in a newly developed experimental nickel-based superalloy. The new alloy was produced via a Powder Metallurgy (PM) route and was subsequently Hot Isostatic Processed (HIP), isothermally forged, and heat treated to produce a coarse grain microstructure with average grain size of 23–32 μm. The alloy was examined by means of Electron Back-Scatter Diffraction (EBSD) to characterise the microstructural features such as grain orientation and morphology, grain boundary characteristics and the identification of potential Prior Particle Boundaries (PPBs) throughout each stage of the processing route. Results at the central region of the cross-section plane parallel to the loading direction showed significant microstructural differences across the forging depth. This microstructural variation was found to be highly dependent on the value of local strain imparted during forging such that areas of low effective strain showed partial recrystallisation and a necklace grain structure was observed following heat treatment. Meanwhile, a fully recrystallised microstructure with no PPBs was observed in the areas of high strain values, in the central region of the forging.

  4. 30 CFR 816.13 - Casing and sealing of drilled holes: General requirements.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: General...-SURFACE MINING ACTIVITIES § 816.13 Casing and sealing of drilled holes: General requirements. Each exploration hole, other drill or borehole, well, or other exposed underground opening shall be cased, sealed...

  5. Magnetocaloric effect and transport properties of Gd5Ge2(Si1-x Sn x )2 (x=0.23 and 0.40) compounds

    International Nuclear Information System (INIS)

    Campoy, J.C.P.; Plaza, E.J.R.; Nascimento, F.C.; Coelho, A.A.; Pereira, M.C.; Fabris, J.D.; Raposo, M.T.; Cardoso, L.P.; Persiano, A.I.C.; Gama, S.

    2007-01-01

    We report a study about the structural properties of polycrystalline samples of nominal composition Gd 5 Ge 2 (Si 1- x Sn x ) 2 (x=0.23, 0.40) that closely influence their physical behavior particularly related to electric resistivity and magnetocaloric (MCE) effect. The samples were characterized by X-ray diffraction (XRD) using the Rietveld refinement method, metallographic analyses, 119 Sn Moessbauer spectroscopy, DC magnetization and electrical transport measurements. It was identified a Gd 5 Si 2 Ge 2 -monoclinic phase for x=0.23 and a Sm 5 Sn 4 -orthorhombic phase (type II) for x=0.40, both with two non-equivalent crystallographic sites for the Sn ions. We were able to infer on the role of tin on the magnetic and transport properties in these compounds

  6. 77 FR 39997 - Heavy Forged Hand Tools, Finished or Unfinished, With or Without Handles From the People's...

    Science.gov (United States)

    2012-07-06

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-803] Heavy Forged Hand Tools...) (Diamond Sawblades), the Department is notifying the public that the final judgment in this case is not in... review on heavy forged hand tools, finished or unfinished, with or without handles from the People's...

  7. Standard specification for titanium and titanium alloy forgings

    International Nuclear Information System (INIS)

    Anon.

    1975-01-01

    Standards are given for the purchase, manufacture, product testing and certification, packaging, and marketing of annealed Ti and Ti-alloy forgings. The specifications apply to the following Ti alloys: 6Al-Ti-4V, 5Al-Ti-2.5 Sn, and Ti + Pd. Acceptable values for the chemical requirements, product analysis limits, and tensile requirements are tabulated

  8. Glass forming ability and magnetic properties of Co(40.2−x)Fe(20.1+x)Ni6.7B22.7Si5.3Nb5 (x=0–10) bulk metallic glasses produced by suction casting

    International Nuclear Information System (INIS)

    Sarlar, Kagan; Kucuk, Ilker

    2015-01-01

    The effect of Fe concentration on the glass forming ability (GFA) and magnetic properties in Co (40.2−x) Fe (20.1+x) Ni 6.7 B 22.7 Si 5.3 Nb 5 (x=0–10) bulk metallic glasses were investigated. By suction casting method, the bulk metallic glasses with diameters up to 2 mm were produced. We try to find out which Fe concentration makes an influence on Co based system's magnetic properties and glass forming ability. The curves of thermal analysis, obtained using differential scanning calorimetry (DSC), show that the Co (40.2−x) Fe (20.1+x) Ni 6.7 B 22.7 Si 5.3 Nb 5 (x=0–10) have a supercooled liquid region (∆T x ) of about 44 K. The saturation magnetizations (J s ) for as-cast BMG alloys were in the range of 0.62 T−0.81 T. - Highlights: • The effect of Fe concentration on the glass forming ability. • The substitution of an appropriate amount of Fe can enhance the GFA. • The substitution of Fe for Co also improves soft magnetic properties of the BMGs. • The high of J s 0.62−0.81 T with a low H c of 2−289 A/m of the alloys

  9. Simulation and experimental verification of the filling process of semi-solid die forging for cup shell

    Directory of Open Access Journals (Sweden)

    Jianbo TAN

    2015-06-01

    Full Text Available The filling mold process of semi-solid alloy blank influences severely the forming and properties of finished piece. In this paper, DEFORM is applied to simulate the process of cup-type 6061 alloy die forging casting. The influences of the temperature of semi-solid alloy blank, preheating temperature, and downward press speed of pressure head on process of mold filling and velocity field are investigated. The results show that the mold filling of semi-solid alloy paste smoothly fills along the whole of mould cavity in “total wall thickness” form when the temperature of semi-solid alloy blank is 620 ℃, preheating temperature of pressure head is 200 ℃ and speed of pressure head is 40 mm/s. Along with the increase of the preheating temperature of pressure head, the filling process of the semi-solid alloy paste trends toward stable when the temperature of semi-solid alloy blank is 620 ℃ and the speed of pressure head is 20 mm/s. Along with the increasing of the temperature of semi-solid alloy, the process of mould filling becomes off balance and the liquid becomes turbulent flow. The velocity field in the process of mould filling affects severely the structure uniformity of the finished product.

  10. Premature failure analysis of forged cold back-up roll in a continuous tandem mill

    International Nuclear Information System (INIS)

    Rad, Hamid Reza Bakhsheshi; Monshi, Ahmad; Idris, Mohd Hasbullah; Kadir, Mohammed Rafiq Abdul; Jafari, Hassan

    2011-01-01

    Highlights: → Metal wrapping and strip welding in work/back-up rolls contact zone caused spalling. → MnS inclusion and pore initiated crack which propagated in milling led to spalling. → Retained austenite conversion to α'-martensite accelerated spalling failure. → Needle shaped carbide (Fe,Mo,Cr) 7 C 3 , may cause poor service life of back-up roll. -- Abstract: In this paper, premature failure of a forged back-up roll from a continuous tandem mill was investigated. Microstructural evolutions of the spalled specimen and surface of the roll were characterized by optical microscopy, X-ray diffraction, scanning electron microscopy and ferritscopy, while hardness value of the specimen was measured by Vickers hardness testing. The results revealed that the presence of pore and MnS inclusion with spherical and oval morphologies were the main contributing factors responsible for the poor life of the back-up roll. In addition, metal pick up and subsequently strip welding on the surface of the work roll were found as the major causes of failure in work roll which led to spalling occurrence in the back-up roll. Furthermore, relatively high percentage of retained austenite, say 9%, in outer surface of the back-up roll contributed spalling due to conversion of this meta-stable phase to martensite and creation of volume expansion on the outer surface through work hardening during mill campaign.

  11. Open die forging of large shafts with porosity defects – physical and numerical modelling

    DEFF Research Database (Denmark)

    Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

    2013-01-01

    The aim and scope of this paper is centered to analyze the influence of the geometry of V-shaped dies on the closure of internal centerline porosity defects in ingots during multistep open-die forging. The investigation is performed with small scale physical models made from lead using V-shaped d......The aim and scope of this paper is centered to analyze the influence of the geometry of V-shaped dies on the closure of internal centerline porosity defects in ingots during multistep open-die forging. The investigation is performed with small scale physical models made from lead using V......-shaped dies with 90o and 120o and a reference pair of flat parallel platens. Holes drilled through the center of these preforms are produced to mimic centerline porosity in full scale cast ingots and intermediate rotation of the preforms replicate a multi-stage forging sequence under laboratory testing...

  12. Multi-objective optimization of die geometry in ingot forging

    DEFF Research Database (Denmark)

    Christiansen, Peter; Martins, Paulo A.F.; Bay, Niels

    2014-01-01

    The soundness of an ingot after hot forging with different V-shaped lower dies is evaluated using finite element simulations.Two different modelling approaches that make use of uncoupled ductile damage and coupled ductile damage based on porousplasticity are employed. It is shown that the two...

  13. Microstructure evolution of superalloy for large exhaust valve during hot forging

    International Nuclear Information System (INIS)

    Jeong, H.S.; Cho, J.R.; Park, H.C.

    2004-01-01

    The nickel-based alloy Nimonic 80A possesses strength, and corrosion, creep and oxidation resistance at high temperature. These products are used for aerospace, marine engineering and power generation, etc. The control of forging parameters such as strain, strain rate, temperature and holding time is important because the microstructure change in hot working affects the mechanical properties. It is necessary to understand the microstructure variation evolution. The microstructure change evolution occurs by recovery, recrystallization and grain growth phenomena. The dynamic recrystallization evolution has been studied in the temperature range 950-1250 deg. C and strain rate range 0.05-5s-1 using hot compression tests. The metadynamic recrystallization and grain growth evolution has been studied in the temperature range 950-1250 deg. C and strain rate range 0.05, 5s-1, holding time range 5, 10, 100, 600 sec using hot compression tests. Modeling equations are developed to represent the flow curve, recrystallized grain size, recrystallized fraction and grain growth phenomena by various tests. Parameters of modeling equation are expressed as a function of the Zener-Hollomon parameter. The modeling equation for grain growth is expressed as a function of initial grain size and holding time. The developed modeling equation was combined with thermo-viscoplastic finite element modeling to predict various microstructure change evolution during thermo mechanical processing. The predicted grain size in developed FE simulation results is compared with results obtained in various tests. In order to obtain a final microstructure and good mechanical properties in forging, the FEM would become a useful tool in the simulation of the microstructure development

  14. Local structure in (MnS)2x(CuInS2)1-x alloys

    International Nuclear Information System (INIS)

    Pietnoczka, A.; Bacewicz, R.; Schorr, S.

    2006-01-01

    Local structure around Mn atoms in (MnS) 2x (CuInS 2 ) 1-x alloys for x≤0.09 has been determined using near-edge and extended X-ray absorption fine structure (XANES and EXAFS) measured at the Mn K-edge. We found that for the Mn concentration up to 9 at% Mn atoms substitute preferentially for indium in the chalcopyrite lattice. The Mn-S bond length is 2.43±0.015 Aa, and is about 2% shorter than the In-S bond length. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  15. Lipofection of siRNA into bovine 8-16-cell stage embryos using zona removal and the well-of-the-well culture system.

    Science.gov (United States)

    Ikeda, Shuntaro; Sugimoto, Miki; Kume, Shinichi

    2018-04-13

    Bovine preimplantation embryos exhibit dramatic biological changes between before and after the 8-16-cell stage. Here we report a simple lipofection method to transfect siRNA into bovine 8-16-cell stage embryos using zona removal and the well-of-the-well (WOW) culture system. Bovine one-cell embryos produced in vitro were freed from the zona pellucida and cultured up to the 8-16-cell stage in WOW dishes. The 8-16-cell embryos were lipofected with siRNA and the transfection efficiency was assessed at 48 h of transfection. Lipofection with a red fluorescent non-targeting siRNA revealed the importance of zona removal for transfection of siRNA into embryos. Using this method, we knocked down the methionine adenosyltransferase 2A (MAT2A) gene, achieving a significant reduction in MAT2A expression (P lipofection', may be useful to analyze gene functions in bovine preimplantation embryos without expensive equipment and skill-intensive techniques.

  16. 30 CFR 816.87 - Coal mine waste: Burning and burned waste utilization.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: Burning and burned waste...-SURFACE MINING ACTIVITIES § 816.87 Coal mine waste: Burning and burned waste utilization. (a) Coal mine... extinguishing operations. (b) No burning or burned coal mine waste shall be removed from a permitted disposal...

  17. Short-range order parameters in amorphous YBaS4X7(X-S, SE, TE) films

    International Nuclear Information System (INIS)

    Hajiyev, E.S.

    2005-01-01

    Full text : Electron scattering intensity curves from amorphous YbAs 4 X 7 (X-S, SE, TE) films have ben obtained by the transmission electron diffraction (TED) method with rotation sector before screen up. The energy of electrons was 100 keV. Amorphous samples were crystallized and the composition of the products were measured by TED. The atomic radial distribution function has been calculated by the Fourier synthesis of intensities in the TED of amorphous YbAs 4 X 7 (X-S, SE, TE) films. The interatomic average distances of As - S (Se, Te) and As-Yb + 2 and partial coordination numbers have been estimated in these thilms. Based on these numbers, chemical orders in these films differ. This difference is due to differing topological order in the amorphous YbAs 4 X 7 (X-S, SE, TE) films

  18. Weldability and mechanical property characterization of weld clad alloy 800H tubesheet forging

    International Nuclear Information System (INIS)

    King, J.F.; McCoy, H.E.

    1984-09-01

    The weldability of an alloy 800H forging that simulates a steam generator tubesheet is studied. Weldability was of concern because a wide range of microstructures was present in this forging. The top and portions of the bottom were weld clad with ERNiC-3 weld metal to a thickness of 19 mm similar to that anticipated for HTGR steam generators. Examinations of the clad fusion line in various regions revealed no weldability problems except possibly on the bottom portion, which contained large grains and some as-cast structure. A few microfissures were evident in this region, but no excessive hot cracking tendency was observed. The tensile properties in all areas of the clad forging were reasonable and not influenced greatly by the microstructure. The elevated-temperature tests showed strong tendency for fracture in the heat-affected zone of the alloy 800H. Creep failure at 649 0 C consistently occurred in the heat-affected zone of the alloy 800H, but the creep strength exceeded the expected values for alloy 800H

  19. Thermal stability of amorphous structure and magnetic properties Fe{sub 80-x}Co{sub x}P{sub 14}B {sub 6} (x=20-40) ribbons

    Energy Technology Data Exchange (ETDEWEB)

    Kostyrya, S.A.; Idzikowski, B. [Institute of Molecular Physics, Polish Academy of Sciences, M. Smoluchowskiego 17, 60-179 Poznan (Poland); Tkatch, V.I.; Popov, V.V.; Rassolov, S.G. [Donetsk Physics and Engineering Institute of National Academy of Sciences of Ukraine, R. Luxemburg 72, 83114 Donetsk (Ukraine)

    2006-01-01

    Amorphous structure and its thermal stability as well as magnetic properties of Fe{sub 80-x}Co{sub x}P{sub 14}B{sub 6} (20{<=}x{<=}40) glasses have been studied by X-ray diffraction, non-isothermal differential scanning calorimetry (DSC) and thermomagnetic (TMG) measurements. The Curie temperature increases with Co content, while the glass transition and crystallization onset temperatures decrease. As a result, for alloys x=30, 32 and 35 at%, the transition into paramagnetic state take place close to glass transition temperature. However, for x=40 at% the TMG curve, in the vicinity of magnetic transition temperature, is overlapped by ferromagnetic crystallization products. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  20. The effects of thermomechanical history on the microstructure of a nickel-base superalloy during forging

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, S., E-mail: 485354@swansea.ac.uk [College of Engineering, Bay Campus, Swansea University, Swansea SA1 8EN (United Kingdom); Li, W. [Rolls-Royce plc, PO Box 31, Derby DE24 8BJ (United Kingdom); Coleman, M. [College of Engineering, Bay Campus, Swansea University, Swansea SA1 8EN (United Kingdom); Johnston, R., E-mail: r.johnston@swansea.ac.uk [College of Engineering, Bay Campus, Swansea University, Swansea SA1 8EN (United Kingdom)

    2016-06-21

    The effect of thermo-mechanical history on hot compression behaviour and resulting microstructures of a nickel base superalloy is presented. Hot compression tests were carried out on HAYNES® 282® specimens to varying strains from 0.1 to 0.8. Both single pass and multi-pass tests were completed. 60 min inter-pass times were utilized to accurately replicate industrial forging practices. The effect of dynamic, metadynamic and static recrystallization during inter-pass times on flow stress was investigated. The resulting microstructures were analysed using scanning electron, optical microscopy and EBSD to relate grain size and homogeneity with flow stress data. The study showed a negligible difference between multi-pass and single pass tests for strain increments above 0.2. Therefore, when modelling similar low strain and strain rate forging processes in HAYNES® 282®, previous forging steps can be ignored.

  1. Cold forging stem of total hip prosthesis with hybrid mechanical properties

    International Nuclear Information System (INIS)

    Lopes, E.S.N.; Contieri, R.J.; Cardoso, F.F.; Cremasco, A.; Button, S.T.; Caram, R.

    2010-01-01

    Type β Ti alloy is one of the most versatile groups of materials with regard to mechanical properties. Aspects such as alloying elements selection, mechanical processing and heat treatment routes empower these materials in applications where hybrid mechanical behavior is necessary. The aim of this study is to produce stems of total hip prostheses with hybrid mechanical properties using Ti-Nb alloys. Ingots were produced by using arc melting. Following, samples were subjected to specific heat treatment aiming to make cold forging. Sample characterization includes X-ray diffraction, scanning electron microscopy, Vickers hardness tests and tensile test. The experiments performed allowed to examine the effects of heat treatment parameters on the microstructure and mechanical behavior. Finally, results obtained show that the application of specific heat treatments of quenching and aging makes feasible the manufacturing of orthopedic devices with hybrid mechanical properties with regions where high mechanical strength was prioritized, while in others, low elastic modulus was the main concern. (author)

  2. Sensitivity Analysis of Oxide Scale Influence on General Carbon Steels during Hot Forging

    Directory of Open Access Journals (Sweden)

    Bernd-Arno Behrens

    2018-02-01

    Full Text Available Increasing product requirements have made numerical simulation into a vital tool for the time- and cost-efficient process design. In order to accurately model hot forging processes with finite, element-based numerical methods, reliable models are required, which take the material behaviour, surface phenomena of die and workpiece, and machine kinematics into account. In hot forging processes, the surface properties are strongly affected by the growth of oxide scale, which influences the material flow, friction, and product quality of the finished component. The influence of different carbon contents on material behaviour is investigated by considering three different steel grades (C15, C45, and C60. For a general description of the material behaviour, an empirical approach is used to implement mathematical functions for expressing the relationship between flow stress and dominant influence variables like alloying elements, initial microstructure, and reheating mode. The deformation behaviour of oxide scale is separately modelled for each component with parameterized flow curves. The main focus of this work lies in the consideration of different materials as well as the calculation and assignment of their material properties in dependence on current process parameters by application of subroutines. The validated model is used to carry out the influence of various oxide scale parameters, like the scale thickness and the composition, on the hot forging process. Therefore, selected parameters have been varied within a numerical sensitivity analysis. The results show a strong influence of oxide scale on the friction behaviour as well as on the material flow during hot forging.

  3. A new Friction and Lubrication Test for Cold Forging

    DEFF Research Database (Denmark)

    Bay, Niels; Wibom, Ole; Aalborg Nielsen, J

    1995-01-01

    This paper presents a new friction and lubrication test for cold forging. The test allows controlled variation of the surface expansion in the range 0-2000%, the tool temperature in the range 20-270°C and the sliding length between 0 and infinite. Friction is decreasing with increasing temperature...

  4. Study of the CdX-B2X3-X (X=S, Se), CdTe-B-Te systems

    International Nuclear Information System (INIS)

    Odin, I.N.; Grin'ko, V.V.; Safronov, E.V.; Kozlovskij, V.F.

    2001-01-01

    Liquidus surfaces of the CdX-B 2 X 3 -X (X=S, Se), CdTe-B-Te systems are plotted for the first time. It is shown that in equilibrium solid solutions on the basis of ternary Cd 2 B 2 X 5 compounds and binary B 2 X 3 , CdX, BS 2 compounds take part with liquid phases. p gen -T and T-x projects of p-T-x phase diagram of B-S (59-100 at. % S), B-Se (59-100 at. % Se), B-Te systems are plotted . B 2 X 3 , BS 2 compounds are formed in that regions of compositions of B-X systems . In the B-Te system compounds are not formed. Ternary compounds are not formed in the CdTe-B-Te system [ru

  5. Investigating the effect of variable gutter technique as a novel method on vertical flow of material in closed die forging processes

    Energy Technology Data Exchange (ETDEWEB)

    Pourbashiri, M.; Sedighi, M. [Iran University, Tehran (Iran, Islamic Republic of)

    2016-04-15

    Recently, Variable gutter technique has been introduced as a novel method in order to reduce waste materials in closed-die forging processes. In this paper, the capability of this method is investigated for a family of forged parts that the vertical flow of material is the last stage of forming process. As a case study, using the variable gutter technique, the amount of waste material is decreased about 50% for a sample forged part with a local rising. The results of FVM simulations and experiments confirmed the effectiveness of the variable gutter technique in such forging processes. The vertical flow of material in the die cavity (h parameter), as a criterion, for different gutter width and thickness dimensions was examined by FVM simulations. The results shown that the gutter thickness has more effect on vertical flow of material than the gutter width. By decreasing the gutter thickness and increasing the gutter width, the amount of vertical flow of material is increased about 120% and 29%, respectively. Finally, A/H ratio (A = Max width of sectional area of a forged part, H = Max height of a forged part) is proposed as shape complexity factor of a forged part. The results of FVM simulations are indicated that for the ratio of A/H > 2, the variable gutter thickness technique is more effective and can be successfully used to reduce the amount of waste materials.

  6. Application of directional solidification ingot (LSD) in forging of PWR reactor vessel heads

    International Nuclear Information System (INIS)

    Benhamou, C.; Poitrault, I.

    1985-09-01

    Creusot-Loire Industrie uses this type of ingot for manufacture of Framatome 1300 and 1450 MW 4-loop PWR reactor vessel heads. This type of ingot offers a number advantages: improved internal soundness; greater chemical, structural and mechanical homogeneity of the finished part; simplified forging process. After a brief description of the pouring and solidification processes, this paper presents an analysis of the results of examinations performed on the prototype forging, as well as review of results obtained during industrial fabrication of dished heads from LSD ingots. The advantages of the LSD ingot over conventional ingots are discussed in conclusion

  7. Optical, Electrical and Photocatalytic Properties of the Ternary Semiconductors ZnxCd1-xS, CuxCd1-xS and CuxZn1-xS

    Directory of Open Access Journals (Sweden)

    Sandra Andrea Mayén-Hernández

    2014-01-01

    Full Text Available The effects of vacuum annealing at different temperatures on the optical, electrical and photocatalytic properties of polycrystalline and amorphous thin films of the ternary semiconductor alloys ZnxCd1-xS, CuxCd1-xS and CuxZn1-xS were investigated in stacks of binary semiconductors obtained by chemical bath deposition. The electrical properties were measured at room temperature using a four-contact probe in the Van der Pauw configuration. The energy band gap of the films varied from 2.30 to 2.85 eV. The photocatalytic activity of the semiconductor thin films was evaluated by the degradation of an aqueous methylene blue solution. The thin film of ZnxCd1-xS annealed under vacuum at 300°C exhibited the highest photocatalytic activity.

  8. Effect of nonmetallic inclusions on anisotropy of ductility in 35KhN3MFA steel forgings

    International Nuclear Information System (INIS)

    Shtremel', M.A.; Yavojskij, V.I.; Volkov, V.A.; Chursin, G.M.; Chukhlov, V.I.; Fetisov, G.I.; Mochalin, N.K.; Smol'yaninov, L.V.

    1980-01-01

    Characteristics of nonmetaltic inclusions and anizotropy of ductility and of impuct strength of forgings of the 35KhN3MFA steel are compared at different variants of melting and outer-furnace treatment. It is shown that method of melting rugulates anisotropy of ductility primarily through deformability of large inclusions during forging. Deformability of inclusions considerably changes due to introduction of silicocalcium in iron mold [ru

  9. Development of production technology and investigation of quality for forged-welded turbine rotors of steel 25Kh2NVFA

    International Nuclear Information System (INIS)

    Borisov, I.A.; Merinov, G.N.; Slezkina, E.V.

    1997-01-01

    A study was made into mechanical properties and microstructure of turbine rotor components manufactured by forging and heat treated under various conditions. It is revealed that the optimal heat treatment of forgings must include double quenching with subsequent tempering at 630-640 deg C for 10-20 h. Forged and welded rotors should be tempered at 620-630 deg C for 50-100 h. Microscopic examination and mechanical tests showed that low alloy steel 25Kh2NMF can be successfully used for manufacturing rotors of high-, medium-and low-heat turbines

  10. Magnetic transition induced by mechanical deformation in Fe{sub 60}Al{sub 40x}Si{sub x} ternary alloys

    Energy Technology Data Exchange (ETDEWEB)

    Legarra, E., E-mail: estibaliz.legarra@ehu.es [Dpto. Electricidad y Electronica, Universidad del Pais Vasco (UPV/EHU), CP. 644, 48080 Bilbao (Spain); Apiñaniz, E. [Dpto. Fisica Aplicada I, Universidad del Pais Vasco, Alameda de Urquijo s/n, 48013 Bilbao (Spain); Plazaola, F. [Dpto. Electricidad y Electronica, Universidad del Pais Vasco (UPV/EHU), CP. 644, 48080 Bilbao (Spain); Jimenez, J.A. [Centro Nacional de Investigaciones Metalurgicas (CENIM), Avda. Gregorio del amo 8, 28040 Madrid (Spain)

    2014-02-15

    Highlights: • Fe{sub 60}Al{sub 40x}Si{sub x} alloys were disordered by means of planetary ball milling technique. • Paramagnetic to ferromagnetic transition is observed with disordering. • Si addition hinders the disordering process and the increase of the lattice parameter. • Si addition promotes the paramagnetic to ferromagnetic transition. -- Abstract: We have used Mössbauer spectroscopy and X-ray diffraction to study the influence of different Al/Si ratios on the structural and magnetic properties of the mechanically deformed Fe{sub 60}Al{sub 40x}Si{sub x} alloys. The results indicate that ternary alloys also present the magnetic transition with disordering observed in binary Fe{sub 60}Al{sub 40} alloys. Besides, Si introduction has two opposite contributions. From a structural point of view, hinders the disordering process, but, from a magnetic point of view promotes the magnetic transition.

  11. Development of SiC Nanoparticles and Second Phases Synergistically Reinforced Mg-Based Composites Processed by Multi-Pass Forging with Varying Temperatures

    Directory of Open Access Journals (Sweden)

    Kaibo Nie

    2018-01-01

    Full Text Available In this study, SiC nanoparticles were added into matrix alloy through a combination of semisolid stirring and ultrasonic vibration while dynamic precipitation of second phases was obtained through multi-pass forging with varying temperatures. During single-pass forging of the present composite, as the deformation temperature increased, the extent of recrystallization increased, and grains were refined due to the inhibition effect of the increasing amount of dispersed SiC nanoparticles. A small amount of twins within the SiC nanoparticle dense zone could be found while the precipitated phases of Mg17Al12 in long strips and deformation bands with high density dislocations were formed in the particle sparse zone after single-pass forging at 350 °C. This indicated that the particle sparse zone was mainly deformed by dislocation slip while the nanoparticle dense zone may have been deformed by twinning. The yield strength and ultimate tensile strength of the composites were gradually enhanced through increasing the single-pass forging temperature from 300 °C to 400 °C, which demonstrated that initial high forging temperature contributed to the improvement of the mechanical properties. During multi-pass forging with varying temperatures, the grain size of the composite was gradually decreased while the grain size distribution tended to be uniform with reducing the deformation temperature and extending the forging passes. In addition, the amount of precipitated second phases was significantly increased compared with that after multi-pass forging under a constant temperature. The improvement in the yield strength of the developed composite was related to grain refinement strengthening and Orowan strengthening resulting from synergistical effect of the externally applied SiC nanoparticles and internally precipitated second phases.

  12. Modelling the void deformation and closure by hot forging of ingot castings

    DEFF Research Database (Denmark)

    Christiansen, Peter; Hattel, Jesper Henri; Kotas, Petr

    2012-01-01

    by mechanical deformation. The aim of this paper is to analyze numerically if and to what degree the voids areclosed by the forging. Using the commercial simulation software ABAQUS, both simplified model ingots and physically manufactured ingots containing prescribed void distributions are deformed and analyzed....... The analysis concernsboth the void density change and the location of the voids in the part after deformation. The latter can be important for the subsequent reliability of the parts, for instance regarding fatigue properties. The analysis incorporates the Gurson yield criterion for metals containing voids...... and focuses on how the voids deform depending on their size and distribution in the ingot as well ashow the forging forces are applied....

  13. Studies on electrodeposited Cd1-xFe xS thin films

    International Nuclear Information System (INIS)

    Deshmukh, S.K.; Kokate, A.V.; Sathe, D.J.

    2005-01-01

    Thin films of Cd 1-x Fe x S have been prepared on stainless steel and fluorine doped tin oxide (FTO) coated glass substrates using electrodeposition technique. Double distilled water containing precursors of Cd, Fe and S are used with ethylene diamine tetra-acetic acid (EDTA) disodium salt as a complexing agent to obtain good quality deposits by controlling the rate of reactions. The different preparative parameters like concentration of bath, deposition time, pH of the bath and Fe content in the bath have been optimized by photoelectrochemical (PEC) technique in order to get good quality thin films. Different techniques have been used to characterize electrodeposited Cd 1-x Fe x S thin films. The X-ray diffraction (XRD) analysis reveals that the films Cd 1-x Fe x S are polycrystalline in nature with crystallite size 282 A for the films deposited with optimized preparative parameters. Scanning electron microscopy (SEM) study for the sample deposited at optimized preparative parameters reveals that all grains uniformly distributed over the surface of stainless steel substrate indicates well defined growth of polycrystalline Cd-Fe-S material. Optical absorption shows the presence of direct transition and band gap energy decreases from 2.43 to 0.81 eV with the increase of Fe content from 0 to 1. PEC study shows the films of Cd 1-x Fe x S with x = 0.2 are more photosensitive than other compositions

  14. Army Combat Medic Resilience: The Process of Forging Loyalty.

    Science.gov (United States)

    Abraham, Preetha A; Russell, Dale W; Huffman, Sarah; Deuster, Patricia; Gibbons, Susanne W

    2018-03-01

    This study presents a grounded theory analysis of in-depth interviews of United States Army Combat Medics (CMs) who had served in Iraq and/or Afghanistan. The study explores how 17 CMs nominated by their peers as resilient cope with military stressors in order to identify the factors that enable them to thrive amidst harsh conditions. Four distinct categories of characteristics unique to this group emerged: (1) social bonding, (2) readiness, (3) dual loyalty as performance, and (4) leader by example. Forging loyalty underpins these characteristics and represents the main process used by resilient CMs and comprised three behavior patterns: (1) commitment to the family, (2) commitment to the military mission, and (3) commitment to their guiding religious and spiritual beliefs. Prominent behavioral tendencies of forging loyalty likely developed during childhood and re-enforced by families, friends, and other role models. Based on the findings, new training and education efforts should focus on developing positive emotional, environmental, and social resources to enhance the health and well-being of service members and their families.

  15. Electronic structure of Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} surface and CdS/Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} interface

    Energy Technology Data Exchange (ETDEWEB)

    Udaka, Yusuke; Takaki, Shin' ichi; Isowaki, Keisuke; Terada, Norio [Graduate School of Science and Engineering, Kagoshima University, 1-21-40 Korimoto, Kagoshima 890-0065 (Japan); Nagai, Takehiko; Kim, Kang Min; Kim, Shinho; Tampo, Hitoshi; Shibata, Hajime; Matsubara, Koji; Niki, Shigeru [Research Center for Photovoltaics, National Institute of Advanced Industrial Science and Technology, 1-1-1 Umezono, Tsukuba 305-8568 (Japan); Sakai, Noriyuki; Kato, Takuya; Sugimoto, Hiroki [Solar Frontier K.K., 123-1 Shimo-Kawairi, Atsugi 243-0206 (Japan)

    2017-06-15

    Changes of the electronic structure of the Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} [CZTSSe] films and the band alignment at the interfaces between CdS buffer and the CZTSSe in conjunction with the anion-mixing ratio x = 0-1 have been investigated using in situ X-ray, ultraviolet photoemission spectroscopy (XPS, UPS), and inverse photoemission spectroscopy (IPES). Changes of the UPS and IPES spectra in conjunction with x have revealed that the electronic structure of the CZTSSe surface is characterized with the preferential rise of conduction band minimum (CBM) in conjunction with the increase of x. As x increases, interface induced band bending decreases from 0.5 to 0.6 at the CdS/CZTSe (x = 0) interface to 0.1-0.2 at the CdS/CZTS (x = 1) one. And the downward shift of CBM due to the deposition of the CdS layer is enhanced as x increases. These changes result in the monotonous decrease of conduction band offset (CBO) in conjunction with the increase of x: CBO at the x = 0 and 1 interfaces are +0.5 and -0.14 to -0.15 eV, respectively. The values of CBO are consistent with the device properties; occasional emergence of double junction like current-voltage characteristics in the CdS/CZTSe-based cells, serious voltage-loss in the CdS/CZTS ones, and the highest performance achieved in the CdS/CZTSSe ones. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  16. Effects of boron additions and solutionizing treatments on microstructures and ductility of forged Ti–6Al–4V alloys

    International Nuclear Information System (INIS)

    Luan, J.H.; Jiao, Z.B.; Chen, G.; Liu, C.T.

    2015-01-01

    Highlights: • Proper boron additions and heat-treatments improve the ductility of Ti64 alloys. • Coarse TiB precipitates embrittle the Ti64 alloys causing ductility loss. • Modified Ti64 forged alloys with high strength and high ductility are developed. - Abstract: The effects of boron additions on the microstructure and mechanical properties of forged Ti–6Al–4V alloys in different heat-treatment conditions have been characterized by both experimental studies and thermodynamic calculations. The results indicate a combination of proper post-forging treatments and B additions are helpful for control of the prior-β grain size and the volume fraction of α phase, thereby tuning the ductility of the forged Ti–6Al–4V alloys. However, the B-containing alloys exhibit a significant drop in ductility if the solutionizing temperature is too high, and this embrittlement is mainly due to the coarsening of brittle TiB borides. The mechanism in this case is due to the cleavage fracture of TiB rather than its debonding with the matrix, as indicated by the observation of the aligned TiB borides on the matching areas of both halves of the fracture surfaces. Thus, the TiB size and orientation, the prior-β grain size, and the volume fraction of the α phase all play important roles in controlling the mechanical properties of the forged Ti–6Al–4V alloys. The current findings shed light on the composition–microstructure–ductility relationship in the forged Ti–6Al–4V alloys

  17. Effects of boron additions and solutionizing treatments on microstructures and ductility of forged Ti–6Al–4V alloys

    Energy Technology Data Exchange (ETDEWEB)

    Luan, J.H.; Jiao, Z.B. [Center for Advanced Structural Materials, Department of Mechanical and Biomedical Engineering, College of Science and Engineering, City University of Hong Kong, Hong Kong (China); Chen, G. [Engineering Research Center of Materials Behavior and Design, Ministry of Education, Nanjing University of Science and Technology, Nanjing 210094 (China); Liu, C.T., E-mail: chainliu@cityu.edu.hk [Center for Advanced Structural Materials, Department of Mechanical and Biomedical Engineering, College of Science and Engineering, City University of Hong Kong, Hong Kong (China)

    2015-03-05

    Highlights: • Proper boron additions and heat-treatments improve the ductility of Ti64 alloys. • Coarse TiB precipitates embrittle the Ti64 alloys causing ductility loss. • Modified Ti64 forged alloys with high strength and high ductility are developed. - Abstract: The effects of boron additions on the microstructure and mechanical properties of forged Ti–6Al–4V alloys in different heat-treatment conditions have been characterized by both experimental studies and thermodynamic calculations. The results indicate a combination of proper post-forging treatments and B additions are helpful for control of the prior-β grain size and the volume fraction of α phase, thereby tuning the ductility of the forged Ti–6Al–4V alloys. However, the B-containing alloys exhibit a significant drop in ductility if the solutionizing temperature is too high, and this embrittlement is mainly due to the coarsening of brittle TiB borides. The mechanism in this case is due to the cleavage fracture of TiB rather than its debonding with the matrix, as indicated by the observation of the aligned TiB borides on the matching areas of both halves of the fracture surfaces. Thus, the TiB size and orientation, the prior-β grain size, and the volume fraction of the α phase all play important roles in controlling the mechanical properties of the forged Ti–6Al–4V alloys. The current findings shed light on the composition–microstructure–ductility relationship in the forged Ti–6Al–4V alloys.

  18. The development of reactor vessel internal heavy forging for 1000 MW pressurized-water reactor nuclear power plant

    International Nuclear Information System (INIS)

    Zhang Zhifeng; Chen Yongbo; Ding Xiuping; Zhang Lingfang

    2012-01-01

    This Paper introduced the development of Reactor Vessel Internal (RVI) heavy forgings for 1000 MW Pressurized Water Reactor (PWR) nuclear power plant, analyzed the manufacture difficulties and technical countermeasures. The testing result of the product indicated that the performance of RVI heavy forgings manufactured by Shanghai Heavy Machinery Plant Ld. (SHMP) is outstanding and entirely satisfy the technical requirements for RVI product. (authors)

  19. Effect of technological parameters on formability of semi-solid rheological casting-forging 6061 alloy

    Directory of Open Access Journals (Sweden)

    Jianbo TAN

    2016-02-01

    Full Text Available The 6061 alloy cooling curve is determined by analysis software, and the 6061 semi-solid alloy is prepared by manual paddling process. The primary solid fraction is tested through prepared water quenched samples under different temperature. With H1F100 type servo press and cup type test mold, the forming of the 6061 semi-solid alloy rheological casting-forging is made. The influence of alloy temperature, forming pressure, upper mould temperature and holding time on the formability of 6061 alloy is researched. The results show that within the same set of mold completing casting and forging of the alloy is feasible. Along with the increase of the alloy temperature and the upper mould temperature, the formability of finished products becomes better. Under this experimentation, when the temperature of the semi-solid alloy is amongst 642 ℃ to 645 ℃ and the upper mould preheating temperature is amongst 200 ℃ to 300 ℃, casting defects such as cold insulation will form in the casting-forging sample of semi-solid 6061 alloy with the prolongation of holding time.

  20. Zn{sub x}Cd{sub 1-} {sub x}S as a heterojunction partner for CuIn{sub 1-x}Ga{sub x}S{sub 2} thin film solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Bhaskar [Florida Solar Energy Center, University of Central Florida, Cocoa, FL 32922 (United States); Vasekar, Parag [Florida Solar Energy Center, University of Central Florida, Cocoa, FL 32922 (United States)], E-mail: psvasekar@yahoo.com; Pethe, Shirish A.; Dhere, Neelkanth G. [Florida Solar Energy Center, University of Central Florida, Cocoa, FL 32922 (United States); Koishiyev, Galymzhan T. [Physics Department, Colorado State University, Fort Collins, CO 80523 (United States)

    2009-02-02

    Zinc cadmium sulfide (Zn{sub x}Cd{sub 1-x}S) heterojunction partner layer prepared with chemical bath deposition (CBD) has exhibited better blue photon response and higher current densities due to its higher bandgap than that of conventional cadmium sulfide (CdS) layer for CuIn{sub 1-x}Ga{sub x}S{sub 2} (CIGS2) solar cells. CIGS2/Zn{sub x}Cd{sub 1-x}S devices have also shown higher open circuit voltage, V{sub oc} indicating improved junction properties. A conduction band offset has been observed by J-V curves at various temperatures indicating that still higher V{sub oc} can be obtained by optimizing the conduction band offset. This contribution discusses the effect of variation of parameters such as concentration of compounds, pH of solution and deposition time during CBD on device properties and composition and crystallinity of film. Efficiencies comparable to CIGS2/CdS devices have been achieved for CIGS2/Zn{sub x}Cd{sub 1-x}S devices.

  1. Influence of the coating process on the tribological conditions during cold forging with a MoS2 based lubricant

    Science.gov (United States)

    Lorenz, Robby; Hagenah, Hinnerk; Merklein, Marion

    2018-05-01

    Cold forging processes such as forward rod extrusion can be used to produce high quality components like connection rods, shafts and gears. The main advantages of these extruded components are sufficient surface quality, work hardening, compressive residual stresses and fatigue strength. Since one technical disadvantage of extruded components lies in the achievable tolerance classes, the improvement of these should be of crucial importance. For instance, the attainable workpiece accuracy and component quality can be influenced by adapting the tribological system in such a way that the resulting friction is specifically controlled in order to improve component forming. Lubricant modification is one practical way of adapting the tribological system to the requirements of the forming process. An industrial established and highly efficient lubricant system is the application of a zinc-phosphate conversion layer with a molybdenum disulfide-based lubricant. While offering many advantages, its tribological conditions seem to depend strongly on the layer weight and the application strategy. These parameters and the respective interdependencies have not been sufficiently investigated yet. In order to examine this, the tribological conditions depending on the layer weight are analyzed in greater detail using the Ring-Compression-Test (RCT). This tribometer provides a comparative representation of the forming conditions during cold forging. Furthermore, a potential dependency between the tribological conditions and two different coating techniques is analyzed. The latter are represented by the industrial standards dipping and dip-drumming.

  2. Multipass forging of Inconel 718 in the delta-Supersolvus domain: assessing and modeling microstructure evolution

    Directory of Open Access Journals (Sweden)

    Zouari Meriem

    2014-01-01

    Full Text Available This work is focused on the evolution of the microstructure of Inconel 718 during multi-pass forging processes. During the forming process, the material is subjected to several physical phenomena such as work-hardening, recovery, recrystallization and grain growth. In this work, transformation kinetics are modeled in the δ-Supersolvus domain (T>Tsolvus where the alloy is single-phase, all the alloying elements being dissolved into the FCC matrix. Torsion tests were used to simulate the forging process and recrystallization kinetics was modeled using a discontinuous dynamic recrystallization (DDRX two-site mean field model. The microstructure evolution under hot forging conditions is predicted in both dynamic and post-dynamic regimes based on the initial distribution of grain size and the evolution of dislocation density distribution during each step of the process. The model predicts recrystallization kinetics, recrystallized grain size distribution and stress–strain curve for different thermo-mechanical conditions and makes the connection between dynamic and post-dynamic regimes.

  3. Effect of Friction on Barreling during cold Upset Forging of Aluminium 6082 Alloy Solid cylinders

    Science.gov (United States)

    Priyadarshini, Amrita; Kiran, C. P.; Suresh, K.

    2018-03-01

    Friction is one of the significant factors in forging operations since it affects metal flow in the die, forming load, strain distribution, tool and die life, surface quality of the product etc. In upset forging, the frictional forces at the die-workpiece interface oppose the outward flow of the material due to which the specimen develops a barrel shape. As a result, the deformation becomes non-uniform or inhomogeneous which is undesirable. Barreling can be reduced by applying effective lubricant on the surface of the platens. The objective of the present work is to study experimentally the effect of various frictional conditions (dry, grease, mineral oil) on barreling during upset forging of aluminum 6082 solid cylinders of different aspect ratio (length/diameter: 0.5, 0.75, 1). The friction coefficients are determined using the ring compression test. Curvature of barrel is determined based on the assumption that the curvature of the barrel follows the geometry of circular arc.

  4. Effects of HIP and forging on fracture behaviour in cast iron with spheroidal vanadium carbides dispersed within martensitic-matrix microstructure

    International Nuclear Information System (INIS)

    Uematsu, Y.; Tokaji, K.; Nishigaki, K.; Okajima, D.; Ogasawara, M.

    2010-01-01

    The cast iron with spheroidal vanadium carbides dispersed within martensitic-matrix microstructure was developed as a die material due to its high hardness. In order to achieve high performances of dies, not only the hardness but also the mechanical properties such as fracture toughness and fatigue crack propagation (FCP) resistance should be improved. In this paper, hot isostatic pressing (HIP) or forging was applied to the cast iron to improve mechanical properties, and the fracture behaviour, such as flexural strength, fracture toughness and FCP, was studied. The average flexural strength was reduced by forging because of the enhanced notch sensitivity due to the increase in the hardness. The fracture toughness was not affected by HIP nor forging while its scatter was significantly reduced by both post-treatments. The intrinsic FCP resistance taking account of crack closure was the same regardless of the application of HIP or forging, indicating that a slight change in the microstructure resulting from both treatments and the presence of casting defects exerted little influence on FCP behaviour. It could be concluded that both HIP and forging could improve the hardness of the material, while fracture toughness and FCP resistance were maintained.

  5. A multi-scale approach for high cycle anisotropic fatigue resistance: Application to forged components

    International Nuclear Information System (INIS)

    Milesi, M.; Chastel, Y.; Hachem, E.; Bernacki, M.; Loge, R.E.; Bouchard, P.O.

    2010-01-01

    Forged components exhibit good mechanical strength, particularly in terms of high cycle fatigue properties. This is due to the specific microstructure resulting from large plastic deformation as in a forging process. The goal of this study is to account for critical phenomena such as the anisotropy of the fatigue resistance in order to perform high cycle fatigue simulations on industrial forged components. Standard high cycle fatigue criteria usually give good results for isotropic behaviors but are not suitable for components with anisotropic features. The aim is to represent explicitly this anisotropy at a lower scale compared to the process scale and determined local coefficients needed to simulate a real case. We developed a multi-scale approach by considering the statistical morphology and mechanical characteristics of the microstructure to represent explicitly each element. From stochastic experimental data, realistic microstructures were reconstructed in order to perform high cycle fatigue simulations on it with different orientations. The meshing was improved by a local refinement of each interface and simulations were performed on each representative elementary volume. The local mechanical anisotropy is taken into account through the distribution of particles. Fatigue parameters identified at the microscale can then be used at the macroscale on the forged component. The linkage of these data and the process scale is the fiber vector and the deformation state, used to calculate global mechanical anisotropy. Numerical results reveal an expected behavior compared to experimental tendencies. We proved numerically the dependence of the anisotropy direction and the deformation state on the endurance limit evolution.

  6. Environmentally Benign Lubricant Systems For Cold, Warm And Hot Forging

    DEFF Research Database (Denmark)

    Bay, Niels

    2010-01-01

    paper gives an overview of these efforts substituting environmentally hazardous lubricants in cold, warm and hot forging. The paper is an extract of the keynote paper [3] written by the author together with eight co-authors referring to collected papers and other information from more than 30 different...

  7. X = S, Se, Te) heterostructures

    KAUST Repository

    Zhang, Qingyun; Schwingenschlö gl, Udo

    2018-01-01

    Using first-principles calculations, we investigate the electronic properties of the two-dimensional GaX/MX2 (M = Mo, W; X = S, Se, Te) heterostructures. Orbital hybridization between GaX and MX2 is found to result in Rashba splitting at the valence

  8. Structure and properties of heat-treated Ti-(40-4X)%Nb-X%Mo alloys with IE (SME)

    International Nuclear Information System (INIS)

    Silva, Marcia Almeida; Matlakhova, Lioudmila Aleksandrovna; Matlakhov, Anatoliy Nikolaevich; Paes Junior, Herval Ramos; Goncharenko, Boris Andreevich

    2010-01-01

    Whereas the inelastic effects (IE) are related with reversible martensitic transformation, in this work, was analyzed the structure and properties of heat treated Ti-(40-4x)%Nb-x%Mo alloys, where the contents of niobium and molybdenum are between 24-40%Nb and 0-4%Mo (% weight). The structural and phase analysis were done through optical microscopy and X-rays diffraction. The properties measured in this study were electrical resistivity and density. The Ti-40%Nb alloy shows a structure consisting of the β phase and αα’’ martensite with a minor participation of the α’ and ω. The alloys with 1 to 4%Mo have similar structures consisting of the β phase and traces of the α’’ phase. Thus, was observed greater capacity of Mo as a β stabilizer. The increase in Mo content in the composition of the alloys causes an increase in electrical resistivity of these. The samples may have undergone change in volume, caused by phase transformation, what possibly caused the difference between the density values calculated (theoretical) and experimental. (author)

  9. Forging New, Non-traditional Partnerships Among Physicists, Teachers and Students

    Energy Technology Data Exchange (ETDEWEB)

    Bardeen, Marjorie [Fermilab; Adams, Mark [Illinois U., Chicago; Wayne, Mitchell [Notre Dame U.; Karmgard, Dan [Notre Dame U.; Goussiou, Anna [Washington U., Seattle

    2017-05-02

    The QuarkNet collaboration has forged new, nontraditional relationships among particle physicists, high school teachers and their students. QuarkNet provides professional development for teachers and creates opportunities for teachers and students to engage in particle physics data investigations and join research teams. Embedded in the U.S. particle research community, QuarkNet leverages the nature of particle physics research—the long duration of the experiments with extensive lead times, construction periods, and data collection and analysis periods. QuarkNet is patterned after the large collaborations with a central management infrastructure and a distributed workload across university- and lab-based research groups. We describe the important benefits of the QuarkNet outreach program that flow to university faculty and present successful strategies that others can adapt for use in their countries.

  10. Photoluminescence studies on Cd(1-x)Zn(x)S:Mn2+ nanocrystals.

    Science.gov (United States)

    Sethi, Ruchi; Kumar, Lokendra; Pandey, A C

    2009-09-01

    Highly monodispersed, undoped and doped with Mn2+, binary and ternary (CdS, ZnS, Cd(1-x)Zn(x)S) compound semiconductor nanocrystals have been synthesized by co-precipitation method using citric acid as a stabilizer. As prepared sample are characterized by X-ray diffraction, Small angle X-ray scattering, Transmission electron microscope, Optical absorption and Photoluminescence spectroscopy, for their optical and structural properties. X-ray diffraction, Small angle X-ray scattering and Transmission electron microscope results confirm the preparation of monodispersed nanocrystals. Photoluminescence studies show a significant blue shift in the wavelength with an increasing concentration of Zn in alloy nanocrystals.

  11. Development of a forging technology for the production of high-pressure compressor blades from γ-titanium aluminide. Project C: production of primary wrought material for the forging of turbine blades from gamma-TiAl and their microstructural optimization. Final report

    International Nuclear Information System (INIS)

    Appel, F.; Oehring, M.; Lorenz, U.; Wagner, R.

    1999-01-01

    By the development of a new canning technique which resulted in an effective thermal isolation of can and billet the flow stress mismatch of can and billet material could be minimized, which allowed crack-free and uniform extrusion. Using this technique which has been applied for patent hot extrusion is an effective and matured working method for ingot material. It allows to produce fine-grained and almost fully recrystallized material with increased workability as has been found by the determination of the forging window as well as by the successful forging of more than 200 compressor blades by the project partner Thyssen Umformtechnik. By forging under suited conditions also a microstructural homogenization is achieved in comparison to extruded material. (orig.)

  12. A friction model for cold forging of aluminum, steel and stainless steel provided with conversion coating and solid film lubricant

    DEFF Research Database (Denmark)

    Bay, Niels; Eriksen, Morten; Tan, Xincai

    2011-01-01

    Adopting a simulative tribology test system for cold forging the friction stress for aluminum, steel and stainless steel provided with typical lubricants for cold forging has been determined for varying normal pressure, surface expansion, sliding length and tool/work piece interface temperature...

  13. Developments of New Lubricants for Cold Forging of Stainless Steel

    DEFF Research Database (Denmark)

    Steenberg, Thomas; Christensen, Erik; Olesen, P.

    1997-01-01

    Two new lubricant systems for cold forging of stainless steel have been developed. The main component of these systems are FeCl3 and ZnCa2(PO4)2, respectively. Both lubricant systems have been tested using a backward extrusion test. The results show excellent lubricating properties with respect...

  14. Ageing of forged superaustenitic stainless steel: Precipitate phases and mechanical properties

    Energy Technology Data Exchange (ETDEWEB)

    Anburaj, J., E-mail: janburaj@gmail.com [Department of Metallurgical Engineering, PSG College of Technology, Coimbatore 641 004 (India); Nazirudeen, S.S. Mohamed; Narayanan, R.; Anandavel, B.; Chandrasekar, A. [Department of Metallurgical Engineering, PSG College of Technology, Coimbatore 641 004 (India)

    2012-02-15

    Highlights: Black-Right-Pointing-Pointer Solutionizing of 1250 Degree-Sign C and ageing of 500-1000 Degree-Sign C was done for hot forged SASS. Black-Right-Pointing-Pointer Strength and toughness increased by 25% on hot forged than the cast SASS. Black-Right-Pointing-Pointer Amounts of precipitates after ageing were evaluated by thermo-calc. Black-Right-Pointing-Pointer Sigma forms from chi at 900 Degree-Sign C and contains constant Cr and Mo contents, unlike chi. Black-Right-Pointing-Pointer Sigma is incoherent, contains high Mo and causes low toughness at 900 Degree-Sign C. - Abstract: Cast superaustenitic stainless steel (SASS), of composition 19 wt% Cr, 20 wt% Ni, 7.5 wt% Mo and 0.37 wt% N, is hot forged at 1200 Degree-Sign C. The forging was then solutionized at 1250 Degree-Sign C and aged for 1 h and 10 h at different temperatures in the range of 500-1000 Degree-Sign C. Effect of these treatments on (i) hardness and (ii) fracture toughness based on impact energy is reported. Chi is formed from low temperatures up to 800 Degree-Sign C, and sigma at temperatures above 900 Degree-Sign C. A model is proposed to illustrate the dissolution of chi and sigma in austenite at elevated temperatures. Compared with chi, sigma contains more Mo. Toughness decreased with increasing amounts of chi and sigma precipitates. However, in the temperature range of 850-950 Degree-Sign C, low toughness was observed for relatively a short ageing time, although virtually the volume of sigma phase is very low. This is attributed to the presence of incoherent sigma in austenite matrix. Fractographs of the impact-tested samples indicated an increased tendency for brittle fracture with increasing ageing temperatures (increase in sigma content). Thermodynamic calculations substantiated (i) EDS results of composition of secondary phases present in the aged SASS and (ii) the proposed model. From these studies it is concluded that sigma is enriched in Mo at 900 Degree-Sign C and can be as

  15. Tensile properties of a dual-axial forged Ti–Fe–Cu alloy containing boron

    Energy Technology Data Exchange (ETDEWEB)

    Zadorozhnyy, V.Yu., E-mail: zadorozhnyyvlad@gmail.com [National University of Science and Technology “MISIS”, Leninsky prospect, 4, Moscow 119049 (Russian Federation); Institute for Materials Research, Tohoku University, Katahira 2-1-1, Aoba-Ku, Sendai 980-8577 (Japan); Shchetinin, I.V.; Chirikov, N.V. [National University of Science and Technology “MISIS”, Leninsky prospect, 4, Moscow 119049 (Russian Federation); Louzguine-Luzgin, D.V. [WPI Advanced Institute for Materials Research, Tohoku University, Katahira 2-1-1, Aoba-Ku, Sendai 980-8577 (Japan)

    2014-09-22

    In the present work we introduce a micro/nano-structured α+β Ti-based low-alloy produced by the tilt-casting method and subjected to subsequent thermo-mechanical treatment. After hot dual-axial forging at 900 °C, subsequent heating at 700 °C and water quenching a Ti{sub 94}Fe{sub 3}Cu{sub 3}+1000 ppm of boron alloy, containing inexpensive alloying elements, showed an ultimate tensile strength value of about 950 MPa and percentage elongation of about 5.2%. It is shown that the intensive forging treatment and subsequent heat treatment are leading to significantly improved mechanical properties of such an alloy compared to the as-cast state.

  16. Qualification of laser based additive production for manufacturing of forging Tools

    Directory of Open Access Journals (Sweden)

    Junker Daniel

    2015-01-01

    Full Text Available Mass customization leads to very short product life cycles, so the costs of a tool have to be amortized with a low number of workpieces. Especially for highly loaded tools, like those for forging, that leads to expensive products. Therefore more economical production processes for tool manufacturing have to be investigated. As laser additive manufacturing is already used for the production of moulds for injection moulding, this technology maybe could also improve the forging tool production. Within this paper laser metal deposition, which is industrially used for tool repair, will be investigated for the use in tool manufacturing. Therefore a mechanical characterization of parts built with different laser process parameters out of the hot work tool steel 1.2709 is made by upsetting tests and hardness measurements. So the influence of the additive manufacturing process on the hardness distribution is analysed.

  17. The coarsening effect of SA508-3 steel used as heavy forgings material

    Directory of Open Access Journals (Sweden)

    Dingqian Dong

    2015-01-01

    Full Text Available SA508Gr.3 steel is popularly used to produce core unit of nuclear power reactors due to its outstanding ability of anti-neutron irradiation and good fracture toughness. The forging process takes important role in manufacturing to refine the grain size and improve the material properties. But due to their huge size, heavy forgings cannot be cooled down quickly, and the refined grains usually have long time to grow in high temperature conditions. If the forging process is not adequately scheduled or implemented, very large grains up to millimetres in size may be found in this steel and cannot be eliminated in the subsequent heat treatment. To fix the condition which may causes the coarsening of the steel, hot upsetting experiments in the industrial production environment were performed under different working conditions and the corresponding grain sizes were measured and analysed. The observation showed that the grain will abnormally grow if the deformation is less than a critical value. The strain energy takes a critical role in the grain evolution. If dynamic recrystallization consumes the strain energy as much as possible, the normal grains will be obtained. While if not, the stored strain energy will promote abnormal growth of the grains.

  18. Physical properties of Zr50Cu40-xAl10Pdx bulk glassy alloys

    International Nuclear Information System (INIS)

    Wencka, M.; Jagodic, M.; Gradisek, A.; Kocjan, A.; Jaglicic, Z.; McGuiness, P.J.; Apih, T.; Yokoyama, Y.; Dolinsek, J.

    2010-01-01

    It was shown recently (Yokoyama et al. ) that the addition of a small amount of Pd to the Zr 50 Cu 40 Al 10 bulk glassy alloy (BGA) has a beneficial effect on fatigue-strength enhancement, where the composition Zr 50 Cu 37 Al 10 Pd 3 behaved in a resonant-like way by showing the highest fatigue limit of 1050 MPa and the minimum Vickers hardness. We performed a study of the magnetic properties, the specific heat, the electrical resistivity and the hydrogen-diffusion constant for a series of compositions Zr 50 Cu 40-x Al 10 Pd x (x = 0-7 at.%), in order to determine their physical properties and to check for the influence of the Pd content on these properties. The Zr 50 Cu 40-x Al 10 Pd x BGAs are nonmagnetic, conducting alloys, where the Pauli spin susceptibility of the conduction electrons is the only source of paramagnetism. The low-temperature specific heat indicates an enhancement of the conduction-electron effective mass m* below 5 K, suggesting that the Zr 50 Cu 40-x Al 10 Pd x BGAs are not free-electron-like compounds. The electrical resistivities of the Zr 50 Cu 40-x Al 10 Pd x BGAs amount to about 200 μΩ cm and show a small, negative temperature coefficient (NTC) with an increase from 300 to 2 K of 4%. The hydrogen self-diffusion constant D in hydrogen-loaded samples shows classical over-barrier-hopping temperature dependence and is of comparable magnitude to the related icosahedral and amorphous Zr 69.5 Cu 12 Ni 11 Al 7.5 hydrogen-storage alloys. No correlation between the investigated physical parameters and the Pd content of the samples could be observed.

  19. Crystallographic and 119Sn and 155Gd Moessbauer analyses of Gd5Ge2(Si1-xSnx)2 (x = 0.23 and x = 0.40)

    International Nuclear Information System (INIS)

    Campoy, J. C. P.; Santos, A. O. dos; Cardoso, L. P.; Paesano, A.; Raposo, M. T.; Fabris, J. D.

    2010-01-01

    We report the structural characterization of Gd 5 Ge 2 (Si 1-x Sn x ) 2 (x = 0.23 and x = 0.40) compounds by means of 100 and 298 K-X-ray diffractometry (XRD) and 4 K- 155 Gd and 298 K- 119 Sn Moessbauer spectroscopy. These compounds order ferromagnetically at 218.4 and 172.7 K, respectively. At ∼100 K, it was identified the Gd 5 Si 4 -orthorhombic phase (type I) for both samples. At ∼298 K, it was identified a Gd 5 Si 2 Ge 2 -monoclinic phase, for x = 0.23 and a Sm 5 Sn 4 -orthorhombic phase (type II), for x 0.40. The Rietveld analysis of XRD data suggests a first order magneto-structural transition at Curie temperature for both compositions. Moessbauer results are well consistent with the proposed crystallographic models for these systems.

  20. The high energy X-ray spectrum of 4U 0900-40 observed from OSO 8

    Science.gov (United States)

    Dolan, J. F.; Crannell, C. J.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.; Ellison, D. C.

    1981-01-01

    The X-ray source 4U 0900-40 (= Vela XR-1) was observed with the high-energy X-ray spectrometer on OSO 8 for one week in 1976 and three weeks in 1978. Spectra of the source are presented above 16 keV. No systematic difference exists between the X-ray eclipse centers and the eclipse centers predicted from optical ephermerides. Short period intrinsic variability in the system's X-ray intensity may be related to changes in the Compton scattering optical depth in the system and does not require sporadic mass transfer via Roche lobe overflow. The 282 s modulation in the source's X-ray flux above 21 keV consists of two essentially similar pulses per period, most easily interpreted as arising from the two different magnetic poles of a rotating neutron star. The secondary appears to be a spherically accreting, magnetic neutron star.

  1. AC conductivity and dielectric properties of amorphous GexSb40-xSe60 thin films

    International Nuclear Information System (INIS)

    Atyia, H.E.; Farid, A.M.; Hegab, N.A.

    2008-01-01

    Measurements of AC conductivity and dielectric properties have been made for chalcogenide film samples of Ge x Sb 40-x Se 60 (with x=0, 10 and 20 at%) at different temperatures (303-393 K) and various frequencies (10 2 -10 5 Hz). It was found that the AC conductivity obeys the law σ(ω, T)=Aω s . The exponent s 1 and dielectric loss ε 2 were found to decrease with frequency and increase with temperature. The maximum barrier height W M was calculated from dielectric measurements according to the Guintini equation. It was found that the obtained value of W m agrees with that proposed by the theory of hopping of charge carriers over potential barrier as suggested by Elliott in case of chalcogenide glasses. The density of localized states N(E F ) has also been calculated for the studied compositions. The effect of decreasing the Sb content at the expense of the Ge content was investigated for the obtained results of the studied parameters

  2. Repetitive forging (RF) using inclined punches as a new bulk severe plastic deformation method

    Energy Technology Data Exchange (ETDEWEB)

    Babaei, A. [Department of Mechanical Engineering, University College of Engineering, University of Tehran, Tehran 11155-4563 (Iran, Islamic Republic of); Faraji, G., E-mail: ghfaraji@ut.ac.ir [Department of Mechanical Engineering, University College of Engineering, University of Tehran, Tehran 11155-4563 (Iran, Islamic Republic of); Department of Engineering Design and Manufacture, University of Malaya, 50603 Kuala Lumpur (Malaysia); Mashhadi, M.M. [Department of Mechanical Engineering, University College of Engineering, University of Tehran, Tehran 11155-4563 (Iran, Islamic Republic of); Hamdi, M. [Department of Engineering Design and Manufacture, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2012-12-15

    A new bulk severe plastic deformation method based on repetitive forging (RF) using inclined punches is proposed. This process consists of two half cycles. In the first half cycle, a square cross section deforms to parallelogram by forging with two inclined punches, and the parallelogram cross section is forged back to square using two flat punches in the second half cycle. This method was applied to commercially pure copper and significant grain refinement was achieved after four passes of RF. The results showed that significant improvement in the mechanical properties was obtained. Notable increase of yield and ultimate strengths corresponding to 358 MPa and 381 MPa after four passes of RF from the initial values of 121 MPa and 230.5 MPa is detectable. Microhardness increases to about 100 Hv after four passes of RF from the initial value of 53 Hv. Finite element (FE) results illustrate that RF is able to impose extremely high plastic strains to the materials. In the RF process, the processed samples have the same dimensions and geometry as those of the initial sample without any waste material and there is no need for back pressure.

  3. Wear Improvement of Tools in the Cold Forging Process for Long Hex Flange Nuts.

    Science.gov (United States)

    Hsia, Shao-Yi; Shih, Po-Yueh

    2015-09-25

    Cold forging has played a critical role in fasteners and has been widely used in automotive production, manufacturing, aviation and 3C (Computer, Communication, and Consumer electronics). Despite its extensive use in fastener forming and die design, operator experience and trial and error make it subjective and unreliable owing to the difficulty of controlling the development schedule. This study used finite element analysis to establish and simulate wear in automotive repair fastener manufacturing dies based on actual process conditions. The places on a die that wore most quickly were forecast, with the stress levels obtained being substituted into the Archard equation to calculate die wear. A 19.87% improvement in wear optimization occurred by applying the Taguchi quality method to the new design. Additionally, a comparison of actual manufacturing data to simulations revealed a nut forging size error within 2%, thereby demonstrating the accuracy of this theoretical analysis. Finally, SEM micrographs of the worn surfaces on the upper punch indicate that the primary wear mechanism on the cold forging die for long hex flange nuts was adhesive wear. The results can simplify the development schedule, reduce the number of trials and further enhance production quality and die life.

  4. Influence of sulphur and phosphorus impurities on ductility of 25Kh2NMFA steel during forging

    International Nuclear Information System (INIS)

    Onishchenko, A.K.

    1989-01-01

    Using cylindrical samples of the 25Kh2NMFA steel with sulfur and phosphorus content in the range of 0.001-0.030%, tensile test with the rate of deformation 10 -3 s -1 at the temperatures of 800-1200 deg C has been conducted. Analysis of fracture foci and plasticity diagrams has shown, that to ensure ductility during forging and high mechanical properties, the content of sulfur and phosphorus impurities in the 25Kh2NMFA steel must not exceed 0.015%

  5. 76 FR 8773 - Forged Stainless Steel Flanges From India and Taiwan

    Science.gov (United States)

    2011-02-15

    ... INTERNATIONAL TRADE COMMISSION [Investigation Nos. 731-TA-639 and 640 (Third Review)] Forged Stainless Steel Flanges From India and Taiwan AGENCY: United States International Trade Commission. ACTION... Taiwan would be likely to lead to continuation or recurrence of material injury. On January 31, 2011, the...

  6. A Probabilistic Analysis of the Nxt Forging Algorithm

    Directory of Open Access Journals (Sweden)

    Serguei Popov

    2016-12-01

    Full Text Available We discuss the forging algorithm of Nxt from a probabilistic point of view, and obtain explicit formulas and estimates for several important quantities, such as the probability that an account generates a block, the length of the longest sequence of consecutive blocks generated by one account, and the probability that one concurrent blockchain wins over an- other one. Also, we discuss some attack vectors related to splitting an account into many smaller ones.

  7. The Simulation and Analysis of the Closed Die Hot Forging Process by A Computer Simulation Method

    Directory of Open Access Journals (Sweden)

    Dipakkumar Gohil

    2012-06-01

    Full Text Available The objective of this research work is to study the variation of various parameters such as stress, strain, temperature, force, etc. during the closed die hot forging process. A computer simulation modeling approach has been adopted to transform the theoretical aspects in to a computer algorithm which would be used to simulate and analyze the closed die hot forging process. For the purpose of process study, the entire deformation process has been divided in to finite number of steps appropriately and then the output values have been computed at each deformation step. The results of simulation have been graphically represented and suitable corrective measures are also recommended, if the simulation results do not agree with the theoretical values. This computer simulation approach would significantly improve the productivity and reduce the energy consumption of the overall process for the components which are manufactured by the closed die forging process and contribute towards the efforts in reducing the global warming.

  8. Forging Consensus for Implementing Youth Socialization Policy in Northwest China

    Science.gov (United States)

    Fairbrother, Gregory P.

    2011-01-01

    The goal of this article is to examine how the provincial education media in China play a role of forging consensus among local actors responsible for the implementation of new centrally-promulgated youth socialization policy. In doing so, it also explores the tension among three of the Chinese state's claims to legitimacy: economic development,…

  9. Laser-fusion 40Ar/39Ar Ages of Darwin Impact Glass

    Science.gov (United States)

    Lo, Ching-Hua; Howard, Kieren T.; Chung, Sun-Lin; Meffre, Sebastien

    2002-11-01

    Three samples of Darwin Glass, an impact glass found in Tasmania, Australia at the edge of the Australasian tektite strewn field were dated using the 40Ar/39Ar single-grain laser fusion technique, yielding isochron ages of 796-815 ka with an overall weighted mean of 816 ± 7 ka. These data are statistically indistinguishable from those recently reported for the Australasian tektites from Southeast Asia and Australia (761-816 ka; with a mean weighted age of 803 ± 3 ka). However, considering the compositional and textural differences and the disparity from the presumed impact crater area for Australasian tektites, Darwin Glass is more likely to have resulted from a distinct impact during the same period of time.

  10. Large forging manufacturing process

    Science.gov (United States)

    Thamboo, Samuel V.; Yang, Ling

    2002-01-01

    A process for forging large components of Alloy 718 material so that the components do not exhibit abnormal grain growth includes the steps of: a) providing a billet with an average grain size between ASTM 0 and ASTM 3; b) heating the billet to a temperature of between 1750.degree. F. and 1800.degree. F.; c) upsetting the billet to obtain a component part with a minimum strain of 0.125 in at least selected areas of the part; d) reheating the component part to a temperature between 1750.degree. F. and 1800.degree. F.; e) upsetting the component part to a final configuration such that said selected areas receive no strains between 0.01 and 0.125; f) solution treating the component part at a temperature of between 1725.degree. F. and 1750.degree. F.; and g) aging the component part over predetermined times at different temperatures. A modified process achieves abnormal grain growth in selected areas of a component where desirable.

  11. Sample (S): SE40_S24 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE40_S24 Solanum lycopersicum Kyotemari fruit Solanum lycopersicum NCBI taxonomy:40...81 Solanum lycopersicum Kyotemari fruit are grown in greenhouses of the Experimental Farm of Kyoto University (Takatsuki, Osaka, Japan) from winter 2013 to spring 2014. ...

  12. Fatigue properties of high-strength materials used in cold-forging tools

    DEFF Research Database (Denmark)

    Brøndsted, P.; Skov-Hansen, P.

    1998-01-01

    In the present work classical analytical models are used to describe the static stress–strain curves, low-cycle fatigue properties and fatigue crack growth behaviour of high-strength materials for use in tools for metal-forming processes such as cold forging and extrusion. The paper describes the...

  13. Developments of steel fabrication processes for castings and ingots for forgings

    International Nuclear Information System (INIS)

    Fernandez, S.

    1980-01-01

    This chapter deals with a series of technological developments in the manufacture of steels which have occurred during the last years, in particular reporting the results obtained in Reinosa with some of these methods in the fabrication of castings as well as forgings and rolled products. (author)

  14. 75 FR 67110 - Forged Stainless Steel Flanges From India and Taiwan

    Science.gov (United States)

    2010-11-01

    ... Stainless Steel Flanges From India and Taiwan AGENCY: United States International Trade Commission. ACTION... India and Taiwan. SUMMARY: The Commission hereby gives notice that it has instituted reviews pursuant to... the antidumping duty orders on forged stainless steel flanges from India and Taiwan would be likely to...

  15. 5 K extended X-ray absorption fine structure and 40 K 10-s resolved extended X-ray absorption fine structure studies of photolyzed carboxymyoglobin

    International Nuclear Information System (INIS)

    Teng, T.Y.; Huang, H.W.; Olah, G.A.

    1987-01-01

    A previous extended X-ray absorption fine structure (EXAFS) study of photolyzed carboxymyoglobin (MbCO) has provoked much discussion on the heme structure of the photoproduct (Mb*CO). The EXAFS interpretation that the Fe-Co distance increases by no more than 0.05 A following photodissociation has been regarded as inconsistent with optical, infrared, and magnetic susceptibility studies. The present experiment was performed with well-characterized dry film samples in which MbCO molecules were embedded in a poly(vinyl alcohol) matrix. The sample had a high protein concentration (12 mM) to yield adequate EXAFS signals but was very thin (40 μm) so that complete photolysis could be easily achieved by a single flash from a xenon lamp. Although the electronic state of Mb*CO resembles that of deoxymyoglobin (deoxy-Mb), direct comparison of EXAFS spectra indicates that structurally Mb*CO is much closer to MbCO than to deoxy-Mb. Our EXAFS analysis shows that photolysis of MbCO at 5 K leads to a stable intermediate state in which CO has moved away from iron by a distance of 0.27-0.45 A, but the 5-coordinate heme structure is strained in a form similar to that of MbCO; the resolution of the CO position depends on the structure parameters of MbCO which we use as a reference for the analysis of Mb*CO. At 40 K, from 1 to 10 s after photolysis, 42% of the photoproduct has relaxed to the ground state, and the EXAFS spectrum of the remaining photoproduct is indistinguishable from that of the 5 K photoproduct

  16. SOFT X-RAY IRRADIATION OF H{sub 2}S ICE AND THE PRESENCE OF S{sub 2} IN COMETS

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez-Escobar, A.; Munoz Caro, G. M. [Centro de Astrobiologia (CSIC-INTA), Carretera de Ajalvir, km 4, Torrejon de Ardoz, 28850 Madrid (Spain); Ciaravella, A.; Candia, R.; Micela, G. [INAF-Osservatorio Astronomico di Palermo, P.za Parlamento 1, 90134 Palermo (Italy); Cecchi-Pestellini, C., E-mail: munozcg@cab.inta-csic.es [INAF-Osservatorio Astronomico di Cagliari, Strada n.54, Loc. Poggio dei Pini, I-09012 Capoterra (Canada) (Italy)

    2012-06-01

    Little is known about the effects of X-rays in interstellar ices. To understand the sulfur depletion in dense clouds and the presence of S{sub 2} in comets, we simulated experimentally the soft X-ray processing (0.3 keV) of H{sub 2}S ice for the first time. Experiments were performed under ultrahigh vacuum conditions at 8 K using infrared and quadrupole mass spectrometry to monitor the solid and gas phases, respectively. A UV irradiation experiment using a similar dose was made for comparison. After X-ray irradiation, an infrared absorption appears near 4.0 {mu}m which is attributed to H{sub 2}S{sub 2} formation in the ice. This identification is also supported by the desorption at 133 K of m/z 66, 65, 64, corresponding to the mass fragments of H{sub 2}S{sub 2}. The H{sub 2}S{sub 2} species is expected to be present in interstellar and cometary ices that were processed by X-rays. Further irradiation leads to dissociation of this molecule forming S{sub 2} and larger S-molecules up to S{sub 8}, which may explain the depletion of sulfur in dense clouds. CS{sub 2} was so far the parent molecule proposed for S{sub 2} formation in comets. But the abundance of H{sub 2}S{sub 2}, formed by irradiation of pure H{sub 2}S or H{sub 2}S in an H{sub 2}O-ice matrix, should be larger than that of CS{sub 2} in the ice, the latter requiring a carbon source for its formation. Based on our experimental results, we propose that S{sub 2} in comets could be formed by dissociation of H{sub 2}S{sub 2} in the ice.

  17. Ferromagnetic resonance studies on (Co{sub 40}Fe{sub 40}B{sub 20}){sub x}(SiO{sub 2}){sub 1-x} granular magnetic films

    Energy Technology Data Exchange (ETDEWEB)

    Yildiz, F. [Department of Physics, Faculty of Sciences and Arts, Celal Bayar University, Muradiye/Manisa (Turkey) and Department of Physics, Electron Spin Science Center, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of)]. E-mail: fyildiz@gyte.edu.tr; Kazan, S. [Gebze Institute of Technology, 41400 Gebze-Kocaeli (Turkey); Aktas, B. [Gebze Institute of Technology, 41400 Gebze-Kocaeli (Turkey); Tarapov, S.I. [Institute of Radiophysics and Electronics, National Academy of Sciences of Ukraine, Kharkov 61085 (Ukraine); Tagirov, L. [Gebze Institute of Technology, 41400 Gebze-Kocaeli (Turkey); Granovsky, B. [Moscow State University, 119992 Moscow (Russian Federation)

    2006-10-15

    Magnetic properties of granular (Co{sub 40}Fe{sub 40}B{sub 20}){sub x}(SiO{sub 2}){sub 1-x} thin films (x=0.37-0.53) have been studied by ferromagnetic resonance (FMR) technique. Samples have been prepared by ion-beam deposition of Co-Fe-B particles and SiO{sub 2} on sitall ceramic substrate. The FMR measurements have been done for different orientations of DC magnetic field with respect to the sample plane. It was found that the deduced value of effective magnetization from FMR data of the thin granular film is reduced by the volume-filling factor of the bulk saturation magnetization. The overall magnetization changes from 152 to 515G depending on the ratio of the magnetic nanoparticles in the SiO{sub 2} matrix. From angular measurements an induced in-plane uniaxial anisotropy has been obtained due to the preparation of the film conditions as well.

  18. Medium carbon vanadium steels for closed die forging; Acos de medio carbono microligados ao vanadio para forjaria em matriz fechada

    Energy Technology Data Exchange (ETDEWEB)

    Jeszensky, Gabor; Plaut, Ronald Lesley

    1994-12-31

    This work analyses the medium carbon micro alloyed vanadium potential for closed die forged production. The steels reach the mechanical resistance requests during cooling after forging, eliminating the subsequent thermal treatment. Those steels also present good fatigue resistance and machinability. The industrial scale experiments are also reported 16 refs., 21 figs.

  19. A coupled thermo-mechanical pseudo inverse approach for preform design in forging

    Science.gov (United States)

    Thomas, Anoop Ebey; Abbes, Boussad; Li, Yu Ming; Abbes, Fazilay; Guo, Ying-Qiao; Duval, Jean-Louis

    2017-10-01

    Hot forging is a process used to form difficult to form materials as well as to achieve complex geometries. This is possible due to the reduction of yield stress at high temperatures and a subsequent increase in formability. Numerical methods have been used to predict the material yield and the stress/strain states of the final product. Pseudo Inverse Approach (PIA) developed in the context of cold forming provides a quick estimate of the stress and strain fields in the final product for a given initial shape. In this paper, PIA is extended to include the thermal effects on the forging process. A Johnson-Cook thermo-viscoplastic material law is considered and a staggered scheme is employed for the coupling between the mechanical and thermal problems. The results are compared with available commercial codes to show the efficiency and the limitations of PIA.

  20. Improved detection of the KIT D816V mutation in patients with systemic mastocytosis using a quantitative and highly sensitive real-time qPCR assay

    DEFF Research Database (Denmark)

    Kielsgaard Kristensen, Thomas; Vestergaard, Hanne; Møller, Michael Boe

    2011-01-01

    The vast majority of patients with systemic mastocytosis (SM) carry the somatic D816V mutation in the KIT gene. The KIT D816V mutation is one of the minor criteria for a diagnosis of SM according to the 2008 World Health Organization classification of myeloproliferative neoplasms. In the present ...

  1. Optimum back-pressure forging using servo die cushion

    OpenAIRE

    Kawamoto, Kiichiro; Yoneyama, Takeshi; Okada, Masato; Kitayama, Satoshi; Chikahisa, Junpei

    2014-01-01

    This study focused on utilizing a servo die cushion (in conjunction with a servo press) as a "back-pressure load generator," to determine its effect on shape accuracy of the formed part and total forming load in forward extrusion during cold forging. The effect of back-pressure load application was confirmed in experiments, and the optimum setting pattern of back-pressure load was considered to minimize both shape accuracy of the formed part and back-pressure energy, which was representative ...

  2. Fatigue behavior of rolled and forged tungsten at 25°, 280° and 480 °C

    International Nuclear Information System (INIS)

    Habainy, J.; Iyengar, S.; Lee, Y.; Dai, Y.

    2015-01-01

    Pure tungsten has been chosen as the target material at the European Spallation Source facility in Lund. Calculations show that the target temperature can reach 500 °C momentarily during the spallation process, leading to thermal fatigue. Target life estimations require fatigue data at different temperatures and this work focuses on generating such data for pure, unirradiated, rolled and forged tungsten in the range 25°–480 °C. For specimens oriented in the rolling direction, tensile tests at room temperature indicated Young's modulus values in the range 320–390 GPa, low levels of plasticity (<0.23%) and UTS values in the range 397 MPa (unpolished) and 705 MPa (Polished). UTS for forged specimens were around 500 MPa. Stress-controlled fatigue tests were conducted in the tensile regime, with a runout limit of 2 × 10"6 cycles. At 25 °C, unpolished specimens had fatigue limits of 150 MPa (rolling and transverse direction), and 175 MPa (forged). For polished specimens in the rolling direction, fatigue limits were higher at 237.5 MPa (25 °C) and 252.5 MPa (280 °C). The forged specimens showed slightly better fatigue properties and marginal cyclic hardening at 480 °C. - Highlights: • Stress & strain-controlled fatigue tests on pure tungsten at 25°, 280° & 480 °C. • Unirradiated, rolled and forged specimens in polished and unpolished condition. • Min. tensile strength (MPa): 397 (25 °C), 472 (280 °C) and 363 (480 °C). • Min. endurance limit (MPa): 137.5 (25 °C), 250 (280 °C) and 150 (480 °C). • Marginal cyclic hardening observed at 480 °C.

  3. Best possible heat treatment of steel SA 336 F22 for the production of forged shells with heavy walls

    International Nuclear Information System (INIS)

    Badeau, J.P.; Poitrault, I.S.; De Badereau, A.; Blondeau, R.P.

    1986-01-01

    The manufacturing of thick-wall components, such as shells, for petrochemical reactors normally requires the 2.25Cr-1Mo(SA 336 F22) steel. This paper deals with: 1. Experienced difficulties in producing thick-wall forgings up to a thickness of 500 mm with standard 2.25Cr-1Mo steel. 2. The solutions offered by Le Creusot Heavy Forge. The studies discussed are: (1) the effect of the structure; (2) the effect of the chemical composition on hardenability and temper embrittlement in steel making; and (3) the effect of austenitization conditions. Some examples concerning industrial forgings are presented, among them: 1. The manufacturing of shells for the petrochemical industry. 2. A thick-wall shell from a 146-metric ton hollow ingot

  4. Ab-initio calculations of Co-based diluted magnetic semiconductors Cd 1-xCoxX (X=S, Se, Te)

    KAUST Repository

    Saeed, Yasir

    2010-10-01

    Ab-initio calculations are performed to investigate the structural, electronic and magnetic properties of spin-polarized diluted magnetic semiconductors composed of IIVI compounds Cd1-xCoxX (X=S, Se, Te) at x=0.25. From the calculated results of band structure and density of states, the half-metallic character and stability of ferromagnetic state for Cd1-xCoxS, Cd1-xCoxSe and Cd 1-xCoxTe alloys are determined. It is found that the tetrahedral crystal field gives rise to triple degeneracy t2g and double degeneracy eg. Furthermore, we predict the values of spin-exchange splitting energies Δx(d) and Δ x(p-d) and exchange constants N0α and N 0β produced by the Co 3d states. Calculated total magnetic moments and the robustness of half-metallicity of Cd1-xCo xX (X=S, Se, Te) with respect to the variation in lattice parameters are also discussed. We also extend our calculations to x=0.50, 0.75 for S compounds in order to observe the change due to increase in Co. © 2010 Elsevier B.V.

  5. 40_245 - 250_Hussaini, A. Ahmad and S. Sani

    African Journals Online (AJOL)

    user pc

    Bajopas Volume 10 Number 2 December, 2017. Table 4: Conductivity measurement of the complex compounds. Complexes. Concentration moldm-3. Electrical conductivity ohm-1 cm-1. Molar conductivity ohm-1cm2 mol-1. [NiL2]. 2H2O. 1 x 10-3. 9.40x10-6. 94.0. [CuL2]. 2H2O. 1 x 10-3. 6.85x10-6. 68.5. Table 5: Infrared ...

  6. Evolution of the Ultrasonic Inspection of Heavy Rotor Forgings Over the Last Decades

    Science.gov (United States)

    Zimmer, A.; Vrana, J.; Meiser, J.; Maximini, W.; Blaes, N.

    2010-02-01

    All types of heavy forgings that are used in energy machine industry, rotor shafts as well as discs, retaining rings or tie bolts are subject to extensive nondestructive inspections before they are delivered to the customer. Due to the availability of the parts in simple shapes, these forgings are very well suited for full volmetric inspections using ultrasound. In the beginning, these inspections were carried out manually, using straight beam probes and analogue equipment. Higher requirements in reliability, efficiency, safety and power output in the machines have lead to higher requirements for the ultrasonic inspection in the form of more scanning directions, higher sensitivity demands and improved documentation means. This and the increasing use of high alloy materials for ever growing parts, increase the need for more and more sophisticated methods for testing the forgings. Angle scans and sizing technologies like DGS have been implemented, and for more than 15 years now, mechanized and automated inspections have gained importance since they allow better documentation as well as easier evaluation of the recorded data using different views (B- C- or D-Scans), projections or tomography views. The latest major development has been the availability of phased array probes to increase the flexibility of the inspection systems. Many results of the ongoing research in ultrasonic's have not been implemented yet. Today's availability of fast computers, large and fast data storages allows saving RF inspection data and applying sophisticated signal processing methods. For example linear diffraction tomography methods like SAFT offer tools for 3D reconstruction of inspection data, simplifying sizing and locating of defects as well as for improving signal to noise ratios. While such methods are already applied in medical ultrasonic's, they are still to be implemented in the steel industry. This paper describes the development of the ultrasonic inspection of heavy forgings

  7. Glass forming ability and magnetic properties of Co{sub (40.2−x)}Fe{sub (20.1+x)}Ni{sub 6.7}B{sub 22.7}Si{sub 5.3}Nb{sub 5} (x=0–10) bulk metallic glasses produced by suction casting

    Energy Technology Data Exchange (ETDEWEB)

    Sarlar, Kagan [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey); Physics Department, Kamil Ozdag Faculty of Sciences, Karamanoglu Mehmetbey University, YunusEmre Campus, 70100 Karaman (Turkey); Kucuk, Ilker, E-mail: ikucuk@uludag.edu.tr [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey)

    2015-01-15

    The effect of Fe concentration on the glass forming ability (GFA) and magnetic properties in Co{sub (40.2−x)}Fe{sub (20.1+x)}Ni{sub 6.7}B{sub 22.7}Si{sub 5.3}Nb{sub 5} (x=0–10) bulk metallic glasses were investigated. By suction casting method, the bulk metallic glasses with diameters up to 2 mm were produced. We try to find out which Fe concentration makes an influence on Co based system's magnetic properties and glass forming ability. The curves of thermal analysis, obtained using differential scanning calorimetry (DSC), show that the Co{sub (40.2−x)}Fe{sub (20.1+x)}Ni{sub 6.7}B{sub 22.7}Si{sub 5.3}Nb{sub 5} (x=0–10) have a supercooled liquid region (∆T{sub x}) of about 44 K. The saturation magnetizations (J{sub s}) for as-cast BMG alloys were in the range of 0.62 T−0.81 T. - Highlights: • The effect of Fe concentration on the glass forming ability. • The substitution of an appropriate amount of Fe can enhance the GFA. • The substitution of Fe for Co also improves soft magnetic properties of the BMGs. • The high of J{sub s} 0.62−0.81 T with a low H{sub c} of 2−289 A/m of the alloys.

  8. Repair in mouse lung of multifraction X rays and neutrons: extension to 40 fractions

    International Nuclear Information System (INIS)

    Parkins, C.S.; Fowler, J.F.

    1985-01-01

    Repair parameters were calculated from measurements of breathing rate and lethality at monthly intervals up to 17 months after irradiation with 1, 10, 20 or 40 equal fractions, down to 1.1 Gy of x-rays and 0.18 Gy of 3 MeV neutrons per fraction. Sparing of neutron damage was negligible when the neutron dose was divided into multiple fractions; progressively greater repair of lung damage was seen after increasing x-ray fractions. Significant increase in the iso-effect dose for 40 x-ray fractions was found compared with 20, even at two fractions per day at six hour intervals, as was the case in the 40 fraction experiment. Data were well fitted by the linear quadratic formula for response vs. dose per fraction and the ratio γ/β yielded values of approx. 3 Gy after x-rays and 30 to 40 Gy after neutron irradiation, not different from γ/β ratios found for up to 20 fractions. Single dose RBE was less than 2, increasing to about six at the lowest dose per fraction measured, agreeing with previous results. The ratio of the γ component for neutrons to that for x-rays was approx. 8, which is therefore the limiting RBE predicted for infinitely small fractional doses. (U.K.)

  9. Characterization of nanostructured photosensitive (NiS)x(CdS)(1-x) composite thin films grown by successive ionic layer adsorption and reaction (SILAR) route

    International Nuclear Information System (INIS)

    Ubale, A.U.; Bargal, A.N.

    2011-01-01

    Highlights: → Thin films of (NiS) x (CdS) (1-x) with variable composition (x = 1 to 0) were deposited onto glass substrates by the successive ionic layer adsorption and reaction (SILAR) method. → The structural, surface morphological and electrical characterizations of the as deposited and annealed films were studied. → The bandgap and activation energy of annealed (NiS) x (CdS) (1-x) film decrease with improvement in photosensitive nature. -- Abstract: Recently ternary semiconductor nanostructured composite materials have attracted the interest of researchers because of their photovoltaic applications. Thin films of (NiS) x (CdS) (1-x) with variable composition (x = 1-0) had been deposited onto glass substrates by the successive ionic layer adsorption and reaction (SILAR) method. As grown and annealed films were characterised by X-ray diffraction, scanning electron microscopy and EDAX to investigate structural and morphological properties. The (NiS) x (CdS) (1-x) films were polycrystalline in nature having mixed phase of rhombohedral and hexagonal crystal structure due to NiS and CdS respectively. The optical and electrical properties of (NiS) x (CdS) (1-x) thin films were studied to determine compsition dependent bandgap, activation energy and photconductivity. The bandgap and activation energy of annealed (NiS) x (CdS) (1-x) film decrease with improvement in photosensitive nature.

  10. Engine piston assembly and forged piston member therefor having a cooling recess

    Energy Technology Data Exchange (ETDEWEB)

    Cooper, B.C.; Erickson, K.L.; Green, J.A.; Nyez, D.S.

    1989-09-19

    This patent describes a forged steel piston member for reciprocating movement in an engine. It comprises: an upper portion of substantially cylindrical shape and having a central axis, a top surface, a tubular wall depending from the top surface and having a peripheral groove adapted to receive a sealing ring, a lower end surface, and an inwardly facing wall surface extending upwardly from the lower end surface. The upper portion further includes an outwardly facing wall surface spaced radially inwardly from the inwardly facing wall surface and a downwardly facing transition portion blendingly associated with the inwardly and outwardly facing wall surfaces to collectively define an annular cooling recess, the transition portion being elevational spaced a relatively short distance from the top surface; and the inwardly facing wall surface being a machined surface of revolution about the central axis integral or one-piece forging.

  11. Potencial genético de progênies de feijão-caupi segregantes quanto ao tipo da inflorescência

    Directory of Open Access Journals (Sweden)

    Fábio Ribeiro Barros

    2011-02-01

    Full Text Available O objetivo deste trabalho foi avaliar o potencial genético produtivo de progênies de feijão-caupi (Vigna unguiculata segregantes quanto ao tipo da inflorescência. Foram avaliadas 68 progênies F4 obtidas dos retrocruzamentos: (TV x 5058-09C x Cacheado-roxo x TV x 5058-09C e (AU94-MOB-816 x Cacheado-roxo x AU94-MOB-816, com os genitores. Dois experimentos foram conduzidos no delineamento de blocos ao acaso, tendo-se avaliado 17 progênies, com quatro repetições, em parcelas subdivididas quanto à inflorescência: simples e composta. A análise estatística foi realizada por modelos mistos via procedimento REML/BLUP. As estimativas das variâncias genéticas foram significativas para todos os caracteres estudados. Os caracteres comprimento do pedúnculo, número médio de vagens por pedúnculo e floração inicial apresentaram alta variabilidade e expressão do componente genético para a inflorescência composta. As progênies de inflorescência simples apresentam potencial genético produtivo similar às progênies de inflorescência composta. As progênies resultantes do retrocruzamento (AU94-MOB-816 x Cacheado-roxo x AU94-MOB-816 são promissoras como estratégia para aumentar os níveis atuais de produtividade do feijão-caupi.

  12. Lax-Phillips scattering theory with perturbations of the type: V(x)=(φ(x))/|x|β, where β=2-(n)/s, φ is an element of Ls(Rn), s > 2 and s ≥ (n)/2

    International Nuclear Information System (INIS)

    Brambila-Paz, F.; Duong Minh Duc.

    1990-12-01

    A scattering theory for the wave equation with compactly supported perturbations was developed by Lax-Phillips in 1967. Using Enss approach, Phillips developed a Lax-Phillips scattering theory with short range perturbations of the type: V(x)=o((1)/|x| β ), β > 2. In this paper we develop a scattering theory for more general perturbations, i.e. for V(x)=(φ(x))/|x| β , where β=2-(n)/s, φ is an element of L s (R n ), s > 2 and s ≥ (n)/2. Refs

  13. Study on antioxidant experiment on forged steel tube sheet and tube hole for steam generator

    International Nuclear Information System (INIS)

    Zong Hai; Wang Detai; Ding Yang

    2012-01-01

    Antioxidant experiment on forged steel tube sheet and tube hole for steam generator was studied and the influence of different simulated heat treatments on the antioxidant performance of tube sheet and tube hole was made. The influence of different antioxidant methods on the size of tube hole was drawn. Furthermore, the change of size and weight of 18MnD5 forged steel tube sheet on the condition of different simulated heat treatments was also studied. The analytical results have proved reference information for the use of 18MnD5 material and for key processes of processing tube hole and wearing and expanding U-style tube. (authors)

  14. Social Work and Engineering Collaboration: Forging Innovative Global Community Development Education

    Science.gov (United States)

    Gilbert, Dorie J.

    2014-01-01

    Interdisciplinary programs in schools of social work are growing in scope and number. This article reports on collaboration between a school of social work and a school of engineering, which is forging a new area of interdisciplinary education. The program engages social work students working alongside engineering students in a team approach to…

  15. Forgings made of austenitic chromium-nickel steels for the low temperature range

    International Nuclear Information System (INIS)

    Gruendler, O.; Schwarz, W.; Koren, M.

    1981-01-01

    The authors discuss the low temperature application of austenitic chromium-nickel steels for energy production and process techniques. Material requirements are presented, and the behaviour, mechanical and physical properties of such steels are discussed. The manufacture of forgings is considered and test results presented. (Auth.)

  16. Forgings made of austenitic chromium-nickel steels for the low temperature range

    Energy Technology Data Exchange (ETDEWEB)

    Gruendler, O.; Schwarz, W.; Koren, M. (Vereinigte Edelstahlwerke A.G. (VEW), Kapfenberg (Austria))

    1981-09-01

    The authors discuss the low temperature application of austenitic chromium-nickel steels for energy production and process techniques. Material requirements are presented, and the behaviour, mechanical and physical properties of such steels are discussed. The manufacture of forgings is considered and test results presented.

  17. Fatigue and fracture behavior of low alloy ferritic forged steels

    International Nuclear Information System (INIS)

    Chaudhry, V.; Sharma, A.K.; Muktibodh, U.C.; Borwankar, Neeraj; Singh, D.K.; Srinivasan, K.N.; Kulkarni, R.G.

    2016-01-01

    Low alloy ferritic steels are widely used in nuclear industry for the construction of pressure vessels. Pressure vessel forged low alloy steels 20MnMoNi55 (modified) have been developed indigenously. Experiments have been carried out to study the Low Cycle Fatigue (LCF) and fracture behavior of these forged steels. Fully reversed strain controlled LCF testing at room temperature and at 350 °C has been carried out at a constant strain rate, and for different axial strain amplitude levels. LCF material behavior has been studied from cyclic stress-strain responses and the strain-life relationships. Fracture behavior of the steel has been studied based on tests carried out for crack growth rate and fracture toughness (J-R curve). Further, responses of fatigue crack growth rate tests have been compared with the rate evaluated from fatigue precracking carried out for fracture toughness (J-R) tests. Fractography of the samples have been carried out to reveal dominant damage mechanisms in crack propagation and fracture. The fatigue and fracture properties of indigenously developed low alloy steel 20MnMoNi55 (modified) steels are comparable with similar class of steels. (author)

  18. The NuSTAR Serendipitous Survey: The 40-month Catalog and the Properties of the Distant High-energy X-Ray Source Population

    Science.gov (United States)

    Lansbury, G. B.; Stern, D.; Aird, J.; Alexander, D. M.; Fuentes, C.; Harrison, F. A.; Treister, E.; Bauer, F. E.; Tomsick, J. A.; Baloković, M.; Del Moro, A.; Gandhi, P.; Ajello, M.; Annuar, A.; Ballantyne, D. R.; Boggs, S. E.; Brandt, W. N.; Brightman, M.; Chen, C.-T. J.; Christensen, F. E.; Civano, F.; Comastri, A.; Craig, W. W.; Forster, K.; Grefenstette, B. W.; Hailey, C. J.; Hickox, R. C.; Jiang, B.; Jun, H. D.; Koss, M.; Marchesi, S.; Melo, A. D.; Mullaney, J. R.; Noirot, G.; Schulze, S.; Walton, D. J.; Zappacosta, L.; Zhang, W. W.

    2017-02-01

    We present the first full catalog and science results for the Nuclear Spectroscopic Telescope Array (NuSTAR) serendipitous survey. The catalog incorporates data taken during the first 40 months of NuSTAR operation, which provide ≈20 Ms of effective exposure time over 331 fields, with an areal coverage of 13 deg2, and 497 sources detected in total over the 3-24 keV energy range. There are 276 sources with spectroscopic redshifts and classifications, largely resulting from our extensive campaign of ground-based spectroscopic follow-up. We characterize the overall sample in terms of the X-ray, optical, and infrared source properties. The sample is primarily composed of active galactic nuclei (AGNs), detected over a large range in redshift from z = 0.002 to 3.4 (median of =0.56), but also includes 16 spectroscopically confirmed Galactic sources. There is a large range in X-ray flux, from {log}({f}3-24{keV}/{erg} {{{s}}}-1 {{cm}}-2)≈ -14 to -11, and in rest-frame 10-40 keV luminosity, from {log}({L}10-40{keV}/{erg} {{{s}}}-1)≈ 39 to 46, with a median of 44.1. Approximately 79% of the NuSTAR sources have lower-energy ( {10}44 erg s-1) to ≈80% at the lowest luminosities ({L}{{X}}< {10}43 erg s-1). Our optical spectroscopic analysis finds that the observed fraction of optically obscured AGNs (I.e., the type 2 fraction) is {F}{Type2}={53}-15+14 % , for a well-defined subset of the 8-24 keV selected sample. This is higher, albeit at a low significance level, than the type 2 fraction measured for redshift- and luminosity-matched AGNs selected by <10 keV X-ray missions.

  19. Multi-objective optimization of swash plate forging process parameters for the die wear/service life improvement

    Science.gov (United States)

    Hu, X. F.; Wang, L. G.; Wu, H.; Liu, S. S.

    2017-12-01

    For the forging process of the swash plate, the author designed a kind of multi-index orthogonal experiment. Based on the Archard wear model, the influences of billet temperature, die temperature, forming speed, top die hardness and friction coefficient on forming load and die wear were numerically simulated by DEFORM software. Through the analysis of experimental results, the best forging process parameters were optimized and determined, which could effectively reduce the die wear and prolong the die service life. It is significant to increase the practical production of enterprise, especially to reduce the production cost and to promote enterprise profit.

  20. The Malarial Exported PFA0660w Is an Hsp40 Co-Chaperone of PfHsp70-x.

    Directory of Open Access Journals (Sweden)

    Michael O Daniyan

    Full Text Available Plasmodium falciparum, the human pathogen responsible for the most dangerous malaria infection, survives and develops in mature erythrocytes through the export of proteins needed for remodelling of the host cell. Molecular chaperones of the heat shock protein (Hsp family are prominent members of the exportome, including a number of Hsp40s and a Hsp70. PFA0660w, a type II Hsp40, has been shown to be exported and possibly form a complex with PfHsp70-x in the infected erythrocyte cytosol. However, the chaperone properties of PFA0660w and its interaction with human and parasite Hsp70s are yet to be investigated. Recombinant PFA0660w was found to exist as a monomer in solution, and was able to significantly stimulate the ATPase activity of PfHsp70-x but not that of a second plasmodial Hsp70 (PfHsp70-1 or a human Hsp70 (HSPA1A, indicating a potential specific functional partnership with PfHsp70-x. Protein binding studies in the presence and absence of ATP suggested that the interaction of PFA0660w with PfHsp70-x most likely represented a co-chaperone/chaperone interaction. Also, PFA0660w alone produced a concentration-dependent suppression of rhodanese aggregation, demonstrating its chaperone properties. Overall, we have provided the first biochemical evidence for the possible role of PFA0660w as a chaperone and as co-chaperone of PfHsp70-x. We propose that these chaperones boost the chaperone power of the infected erythrocyte, enabling successful protein trafficking and folding, and thereby making a fundamental contribution to the pathology of malaria.

  1. Bioresorbable composite screws manufactured via forging process: pull-out, shear, flexural and degradation characteristics.

    Science.gov (United States)

    Felfel, R M; Ahmed, I; Parsons, A J; Rudd, C D

    2013-02-01

    Bioresorbable screws have the potential to overcome some of the complications associated with metallic screws currently in use. Removal of metallic screws after bone has healed is a serious issue which can lead to refracture due to the presence of screw holes. Poly lactic acid (PLA), fully 40 mol% P(2)O(5) containing phosphate unidirectional (P40UD) and a mixture of UD and short chopped strand random fibre mats (P40 70%UD/30%RM) composite screws were prepared via forging composite bars. Water uptake and mass loss for the composite screws manufactured increased significantly to ∼1.25% (P=0.0002) and ∼1.1% (P<0.0001), respectively, after 42 days of immersion in PBS at 37 °C. The initial maximum flexural load for P40 UD/RM and P40 UD composite screws was ∼60% (P=0.0047) and ∼100% (P=0.0037) higher than for the PLA screws (∼190 N), whilst the shear load was slightly higher in comparison to PLA (∼2.2 kN). The initial pull-out strengths for the P40 UD/RM and PLA screws were similar whereas that for P40 UD screws was ∼75% higher (P=0.022). Mechanical properties for the composite screws decreased initially after 3 days of immersion and this reduction was ascribed to the degradation of the fibre/matrix interface. After 3 days interval the mechanical properties (flexural, shear and pull-out) maintained their integrity for the duration of the study (at 42 days). This property retention was attributed to the chemical durability of the fibres used and stability of the matrix properties during the degradation process. It was also deemed necessary to enhance the fibre/matrix interface via use of a coupling agent in order to maintain the initial mechanical properties acquired for the required period of time. Lastly, it is also suggested that the degrading reinforcement fibres may have the potential to buffer any acidic products released from the PLA matrix. Copyright © 2012 Elsevier Ltd. All rights reserved.

  2. Forging C-C Bonds Through Decarbonylation of Aryl Ketones.

    Science.gov (United States)

    Somerville, Rosie J; Martin, Ruben

    2017-06-06

    The ability of nickel to cleave strong σ-bonds is again in the spotlight after a recent report that demonstrates the feasibility of using nickel complexes to promote decarbonylation of diaryl ketones. This transformation involves the cleavage of two strong C-C(O) bonds and avoids the use of noble metals, hence reinforcing the potential of decarbonylation as a technique for forging C-C bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. The first back-side illuminated types of Kyoto's X-ray astronomy SOIPIX

    Energy Technology Data Exchange (ETDEWEB)

    Itou, Makoto, E-mail: itou@cr.scphys.kyoto-u.ac [Department of Physics, Graduate School of Science, Kyoto University, Kitashirakawa Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Tsuru, Takeshi Go; Tanaka, Takaaki; Takeda, Ayaki; Matsumura, Hideaki; Ohmura, Shunichi; Uchida, Hiroyuki [Department of Physics, Graduate School of Science, Kyoto University, Kitashirakawa Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Nakashima, Shinya [Institute of Space and Astronautical Science (ISAS)/JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Arai, Yasuo; Kurachi, Ikuo [Institute of Particle and Nuclear Studies, High Energy Accelerator Research Org., KEK, 1-1 Oho, Tsukuba 305-0801 (Japan); Mori, Koji; Takenaka, Ryota; Nishioka, Yusuke [Department of Applied Physics, Faculty of Engineering, University of Miyazaki,1-1 Gakuen Kibana-dai Nishi, Miyazaki 889-2192 (Japan); Kohmura, Takayoshi; Tamasawa, Koki [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba 278-8510 (Japan); Tindall, Craig [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States)

    2016-09-21

    We have been developing Kyoto's X-ray astronomy SOI pixel sensors, called “XRPIX”, aiming to extend the frontiers of X-ray astronomy with the wide-band imaging spectroscopy in the 0.5–40 keV band. A dead layer on the X-ray incident surface should ideally be as thin as possible to achieve a high sensitivity below 1 keV, and the depletion layer is required to be thick enough to detect 40 keV X-rays. Thus, we have started developing fully-depleted back-side illuminated (BI) types of XRPIXs. This paper reports on our first two BI devices and their X-ray evaluation (2.6–12 keV). The device named “XRPIX2b-FZ-LA” successfully reaches a full depletion with a thickness of 500 μm. On the other hand, it has a dead layer with a thickness of 1.1–1.5 μm and struggles to achieve the requirement of 1.0 μm. The other device named “XRPIX2b-CZ-PZ”, which is applied with a thin Si sensor-layer and an improved back-side process, is found to satisfy the requirement with its thickness of 0.9–1.0 μm, including Al optical blocking filter of 0.2 μm, although the Si sensor-layer is rather thin with 62 μm. We also describe in this paper the X-ray calibration system that we have built for the X-ray evaluation of XRPIXs.

  4. Structure cristalline du composé Hg3-xSbx(S+Se2+xI2-x (x ≃ 0.1

    Directory of Open Access Journals (Sweden)

    Mohammed Kars

    2016-03-01

    Full Text Available Single crystals of the mercury chalcohalide Hg3-xSbx(S+Se2+xI2-x (x ≃ 0.1 (mercury antimony sulfide selenide iodide, were grown by a chemical transport reaction. The structure contains three independent A (Hg/Sb atoms; each atom is strongly covalently bonded with two X (Se/S atoms to form approximately linear X–A–X units. The X–A–X units link to form A4X4 rings, which are combined into infinite crankshaft-type bands running along the [100] direction. Four equatorial E (I/X = Se,S atoms at relatively long distances complete the distorted octahedral coordination of A (Hg/Sb. The crystal under investigation was twinned by non-merohedry with a refined twin domain fraction of 0.814 (6:0.186 (6. The structure is isotypic with Hg3Se2I2 [Beck & Hedderich (2000. J. Solid State Chem. 151, 73–76], but the current determination reveals a coupled substitution, with partial replacement of Hg+2 by Sb+3, balanced by the equivalent substitution of I−1 by S−2 and Se−2. Bond-valence calculations are consistent with this relative substitution model.

  5. The TI-Nspire CAS: A Happy-Medium Mobile Device for Grades 8-16 Mathematics Classrooms

    Science.gov (United States)

    Zelkowski, Jeremy

    2011-01-01

    This article justifies classifying the TI-Nspire CAS Touchpad as a mobile device for grades 8-16 mathematics classrooms equipped with a Navigator system. The 2010 Horizon Report: K-12 indicates virtually every secondary school aged child has some sort of mobile device. Yet, many school policies ban the use of mobile devices, preventing students…

  6. K X-Ray production cross sections for 40-180 keV protons

    International Nuclear Information System (INIS)

    Szegedi, S.; Hassan, M.F.

    2002-01-01

    In view of the importance of the X-ray production cross-section for the determination of element concentration in a given material, we have measured them experimentally for light elements Sc and Fe using proton beams of energy between 40 and 180 keV. The obtained K X-ray production cross-section is compared with the previous experimental results. The experimental K X-ray production cross-section for proton induced X-ray emission (PIXE) analysis, using low energy (200 keV) accelerator, have been improved

  7. The Influence of Temperature on the Frictional Behavior of Duplex-Coated Die Steel Rubbing Against Forging Brass

    Science.gov (United States)

    Ebrahimzadeh, I.; Ashrafizadeh, F.

    2015-01-01

    Improvement of die life under hot forging of brass alloys is considered vital from both economical and technical points of view. One of the best methods for improving die life is duplex coatings. In this research, the influence of temperature on the tribological behavior of duplex-coated die steel rubbing against forging brass was investigated. The wear tests were performed on a pin-on-disk machine from room temperature to 700 °C; the pins were made in H13 hot work tool steel treated by plasma nitriding and by PVD coatings of TiN-TiAlN-CrAlN. The disks were machined from a two-phase brass alloy too. The results revealed that the friction coefficient of this tribosystem went through a maximum at 550 °C and decreased largely at 700 °C. Furthermore, the formation of Cr2O3 caused the reduction of friction coefficient at 700 °C. PVD coatings proved their wear resistance up to 550 °C, well above the working temperature of the brass forging dies.

  8. [Research on the temperature field detection method of hot forging based on long-wavelength infrared spectrum].

    Science.gov (United States)

    Zhang, Yu-Cun; Wei, Bin; Fu, Xian-Bin

    2014-02-01

    A temperature field detection method based on long-wavelength infrared spectrum for hot forging is proposed in the present paper. This method combines primary spectrum pyrometry and three-stage FP-cavity LCTF. By optimizing the solutions of three group nonlinear equations in the mathematical model of temperature detection, the errors are reduced, thus measuring results will be more objective and accurate. Then the system of three-stage FP-cavity LCTF was designed on the principle of crystal birefringence. The system realized rapid selection of any wavelength in a certain wavelength range. It makes the response of the temperature measuring system rapid and accurate. As a result, without the emissivity of hot forging, the method can acquire exact information of temperature field and effectively suppress the background light radiation around the hot forging and ambient light that impact the temperature detection accuracy. Finally, the results of MATLAB showed that the infrared spectroscopy through the three-stage FP-cavity LCTF could meet the requirements of design. And experiments verified the feasibility of temperature measuring method. Compared with traditional single-band thermal infrared imager, the accuracy of measuring result was improved.

  9. Microstructures and tensile properties of Mg–Gd–Y–Zr alloy during multidirectional forging at 773 K

    International Nuclear Information System (INIS)

    Tang, Liechong; Liu, Chuming; Chen, Zhiyong; Ji, Dawei; Xiao, Hongchao

    2013-01-01

    Highlights: • Rare earth (RE) containing Mg–Gd–Y–Zr alloy was successfully multidirectional forged for 8 passes without any cracks. • Initial coarse grains was refined due to a combination of discontinuous and continuous dynamic recrystallization. • The alloy MDFed after 6 passes exhibited an excellent balance of strength and ductility at room temperature. - Abstract: A homogenized Mg–10Gd–4.8Y–0.6Zr (wt.%) alloy was subjected to multidirectional forging (MDF) at 773 K. It was shown that the average grain size decreased with increasing cumulative strain till 6 passes. Uniform fine-grained structure with an average grain size of 9.3 μm was achieved after 6 passes, i.e., cumulative strain of 1.8. Results revealed that grain refinement was induced by a complicated combination of discontinuous dynamic recrystallization at low strain regions and continuous dynamic recrystallization or rotation recrystallization at medium-to-high strain regions. The alloy multi-directionally forged (MDFed) for 6 passes exhibited an excellent balance of strength and ductility at room temperature with ultimate tensile strength (UTS) of 336 MPa and elongation to fracture of 21.0%

  10. The analysis of forming and strain state of the hollow step forgings during the enlarging process

    Directory of Open Access Journals (Sweden)

    Олег Євгенійович Марков

    2017-12-01

    Full Text Available Improving safety, accelerating construction and extending the life of nuclear power plants is one of the main directions of the development of the energy industry. From this point of view, much attention is being paid to the production of forgings, which combine a few details today. This requires the use of new technologies with the use of non-standard tools. The purpose of the work is analyze of the shape and the deformation state of the conical stepped forging when rolling the stepped workpiece with the simultaneous deformation of the protuberance and the ledge. The simulation was performed using finite element method, which is consistent with experimental data. Experimental studies were carried out on lead models. Rolling of stepped workpiece with simultaneous deformation of the protrusion and ledge leads to the appearance of conical forging. Taper on the side of the ledge occurs at the initial stage of rolling and during the whole process increases. The emergence of a conical shape is explained by the fact that during slipping, with the same absolute deformation (stroke, the ledge gets more accumulated deformation through a more precise wall.

  11. Quality surveillance for steel forgings of SA508 Gr.3 used on the main NI equipment of AP1000 nuclear island

    International Nuclear Information System (INIS)

    Liu Lizhao

    2011-01-01

    Being a type of steel with ideal weldability, outstanding ability of anti-neutron irradiation embitterment and good property of fracture toughness and impact toughness, the steel of ASME SA508-3 was used widely for the nuclear island equipment of PWR Nuclear Power Plant. For the 3rd generation nuclear power plant AP1000, all large forgings and some critical components of the SG, RV and PRZ adopt this steel. Through analysis on the critical technical points during manufacturing of the SA508-3 forgings, this article try to identify the key points should be paid attention during the quality surveillance for this type of forgings, and to put forward the supervision method and focus during quality surveillance activities. (author)

  12. Structural features of spin-coated thin films of binary AsxS100−x chalcogenide glass system

    International Nuclear Information System (INIS)

    Cook, J.; Slang, S.; Golovchak, R.; Jain, H.; Vlcek, M.; Kovalskiy, A.

    2015-01-01

    Spin-coating technology offers a convenient method for fabricating photostable chalcogenide glass thin films that are especially attractive for applications in IR optics. In this paper we report the structure of spin-coated As x S 100−x (x = 30, 35, 40) thin films as determined using high resolution X-ray photoelectron spectroscopy (XPS) and Raman spectroscopy, especially in relation to composition (i.e. As/S ratio) and preparation process variables. It was observed that As atoms during preparation have a tendency to precipitate out in close to stoichiometric compositions. The mechanism of bonding between the inorganic matrix and organic residuals is discussed based on the experimental data. A weak interaction between S ions and amine-based clusters is proposed as the basis of structural organization of the organic–inorganic interface. - Highlights: • As–S spin-coated chalcogenide thin films with different As/S were fabricated. • XPS measurements support the cluster-like structure of spin-coated films. • As 2 O 3 was confirmed as the composition of precipitate formed during dissolution. • Lack of As–As bonds explains the observed photostability of the thin films

  13. Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

    Science.gov (United States)

    Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

    2016-12-01

    A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

  14. 73.7 Tb/s (96x3x256-Gb/s) mode-division-multiplexed DP-16QAM transmission with inline MM-EDFA

    NARCIS (Netherlands)

    Sleiffer, V.A.J.M.; Jung, Y.; Veljanovski, V.; Uden, van R.G.H.; Kuschnerov, M.; Kang, Q.; Grüner-Nielsen, L.; Sun, Y.; Richardson, D.J.; Alam, S.U.; Poletti, F.; Sahu, J.K.; Dhar, A.; Chen, H.; Inan, B.; Koonen, A.M.J.; Corbett, B.; Winfield, R.; Ellis, A.D.; Waardt, de H.

    2012-01-01

    We show transmission of a 73.7 Tb/s (96x3x256-Gb/s) DP-16QAM mode-division- multiplexed signal over 119km of few-mode fiber with inline multi-mode EDFA, using 6x6 MIMO digital signal processing. The total demonstrated net capacity is 57.6 Tb/s (SE 12 bits/s/Hz).

  15. Determination of the enthalpy of fusion and thermal diffusivity for ternary Cu_6_0_−_xSn_xSb_4_0 alloys

    International Nuclear Information System (INIS)

    Zhai, W.; Zhou, K.; Hu, L.; Wei, B.

    2016-01-01

    Highlights: • The increasing Sn content reduces the liquidus temperature. • High Sn content results in lower enthalpy of fusion by polynomial functions. • The thermal diffusivity drops from the solid toward the semi-solid state. • Undercoolability of alloys with primary Cu_2Sb phase is stronger than others. - Abstract: The liquidus and solidus temperatures, enthalpy of fusion, and the temperature dependence of thermal diffusivity for ternary Cu_6_0_−_xSn_xSb_4_0 alloys were systematically measured by DSC and laser flash methods. It is found that both the liquidus temperature and the enthalpy of fusion decrease with the rise of Sn content, and their relationships with alloy composition were established by polynomial functions. The thermal diffusivity usually drops from the solid toward the semi-solid state. The undercoolability of those liquid Cu_6_0_−_xSn_xSb_4_0 alloys with primary Cu_2Sb solid phase is stronger than the others with primary β(SnSb) intermetallic compound, and the increase of cooling rate facilitates further undercooling. Microstructural observation indicates that both of the primary Cu_2Sb and β(SnSb) intermetallic compounds in ternary Cu_6_0_−_xSn_xSb_4_0 alloys grow in faceted mode, and develop into coarse flakes and polygonal blocks.

  16. Friction welding of a nickel free high nitrogen steel: influence of forge force on microstructure, mechanical properties and pitting corrosion resistance

    Directory of Open Access Journals (Sweden)

    Mrityunjoy Hazra

    2014-01-01

    Full Text Available In the present work, nickel free high nitrogen austenitic stainless steel specimens were joined by continuous drive friction welding process by varying the amount of forge (upsetting force and keeping other friction welding parameters such as friction force, burn-off, upset time and speed of rotation as constant at appropriate levels. The joint characterization studies include microstructural examination and evaluation of mechanical (micro-hardness, impact toughness and tensile and pitting corrosion behaviour. The integrity of the joint, as determined by the optical microscopy was very high and no crack and area of incomplete bonding were observed. Welds exhibited poor Charpy impact toughness than the parent material. Toughness for friction weld specimens decreased with increase in forge force. The tensile properties of all the welds were almost the same (irrespective of the value of the applied forge force and inferior to those of the parent material. The joints failed in the weld region for all the weld specimens. Weldments exhibited lower pitting corrosion resistance than the parent material and the corrosion resistance of the weld specimens was found to decrease with increase in forge force.

  17. Characterization of nanostructured photosensitive (NiS){sub x}(CdS){sub (1-x)} composite thin films grown by successive ionic layer adsorption and reaction (SILAR) route

    Energy Technology Data Exchange (ETDEWEB)

    Ubale, A.U., E-mail: ashokuu@yahoo.com [Nanostructured Thin Film Materials Laboratory, Department of Physics, Govt. Vidarbha Institute of Science and Humanities, Amravati 444604, Maharashtra (India); Bargal, A.N. [Nanostructured Thin Film Materials Laboratory, Department of Physics, Govt. Vidarbha Institute of Science and Humanities, Amravati 444604, Maharashtra (India)

    2011-07-15

    Highlights: {yields} Thin films of (NiS){sub x}(CdS){sub (1-x)} with variable composition (x = 1 to 0) were deposited onto glass substrates by the successive ionic layer adsorption and reaction (SILAR) method. {yields} The structural, surface morphological and electrical characterizations of the as deposited and annealed films were studied. {yields} The bandgap and activation energy of annealed (NiS){sub x}(CdS){sub (1-x)} film decrease with improvement in photosensitive nature. -- Abstract: Recently ternary semiconductor nanostructured composite materials have attracted the interest of researchers because of their photovoltaic applications. Thin films of (NiS){sub x}(CdS){sub (1-x)} with variable composition (x = 1-0) had been deposited onto glass substrates by the successive ionic layer adsorption and reaction (SILAR) method. As grown and annealed films were characterised by X-ray diffraction, scanning electron microscopy and EDAX to investigate structural and morphological properties. The (NiS){sub x}(CdS){sub (1-x)} films were polycrystalline in nature having mixed phase of rhombohedral and hexagonal crystal structure due to NiS and CdS respectively. The optical and electrical properties of (NiS){sub x}(CdS){sub (1-x)} thin films were studied to determine compsition dependent bandgap, activation energy and photconductivity. The bandgap and activation energy of annealed (NiS){sub x}(CdS){sub (1-x)} film decrease with improvement in photosensitive nature.

  18. FLANDES, Flange Design for He Circuits by Taylor-Forge Method

    International Nuclear Information System (INIS)

    Pitchford, B.E.

    1977-01-01

    1 - Nature of the physical problem solved: Flange design for helium circuits. 2 - Method of solution: This is a flange design programme based on the Taylor forge method with an additional calculation of flange rotation and bolt load change during the application of internal pressure. The method relates only to the integral hub type of flange, with or without a secondary O-ring seal but will deal also with the flange and cover plate case

  19. Examining the X-ray Properties of Lenticular Galaxies: Rollins S0 X-ray Sample (RS0X)

    Science.gov (United States)

    Fuse, Christopher R.; Malespina, Alysa

    2017-01-01

    Lenticular galaxies represent a complex morphology in which many questions remain. The S0 morphology possesses spiral galaxy attributes, such as a disk, while also displaying the luminosity and old stellar population indicative of an elliptical galaxy. The proposed formation mechanisms for lenticulars are also varied, with the absence of gas suggesting a faded spiral and the high masses and luminosities implying a merger formation. The star formation and high-energy emission from a sample of S0s will be used to better understand the properties and formation mechanisms of this unique subset of galaxies.We use the Chandra X-ray Observatory archives cycle 1 - 16 to identify a sample of seventeen lenticular galaxies residing in a variety of environments. Data was analyzed using the CIAO software to produce true color images, radial profiles of the halo gas, gas contours, as well as determine the X-ray luminosities of the point sources and gas.The X-ray gas temperature of the sample S0s varied over a narrow range between 0.61 and 0.96 keV, with one outlier, NGC 4382 at 2.0 keV. The X-ray luminosity of the halo gas varies by four dex. The gas temperatures and X-ray luminosities do not vary by environment, with the majority of sample S0s displaying values of typical elliptical galaxies. The S0 sample is X-ray under-luminous relative to the optical luminosity as compared to the sample of early-type galaxies of Ellis & O’Sullivan (2006).The halo gas exhibited some distinct morphological features, such as multiple X-ray peaks, which may indicate a merger event, and highly concentrated gas, suggesting limited gravitational disturbance. Isolated S0, NGC 4406, displays an asymmetric halo, which could be interpreted as gas stripping. An isolated lenticular experiencing gas redistribution due to gravitational perturbation or a cluster-like medium could be interpreted as NGC 4406 forming in a higher galactic density environment than the field.

  20. Amorphous MoS{sub x} on CdS nanorods for highly efficient photocatalytic hydrogen evolution

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiaofang; Tang, Chaowan; Zheng, Qun; Shao, Yu; Li, Danzhen, E-mail: dzli@fzu.edu.cn

    2017-02-15

    Loading cocatalyst on semiconductors was crucially necessary for improving the photocatalytic hydrogen evolution. Amorphous MoS{sub x} as a novel and noble metal-free cocatalyst was loaded on CdS nanorods by a simple photodeposition method. Efficient hydrogen evolution with amount of 15 mmol h{sup −1} g{sup −1} was observed over the MoS{sub x} modified CdS nanorods, which was about 6 times higher than that by using Pt as cocatalyst. Meanwhile, with MoS{sub x} cocatalyst, the efficiency of CdS nanorods was superior to that of CdS nanoparticles and bulk CdS. No deactivation could be observed in the efficiency of MoS{sub x} modified CdS nanorods under irradiation for successive 10 h. Further experimental results indicated that the efficient electrons transfer, low overpotential of hydrogen evolution and active S atoms over the MoS{sub x} modified CdS nanorods were responsible for the higher efficiency. Our results provided guidance for synthesizing noble metal-free materials as cocatalyst for photocatalytic hydrogen evolution. - Graphical abstract: Photodeposition of amorphous MoS{sub x} on CdS nanorods for highly efficient photocatalytic hydrogen evolution. - Highlights: • Amorphous MoSx cocatalyst was loaded on CdS NRs by a simple photodeposition. • MoS{sub x}/CdS NRs exhibited 6 times higher hydrogen evolution efficiency than Pt/CdS NRs. • The hydrogen evolution of MoS{sub x}/CdS NRs linearly increased with prolonging time. • Lower overpotential and efficient electron transfer were observed over MoS{sub x}/CdS NRs.

  1. Convenient hydrothermal decomposition process for preparation of nanocrystalline mineral Cu3BiS3 and Pb1-xBi2x/3S

    International Nuclear Information System (INIS)

    Hu Junqing; Deng Bin; Wang Chunrui; Tang Kaibin; Qian Yitai

    2003-01-01

    Mineral nanocrystalline Cu 3 BiS 3 and Pb 1-x Bi 2x/3 S (or Bi 0.22 Pb 0.89 S 1.22 ) have been prepared at low synthetic temperature of 100-150 deg. C by convenient hydrothermal decomposition process. X-ray powder diffraction, transmission electron microscopy, X-ray photoelectron spectra, and element analysis were used to characterize and measure the samples. The as-prepared Cu 3 BiS 3 sample consisted of whisker-like particles with an average size of 50x10 nm 2 and the Pb 1-x Bi 2x/3 S sample displayed aggregative particles with size in the range of 30-50 nm. Preliminary results showed that the prepared precursors, reaction temperature and time played a role in the formation of the final products. A possible reaction mechanism was also discussed briefly

  2. Synthesis and Photocatalytic Activity of Zn x Cd 1–x S/TiO 2 ...

    African Journals Online (AJOL)

    Synthesis and Photocatalytic Activity of Zn x Cd 1–x S/TiO 2 Heterostructures ... South African Journal of Chemistry ... Whenthe molar ratio of S/Ti was 0.96, the ZnxCd1–xS/TiO2 hierarchical heterostructures exhibited enhanced visible light ...

  3. eFORGE : A Tool for Identifying Cell Type-Specific Signal in Epigenomic Data

    NARCIS (Netherlands)

    Breeze, Charles E.; Paul, Dirk S.; van Dongen, Jenny; Butcher, Lee M.; Ambrose, John C.; Barrett, James E.; Lowe, Robert; Rakyan, Vardhman K.; Iotchkova, Valentina; Frontini, Mattia; Downes, Kate; Ouwehand, Willem H.; Laperle, Jonathan; Jacques, Pierre-ETienne; Bourque, Guillaume; Bergmann, Anke K.; Siebert, Reiner; Vellenga, Edo; Saeed, Sadia; Matarese, Filomena; Martens, Joost H. A.; Stunnenberg, Hendrik G.; Teschendorff, Andrew E.; Herrero, Javier; Birney, Ewan; Dunham, Ian; Beck, Stephan

    2016-01-01

    Epigenome-wide association studies (EWAS) provide an alternative approach for studying human disease through consideration of non-genetic variants such as altered DNA methylation. To advance the complex interpretation of EWAS, we developed eFORGE (http://eforge.cs.ucl.ac.uk/), a new stand-alone and

  4. Research on damage evolution and damage model of 316LN steel during forging

    Energy Technology Data Exchange (ETDEWEB)

    Duan, X.W., E-mail: dxwmike1998@sina.com; Liu, J.S.

    2013-12-20

    The tensile tests and unloading tensile experiments of 316LN steel were conducted. The damage evolution processes were investigated by optical microscope. The fracture was studied using a Scanning Electron Microscope (SEM) and optical microscope, of which, the chemical compositions were analyzed by Energy Dispersive Spectrometer (EDS). The results show that voids nucleate by decohesion of Al{sub 2}O{sub 3} inclusions–matrix interface and mainly along the grain boundary, especially, at triangular grain boundary junctions. The tensile processes were simulated by Deform2D under different deformation conditions. The critical damage values were obtained. The model between the critical damage value, temperature and strain rate was established by regression analysis. A combination of numerical simulation and upsetting experiments was applied for verifying the accuracy and reliability of critical damage value. These damage values can be used to predict the initiation of voids during 316LN steel hot forging. So, they have important instructional effects on designing forging technology of 316LN steel.

  5. Elevated-temperature tensile properties of three heats of commercially heat-treated Alloy 718

    International Nuclear Information System (INIS)

    Booker, M.K.; Booker, B.L.P.

    1980-03-01

    Three heats of commercially heat-treated alloy 718 were tensile tested over the temperature range from room temperature to 816 degree C and at nominal strain rates from 6.7 x 10 -6 to 6.7 x 10 -3 /s. We examined data for yield strength, ultimate tensile strength, uniform elongation, total elongation, and reduction in area and also inspected tensile stress-strain behavior. Yield and ultimate tensile strengths for commercially heat-treated alloy 718 decrease very gradually with temperature from room temperature up to about 600 degree C for a strain rate of 6.7 x 10 -5 /s or to about 700 degree C for a strain rate of 6.7 x 10 -4 /s. Above these temperatures the strength drops off fairly rapidly. Reduction in area and total elongation data show minimum around 700 degree C, with each ductility measure falling to 10% or less at the minimum. This minimum is more pranced and occurs at lower temperatures as strain rate decreases. Up to about 600 degree C the ductility is typically around 30%. As the temperature reaches 816 degree C the ductility again increases to perhaps 60%. The uniform elongation (plastic strain at peak load) decreases only slightly with temperature to about 500 degree C then drops off rapidly and monotonically with temperature, reaching values less than 1% at 816 degree C. At the highest test temperatures the load maximum may result, not from necking of the specimen, but from overaging of the precipitation-hardened microstructure. Stress-strain curves showed serrated deformations in the temperature range from 316 to 649 degree C, although they occur only for the faster strain rates at the supper end of this temperature range. The serrations can be quite large, involving load drops of perhaps 40 to 80 MPa. The serrations typically begin within the first 2% of deformation and continue until fracture, although exceptions were noted. 16 refs., 14 figs., 3 tabs

  6. Foundations of the AdS5 x S5 superstring: I

    International Nuclear Information System (INIS)

    Arutyunov, Gleb; Frolov, Sergey

    2009-01-01

    We review the recent advances towards finding the spectrum of the AdS 5 x S 5 superstring. We thoroughly explain the theoretical techniques which should be useful for the ultimate solution of the spectral problem. In certain cases our exposition is original and cannot be found in the existing literature. The present part I deals with foundations of classical string theory in AdS 5 x S 5 , light-cone perturbative quantization and the derivation of the exact light-cone world-sheet scattering matrix

  7. Photoluminescence and electrical impedance measurements on alloyed Zn{sub (1-x)}Cd{sub x}S nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Saravanan, R. Sakthi Sudar, E-mail: rsakthiss@yahoo.com [Physics Research Centre, S.T. Hindu College, Nagercoil 629 002 (India); Mahadevan, C.K. [Physics Research Centre, S.T. Hindu College, Nagercoil 629 002 (India)

    2012-11-15

    Highlights: Black-Right-Pointing-Pointer High yield synthesis of Zn-Cd-S QDs. is achieved by solvothermal-microwave heating. Black-Right-Pointing-Pointer The samples are highly crystalline and the average particle size is {approx}3.5 nm. Black-Right-Pointing-Pointer High luminescent quantum yield and narrow emission spectral widths are obtained. Black-Right-Pointing-Pointer High conduction activation energy is observed in the case of Zn-Cd coexisting QDs. - Abstract: A series of wurtzite Zn{sub (1-x)}Cd{sub x}S (x = 0, 0.25, 0.5, 0.75 and 1) nanocrystals with average crystallite size of 1.98, 1.82, 1.80, 2.04 and 2.51 nm, respectively, have been synthesized by simple solvothermal microwave heating method. The photoluminescence yield is found to be higher in the case of alloyed nanocrystals (x = 0.25, 0.5, 0.75) as compared to ZnS (x = 0) and CdS (x = 1). The optical emission is tuned from blue (440 nm) to orange (575 nm) with the increase of Cd composition in Zn{sub (1-x)}Cd{sub x}S nanocrystal. The impedance analysis for Zn{sub (1-x)}Cd{sub x}S nanocrystals has been measured as a function of frequency and temperature. The real and imaginary part of complex impedance plots exhibit semicircle behavior in the complex plane. The AC activation energies of ZnS, Zn{sub 0.75}Cd{sub 0.25}S, Zn{sub 0.5}Cd{sub 0.5}S, Zn{sub 0.25}Cd{sub 0.75}S and CdS nanocrystals were calculated from electrical conductivity analysis and are found to be 0.188, 0.378, 0.456, 0.284 and 0.255 eV, respectively. The conductivity of the alloyed nanocrystals was higher than that of ZnS and CdS.

  8. Selection of the optimal hard facing (HF technology of damaged forging dies based on cooling time t8/5

    Directory of Open Access Journals (Sweden)

    D. Arsić

    2016-01-01

    Full Text Available In exploitation, the forging dies are exposed to heating up to very high temperatures, variable loads: compressive, impact and shear. In this paper, the reparatory hard facing of the damaged forging dies is considered. The objective was to establish the optimal reparatory technology based on cooling time t8/5 . The verification of the adopted technology was done by investigation of the hard faced layers microstructure and measurements of hardness within the welded layers’ characteristic zones. Cooling time was determined theoretically, numerically and experimentally.

  9. Increasing of the lifetime of large forging dies by repairwelding

    Science.gov (United States)

    Duchek, M.; Koukolikova, M.; Kotous, J.; Majer, M.

    2018-02-01

    Repair welding is often used for rebuilding discarded or failed forging dies. It saves the cost of new tools. Increased useful life of repaired dies is another motivation for repair welding. This article focuses on the development of new filler materials for this purpose. The main goal was to prolong the life of tools of DIN 1.2714 material. Filler wires of two chemistries were made and several samples were experimentally welded. Metallographic and tribological analyses were carried out.

  10. 12-core x 3-mode Dense Space Division Multiplexed Transmission over 40 km Employing Multi-carrier Signals with Parallel MIMO Equalization

    DEFF Research Database (Denmark)

    Mizuno, T.; Kobayashi, T.; Takara, H.

    2014-01-01

    We demonstrate dense SDM transmission of 20-WDM multi-carrier PDM-32QAM signals over a 40-km 12-core x 3-mode fiber with 247.9-b/s/Hz spectral efficiency. Parallel MIMO equalization enables 21-ns DMD compensation with 61 TDE taps per subcarrier....

  11. Use of Gleeble MAXStrain unit for study of damage development in hot forging

    NARCIS (Netherlands)

    Geijselaers, Hubertus J.M.; Wang, Chao; Miroux, A.; Recina, V.; van den Boogaard, Antonius H.; Saanouni, K.

    2016-01-01

    The standard Gleeble MAXStrain unit has been modified to allow axial elongation. Analyses indicate that in this way both positive and negative hydrostatic stresses can be achieved during forging simulations, depending on the amount of strain per hit. This opens the way to the study of the effect of

  12. Nonlinear optical diagnostic of semimagnetic semiconductors Pb1-xYb xX (X = S, Se, Te)

    International Nuclear Information System (INIS)

    Nouneh, K.; Kityk, I.V.; Viennois, R.; Benet, S.; Charar, S.; Plucinski, K.J.

    2007-01-01

    Nonlinear optical measurements were performed to elucidate the influence of magnetic ions on the behavior of charge carriers in magnetic semiconductors-Pb 1-x Yb x X (X = S, Se, Te at x = 1-3%). It was shown that nonlinear optical methods could be used as sensitive tools for investigations of electron-phonon anharmonicity near low-temperature semiconductor-insulator phase transitions. There exists a difference between surface and bulk-like contributions to the nonlinear optical effects. It was shown that only low-temperature Two Photon Absorption (TPA) oscillator may be related to the number of the electron-phonon anharmonic modes responsible for the observed phase transformation. The explanation of the anomalous temperature dependences is given in accordance with dipole momentum's behaviors determined by low-temperature spin-spin interactions and by electron-phonon anharmonic interactions. We have discovered that low-temperature dependence of specific heat of Pb 1-x R x Te (R = Yb, Pr with x = 3% and 1.6%, respectively) exhibits a non-magnetic order caused by large electron-phonon contributions and structural disorder effects

  13. Stress corrosion of low alloy steel forgings

    International Nuclear Information System (INIS)

    Thornton, D.V.; Mould, P.B.; Patrick, E.C.

    1976-01-01

    The catastrophic failure of a steam turbine rotor disc at Hinkley Point 'A' Power station was shown to have been caused by the growth of a stress corrosion crack to critical dimensions. This failure has promoted great interest in the stress corrosion susceptibility of medium strength low alloy steel forgings in steam environments. Consequently, initiation and growth of stress corrosion cracks of typical disc steels have been investigated in steam and also in water at 95 0 C. Cracking has been shown to occur, predominantly in an intergranular manner, with growth rates of between 10 -9 and 10 -7 mm sec. -1 . It is observed that corrosion pitting and oxide penetration prior to the establishment of a stress corrosion crack in the plain samples. (author)

  14. Composition determination of CdS sub x Se sub 1-x mixed crystals by optical dispersion

    Energy Technology Data Exchange (ETDEWEB)

    Iliev, I; Dimov, T; Ribarov, D [Pedagogical High School, Schumen (Bulgaria); Lange, H [Akademie der Wissenschaften der DDR, Berlin (German Democratic Republic). Zentralinstitut fuer Elektronenphysik

    1989-10-16

    An optical dispersion method has been developed determining the CdS/CdSe ratio in CdS{sub x}Se{sub 1-x} mixed crystals from the relationship between position of the isotropic point (birefrigence becomes zero for a definite wavelength at the absorption edge) and chemical composition x. Birefrigence spectra and piezo-optic spectra of samples with x = 0.2, 0.6, and 0.875 give the spectral position of the isotropic point (ip). A curve of wavelength of ip versus x of CdS{sub x}Se{sub 1-x} is evaluated by the least-squares procedure and tested by X-ray fluorescence analysis.

  15. Study of collective flow of inclusive muons in p–Pb collisions at $\\sqrt{s_{\\rm NN}}$ = 8.16 TeV with ALICE

    CERN Document Server

    Chetcuti, Wayne Jordan

    2017-01-01

    This work focuses on the results obtained from the ALICE muon spectrometer for the measurement of the elliptic flow of muons at forward rapidity in p–Pb collisions at 8.16 TeV. The muon triggered data sample that was used, gave the minimum-bias data sample, as well as sufficient statistics at intermediate and high $p_T$ . The correction for the non-uniform detector appearance was performed and the Generic Q-cumulant method for 2- and 4-particle correlations was applied to get the elliptic flow of inclusive muons. From the results of the elliptic flow, it was suggested that the observed hydrodynamic-like particle correlations at high multiplicity in small systems may come out from the same underlying physics mechanisms as that in heavy-ion collisions.

  16. Experimental and numerical research on forging with torsion

    Science.gov (United States)

    Petrov, Mikhail A.; Subich, Vadim N.; Petrov, Pavel A.

    2017-10-01

    Increasing the efficiency of the technological operations of blank production is closely related to the computer-aided technologies (CAx). On the one hand, the practical result represents reality exactly. On the other hand, the development procedure of new process development demands unrestricted resources, which are limited on the SMEs. The tools of CAx were successfully applied for development of new process of forging with torsion and result analysis as well. It was shown, that the theoretical calculations find the confirmation both in praxis and during numerical simulation. The mostly used constructional materials were under study. The torque angles were stated. The simulated results were evaluated by experimental procedure.

  17. Performance of the PRAXyS X-ray polarimeter

    Energy Technology Data Exchange (ETDEWEB)

    Iwakiri, W.B., E-mail: wataru.iwakiri@riken.jp [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Black, J.K. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Rock Creek Scientific, 1400 East-West Hwy, Silver Spring, MD 20910 (United States); Cole, R. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Enoto, T. [The Hakubi Center for Advanced Research, Kyoto University, Kyoto 606-8302 (Japan); Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Hayato, A. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Hill, J.E.; Jahoda, K. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Kaaret, P. [University of Iowa, Iowa City, IA 52242 (United States); Kitaguchi, T. [Department of Physical Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Kubota, M. [Department of Physics, Tokyo University of Science, 3-1 Kagurazaka, Shinjuku-ku, Tokyo 162-8601, Japan. (Japan); RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Marlowe, H.; McCurdy, R. [University of Iowa, Iowa City, IA 52242 (United States); Takeuchi, Y. [Department of Physics, Tokyo University of Science, 3-1 Kagurazaka, Shinjuku-ku, Tokyo 162-8601, Japan. (Japan); RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Tamagawa, T. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Department of Physics, Tokyo University of Science, 3-1 Kagurazaka, Shinjuku-ku, Tokyo 162-8601, Japan. (Japan)

    2016-12-01

    The performance of the Time Projection Chamber (TPC) polarimeter for the Polarimeter for Relativistic Astrophysical X-ray Sources (PRAXyS) Small Explorer was evaluated using polarized and unpolarized X-ray sources. The PRAXyS mission will enable exploration of the universe through X-ray polarimetry in the 2–10 keV energy band. We carried out performance tests of the polarimeter at the Brookhaven National Laboratory, National Synchrotron Light Source (BNL-NSLS) and at NASA's Goddard Space Flight Center. The polarimeter was tested with linearly polarized, monochromatic X-rays at 11 different energies between 2.5 and 8.0 keV. At maximum sensitivity, the measured modulation factors at 2.7, 4.5 and 8.0 keV are 27%, 43% and 59%, respectively and the measured angle of polarization is consistent with the expected value at all energies. Measurements with a broadband, unpolarized X-ray source placed a limit of less than 1% on false polarization in the PRAXyS polarimeter.

  18. A worker attaches covers for the nose pitot boom before removing the unpiloted X-40 from the runway

    Science.gov (United States)

    2001-01-01

    A worker attaches covers for the nose pitot boom before removing the unpiloted X-40 from the runway at Edwards Air Force Base, California, following its successful free-flight on March 14, 2001. The unpiloted X-40 is a risk-reduction vehicle for the X-37, which is intended to be a reusable space vehicle. NASA's Marshall Space Flight Center in Huntsville, Ala, manages the X-37 project. At Dryden, the X-40A underwent a series of ground and air tests to reduce possible risks to the larger X-37, including drop tests from a helicopter to check guidance and navigation systems planned for use in the X-37. The X-37 is designed to demonstrate technologies in the orbital and reentry environments for next-generation reusable launch vehicles that will increase both safety and reliability, while reducing launch costs from $10,000 per pound to $1,000 per pound. The X-37, carried into orbit by the Space Shuttle, is planned to fly two orbital missions to test reusable launch vehicle technologies.

  19. $D$ meson production and long-range azimuthal correlation in $8.16~\\mathrm{TeV}$ $p$+Pb collisions with ATLAS

    CERN Document Server

    The ATLAS collaboration

    2017-01-01

    The production of $D^{0}(\\overline{D^0})$ and $D^{*\\pm}$ mesons has been measured with the ATLAS detector in $p$+Pb collisions at $\\sqrt{s_{_\\mathrm{NN}}}=8.16~\\mathrm{TeV}$ with an integrated luminosity of $76.3\\mu b^{-1}$ taken in 2016. The $D$ meson production asymmetry between forward ($0 < y^* < 0.5$) and backward ($-0.5 < y^* < 0$) center-of-mass rapidities is studied, and no significant asymmetry is observed. Azimuthal correlations between inclusive $D^{*\\pm}$ and charged particles are also presented in intervals of event-wise charged-particle multiplicity. The second-order harmonic coefficients for inclusive $D^{*\\pm}$ and charged particles azimuthal correlation have been extracted using template fits.

  20. Mutation D816V alters the internal structure and dynamics of c-KIT receptor cytoplasmic region: implications for dimerization and activation mechanisms.

    Directory of Open Access Journals (Sweden)

    Elodie Laine

    2011-06-01

    Full Text Available The type III receptor tyrosine kinase (RTK KIT plays a crucial role in the transmission of cellular signals through phosphorylation events that are associated with a switching of the protein conformation between inactive and active states. D816V KIT mutation is associated with various pathologies including mastocytosis and cancers. D816V-mutated KIT is constitutively active, and resistant to treatment with the anti-cancer drug Imatinib. To elucidate the activating molecular mechanism of this mutation, we applied a multi-approach procedure combining molecular dynamics (MD simulations, normal modes analysis (NMA and binding site prediction. Multiple 50-ns MD simulations of wild-type KIT and its mutant D816V were recorded using the inactive auto-inhibited structure of the protein, characteristic of type III RTKs. Computed free energy differences enabled us to quantify the impact of D816V on protein stability in the inactive state. We evidenced a local structural alteration of the activation loop (A-loop upon mutation, and a long-range structural re-organization of the juxta-membrane region (JMR followed by a weakening of the interaction network with the kinase domain. A thorough normal mode analysis of several MD conformations led to a plausible molecular rationale to propose that JMR is able to depart its auto-inhibitory position more easily in the mutant than in wild-type KIT and is thus able to promote kinase mutant dimerization without the need for extra-cellular ligand binding. Pocket detection at the surface of NMA-displaced conformations finally revealed that detachment of JMR from the kinase domain in the mutant was sufficient to open an access to the catalytic and substrate binding sites.

  1. Pediatric acute myeloid leukemia with t(8;16)(p11;p13), a distinct clinical and biological entity: a collaborative study by the International-Berlin-Frankfurt-Münster AML-study group

    Science.gov (United States)

    Coenen, Eva A.; Zwaan, C. Michel; Reinhardt, Dirk; Harrison, Christine J.; Haas, Oskar A.; de Haas, Valerie; Mihál, Vladimir; De Moerloose, Barbara; Jeison, Marta; Rubnitz, Jeffrey E.; Tomizawa, Daisuke; Johnston, Donna; Alonzo, Todd A.; Hasle, Henrik; Auvrignon, Anne; Dworzak, Michael; Pession, Andrea; van der Velden, Vincent H. J.; Swansbury, John; Wong, Kit-fai; Terui, Kiminori; Savasan, Sureyya; Winstanley, Mark; Vaitkeviciene, Goda; Zimmermann, Martin; Pieters, Rob; van den Heuvel-Eibrink, Marry M.

    2013-01-01

    In pediatric acute myeloid leukemia (AML), cytogenetic abnormalities are strong indicators of prognosis. Some recurrent cytogenetic abnormalities, such as t(8;16)(p11;p13), are so rare that collaborative studies are required to define their prognostic impact. We collected the clinical characteristics, morphology, and immunophenotypes of 62 pediatric AML patients with t(8;16)(p11;p13) from 18 countries participating in the International Berlin-Frankfurt-Münster (I-BFM) AML study group. We used the AML-BFM cohort diagnosed from 1995-2005 (n = 543) as a reference cohort. Median age of the pediatric t(8;16)(p11;p13) AML patients was significantly lower (1.2 years). The majority (97%) had M4-M5 French-American-British type, significantly different from the reference cohort. Erythrophagocytosis (70%), leukemia cutis (58%), and disseminated intravascular coagulation (39%) occurred frequently. Strikingly, spontaneous remissions occurred in 7 neonates with t(8;16)(p11;p13), of whom 3 remain in continuous remission. The 5-year overall survival of patients diagnosed after 1993 was 59%, similar to the reference cohort (P = .14). Gene expression profiles of t(8;16)(p11;p13) pediatric AML cases clustered close to, but distinct from, MLL-rearranged AML. Highly expressed genes included HOXA11, HOXA10, RET, PERP, and GGA2. In conclusion, pediatric t(8;16)(p11;p13) AML is a rare entity defined by a unique gene expression signature and distinct clinical features in whom spontaneous remissions occur in a subset of neonatal cases. PMID:23974201

  2. Ab-initio calculations of Co-based diluted magnetic semiconductors Cd 1-xCoxX (X=S, Se, Te)

    KAUST Repository

    Saeed, Yasir; Nazir, Safdar; Shaukat, Ali; Reshak, A. H.

    2010-01-01

    Ab-initio calculations are performed to investigate the structural, electronic and magnetic properties of spin-polarized diluted magnetic semiconductors composed of IIVI compounds Cd1-xCoxX (X=S, Se, Te) at x=0.25. From the calculated results

  3. First observation of $\\overline{B}^{0}_{s} \\to D^{*+}_{s2}X\\mu^{-}\\overline{\

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Agari, M; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Amoraal, J; Anderson, J; Antunes Nobrega, R; Appleby, R B; Aquines Gutierrez, O; Arefyev, A; Arrabito, L; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Basiladze, S; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belous, K; Belyaev, I; Benayoun, M; Bencivenni, G; Bernet, R; Bettler, M-O; van Beuzekom, M; Bifani, S; Bizzeti, A; Björnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bochin, B; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bos, E; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brisbane, S; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Bursche, A; Buytaert, J; Cadeddu, S; Caicedo Carvajal, J M; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Cameron, W; Camilleri, L; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Charles, M; Charpentier, Ph; Cheng, J; Chiapolini, N; Chlopik, A; Christiansen, J; Ciambrone, P; Cid Vidal, X; Clark, P J; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Constantin, F; Conti, G; Contu, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Almagne, B; D'Ambrosio, C; D'Antone, I; Da Silva, W; Dané, E; David, P; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Degaudenzi, H; Deissenroth, M; Del Buono, L; Deplano, C; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Dima, M; Donleavy, S; Dornan, P; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Eames, C; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Eklund, L; d'Enterria, D G; Esperante Pereira, D; Estève, L; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Flegel, W; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Fungueirino Pazos, J L; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garrido, L; Gaspar, C; Gassner, J; Gauvin, N; Gavillet, P; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gong, G; Gong, H; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Guzik, Z; Gys, T; Haefeli, G; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, P F; He, J; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hilke, H J; Hofmann, W; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Iakovenko, V; Iglesias Escudero, C; Ilgner, C; Ilten, P; Imong, J; Jacobsson, R; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kapusta, F; Karbach, T M; Kashchuk, A; Keaveney, J; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koblitz, S; Konoplyannikov, A; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kukulak, S; Kumar, R; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, R W; Lanfranchi, G; Langenbruch, C; Latham, T; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Lehner, F; Leroy, O; Lesiak, T; Li, L; Li, Y Y; Li Gioi, L; Libby, J; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Löchner, S; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Luisier, J; M'charek, B; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maier, A; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martin Sanchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Matveev, V; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Mclean, C; Meissner, M; Merk, M; Merkel, J; Merkin, M; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Monteil, S; Moran, D; Morawski, P; Morris, J V; Moscicki, J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Murtas, F; Muryn, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nardulli, J; Nawrot, A; Nedos, M; Needham, M; Neufeld, N; Neustroev, P; Nicol, M; Nies, S; Niess, V; Nikitin, N; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Ostankov, A; Pal, B; Palacios, J; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pauna, E; Pauna, C; Pavel, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Pessina, G; Petrella, A; Petrolini, A; Pie Valls, B; Pietrzyk, B; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Pozzi, S; du Pree, T; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Raniuk, I; Raven, G; Redford, S; Reece, W; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Cobo, C; Rodriguez Perez, P; Rogers, G J; Romanovsky, V; Rouvinet, J; Ruf, T; Ruiz, H; Rusinov, V; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sambade Varela, A; Sannino, M; Santacesaria, R; Santinelli, R; Santovetti, E; Sapunov, M; Saputi, A; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schmelling, M; Schmidt, B; Schneider, O; Schneider, T; Schopper, A; Schune, M -H; Schwemmer, R; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Serra, N; Serrano, J; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Simioni, E; Skottowe, H P; Skwarnicki, T; Smale, N; Smith, A; Smith, A C; Sobczak, K; Soler, F J P; Solomin, A; Somogy, P; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spiridenkov, E; Spradlin, P; Srednicki, A; Stagni, F; Steiner, S; Steinkamp, O; Stenyakin, O; Stoica, S; Stone, S; Storaci, B; Straumann, U; Styles, N; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Talanov, V; Tarkovskiy, E; Teodorescu, E; Terrier, H; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Tran, M T; Traynor, S; Trunk, U; Tsaregorodtsev, A; Tuning, N; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Vervink, K; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Voong, D; Vorobyev, A; Vorobyev, An; Voss, H; Wacker, K; Wandernoth, S; Wang, J; Ward, D R; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Yang, Z; Ybeles Smit, G; Young, R; Yushchenko, O; Zavertyaev, M; Zeng, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E

    2011-01-01

    Using data collected with the LHCb detector in proton-proton collisions at a centre-of-mass energy of 7 TeV, the semileptonic decays Bs -> Ds+ X mu nu and Bs -> D0 K+ X mu nu are detected. Two structures are observed in the D0 K+ mass spectrum at masses consistent with the known D^+_{s1}(2536) and $D^{*+}_{s2}(2573) mesons. The measured branching fractions relative to the total Bs semileptonic rate are B(Bs -> D_{s2}^{*+} X mu nu)/B(Bs -> X mu nu)= (3.3\\pm 1.0\\pm 0.4)%, and B(Bs -> D_{s1}^+ X munu)/B(Bs -> X mu nu)= (5.4\\pm 1.2\\pm 0.5)%, where the first uncertainty is statistical and the second is systematic. This is the first observation of the D_{s2}^{*+} state in Bs decays; we also measure its mass and width.

  4. The influence of microstructure and operating temperature on the fatigue endurance of hot forged Inconel{sup ®} 718 components

    Energy Technology Data Exchange (ETDEWEB)

    Maderbacher, H., E-mail: hermann.maderbacher@unileoben.ac.at [Chair of Mechanical Engineering, Montanuniversität Leoben, Franz-Josef-Straße 18, 8700 Leoben (Austria); Oberwinkler, B., E-mail: bernd.oberwinkler@bohler-forging.com [Böhler Schmiedetechnik GmbH and Co KG, Mariazellerstraße 25, 8605 Kapfenberg (Austria); Gänser, H.-P., E-mail: hans-peter.gaenser@mcl.at [Materials Center Leoben Forschung GmbH, Roseggerstraße 12, 8700 Leoben (Austria); Tan, W., E-mail: wen.tan@unileoben.ac.at [Chair of Mechanical Engineering, Montanuniversität Leoben, Franz-Josef-Straße 18, 8700 Leoben (Austria); Rollett, M., E-mail: mathias.rollett@stud.unileoben.ac.at [Chair of Mechanical Engineering, Montanuniversität Leoben, Franz-Josef-Straße 18, 8700 Leoben (Austria); Stoschka, M., E-mail: michael.stoschka@stud.unileoben.ac.at [Chair of Mechanical Engineering, Montanuniversität Leoben, Franz-Josef-Straße 18, 8700 Leoben (Austria)

    2013-11-15

    The dependence of the fatigue behavior of hot-forged Inconel{sup ®} 718 aircraft components on the operating temperature and the material microstructure is investigated. To this purpose, possible correlations between a variety of tested microstructural parameters and the results from low-cycle fatigue (LCF) testing are analyzed using statistical methods. To identify the prevailing damage mechanisms, failure analyses are carried out on specimens tested at different temperatures. Optical and scanning electron microscopy are used for the inspection of surface crack networks and of the final fracture surface. In addition, energy dispersive X-ray (EDX) analyses are performed at the crack initiation sites to track down possible accumulations of alloying elements. The results are critically reviewed and used to propose a temperature and microstructure dependent fatigue model for predicting LCF ε⧸N-curves.

  5. Microwave-assisted synthesis of Zn{sub x}Cd{sub 1-x}S-MWCNT heterostructures and their photocatalytic properties

    Energy Technology Data Exchange (ETDEWEB)

    Wu Huaqiang, E-mail: wuhuaq@mail.ahnu.edu.cn; Yao Youzhi; Li Wenting; Zhu Lulu; Ni Na; Zhang Xiaojun [Anhui Normal University, Anhui Key Laboratory of Molecule-based Materials, College of Chemistry and Materials Science (China)

    2011-05-15

    The multi-walled carbon nanotubes (MWCNTs) wrapped with hexagonal wurtzite Zn{sub x}Cd{sub 1-x}S nanoparticles with a uniform and small diameter have been prepared to form Zn{sub x}Cd{sub 1-x}S-MWCNT heterostructures by microwave-assisted route using Zn(Ac){sub 2}, Cd(NO{sub 3}){sub 2}, and thioacetamide as the reactants{sub .} The heterostructures have been characterized by X-ray powder diffraction, scanning and transmission electron microscopy, high-resolution transmission electron microscopy, photoluminescence (PL) and PL excited lifetime. Despite the analogous size and configuration, the Zn{sub x}Cd{sub 1-x}S-MWCNT (x = 0, 0.2, 0.5, 0.8, 1) with different Zn concentration exhibit composition-dependent absorption properties in the visible zone. The PL peak positions of Zn{sub x}Cd{sub 1-x}S-MWCNT change gradually from ZnS-MWCNT to CdS-MWCNT. The Zn{sub x}Cd{sub 1-x}S-MWCNT shows different photocatalytic activity towards the photodegradation of fuchsin acid under visible light illumination, photocatalytic activity of the Zn{sub x}Cd{sub 1-x}S-MWCNT decreases gradually with the increase in the Zn concentration, the Zn{sub 0.2}Cd{sub 0.8}S-MWCNT possessed the best photocatalytic activity. After recycling thrice, the photocatalysts still have about 85% efficiency.

  6. Forging Alliances in Interdisciplinary Rehabilitation Research (FAIRR): A Logic Model.

    Science.gov (United States)

    Gill, Simone V; Khetani, Mary A; Yinusa-Nyahkoon, Leanne; McManus, Beth; Gardiner, Paula M; Tickle-Degnen, Linda

    2017-07-01

    In a patient-centered care era, rehabilitation can benefit from researcher-clinician collaboration to effectively and efficiently produce the interdisciplinary science that is needed to improve patient-centered outcomes. The authors propose the use of the Forging Alliances in Interdisciplinary Rehabilitation Research (FAIRR) logic model to provide guidance to rehabilitation scientists and clinicians who are committed to growing their involvement in interdisciplinary rehabilitation research. We describe the importance and key characteristics of the FAIRR model for conducting interdisciplinary rehabilitation research.

  7. Manufacturing of ultra-large diameter 20 MnMoNi 5 5 steel forgings for reactor pressure vessels and their properties

    International Nuclear Information System (INIS)

    Onodera, S.; Kawaguchi, S.; Tsukada, H.; Moritani, H.; Suzuki, K.; Sato, I.

    1983-01-01

    A set of component material for PHWR RPV, including the largest forgings ever manufacture so far such as flanges (8,440 mm O.D.), shells and torus (7,960 mm O.D.) and dome (6,800 mm dia. in chord, 460 mm thick), was presented in the outline of manufacturing and properties. Even with increased dimensions and weight than the current largest forgings, the manufacture and the qualities achieved were satisfactory. These results encourage us in further developing PWRs and PHWRs with increased capacity. (orig.)

  8. The Ties That Bind: How Social Capital Is Forged and Forfeited in Teacher Communities

    Science.gov (United States)

    Bridwell-Mitchell, E. N.; Cooc, North

    2016-01-01

    The effects of social capital on school improvement make it important to understand how teachers forge, maintain, or forfeit collegial relationships. Two common explanations focused on formal organizational features and individual characteristics do not address how social capital accrues from informal dynamics of teachers' interactions in…

  9. Brittle Fracture Behaviors of Large Die Holders Used in Hot Die Forging

    Directory of Open Access Journals (Sweden)

    Weifang Zhang

    2017-05-01

    Full Text Available Brittle fracture of large forging equipment usually leads to catastrophic consequences. To avoid this kind of accident, the brittle fracture behaviors of a large die holder were studied by simulating the practical application. The die holder is used on the large die forging press, and it is made of 55NiCrMoV7 hot-work tool steel. Detailed investigations including mechanical properties analysis, metallographic observation, fractography, transmission electron microscope (TEM analysis and selected area electron diffraction (SAED were conducted. The results reveal that the material generated a large quantity of large size polyhedral M23C6 (M: Fe and Cr mainly and elongated M3C (M: Fe mainly carbides along the martensitic lath boundaries when the die holder was recurrently tempered and water-cooled at 250 °C during the service. The large size carbides lead to the material embrittlement and impact toughness degradation, and further resulted in the brittle fracture of the die holder. Therefore, the operation specification must be emphasized to avoid the die holder being cooled by using water, which is aimed at accelerating the cooling.

  10. THE LEGAL PROTECTION FOR REAL LAND RIGHT HOLDER IN CASE OF FORGED RINCIK

    Directory of Open Access Journals (Sweden)

    Nirwana Nirwana

    2017-12-01

    Full Text Available The legal Protection For Real Land Right Holder in Case of Forged Rincik. The research aimed to investigate (1 the legal protection for the land owner whose possession was based on rincik evidence, and (2 the legal protection on the good-will buyer based on the forged rincik document used in the land sale transaction. This was the normative legal research, also called the library research or documentary study because the research was only conducted on the written regulations or other legal materials or secondary data consisting of the primary and secondary legal materials. The interview was performed to strengthen the theories and opinions in the research. The research also used the Secondary data. the data were analysed and presented using the qualitative descriptive method. The research result indicate that: (1 the real land owner with rincik possession issued after the year 1960 based on the decision of Indonesian Supreme Court No. 560K / PID / 2008 has not been fully protected due to the fact that the seller is funished for forging the rincik., returning the right to the land owner can not be carried out due to the decision of Indonesian Supreme Court Number. 482 / PK / Pdt / 2014 which make the buyer win, while the real land owner is the directed to sue the land seller to give the compensation: and (2 the legal protection on the good faith buyer based on forget rincik in the land sale transaction has been fully protected and has the ringt to possess the land based on the decision of Indonesian Supreme Court Number. 482/PK/Pdt/2014 because the buyer has bought the land in the presence of Temporary Land Title Registar.

  11. An Assessment of the Ductile Fracture Behavior of Hot Isostatically Pressed and Forged 304L Stainless Steel

    Science.gov (United States)

    Cooper, A. J.; Smith, R. J.; Sherry, A. H.

    2017-05-01

    Type 300 austenitic stainless steel manufactured by hot isostatic pressing (HIP) has recently been shown to exhibit subtly different fracture behavior from that of equivalent graded forged steel, whereby the oxygen remaining in the component after HIP manifests itself in the austenite matrix as nonmetallic oxide inclusions. These inclusions facilitate fracture by acting as nucleation sites for the initiation, growth, and coalescence of microvoids in the plastically deforming austenite matrix. Here, we perform analyses based on the Rice-Tracey (RT) void growth model, supported by instrumented Charpy and J-integral fracture toughness testing at ambient temperature, to characterize the degree of void growth ahead of both a V-notch and crack in 304L stainless steel. We show that the hot isostatically pressed (HIP'd) 304L steel exhibits a lower critical void growth at the onset of fracture than that observed in forged 304L steel, which ultimately results in HIP'd steel exhibiting lower fracture toughness at initiation and impact toughness. Although the reduction in toughness of HIP'd steel is not detrimental to its use, due to the steel's sufficiently high toughness, the study does indicate that HIP'd and forged 304L steel behave as subtly different materials at a microstructural level with respect to their fracture behavior.

  12. Tool design and materials for electro sinter forging (ESF)

    DEFF Research Database (Denmark)

    Cannella, Emanuele; Nielsen, Chris Valentin

    ) process, the main requirement is the electrical current passing through the electrical conducting powder. To obtain this, a closed-die setup with electrical insulating properties was used. Furthermore, the alignment between the compacting punch and die needed to be ensured by pre-aligning or alternatively...... by using an alignment system. The present work is focused on the designing phase of a tool for the electro sinter forging of a disc, made from titanium powder. By applying a pre-alignment system, the setup resulted suitable for this application. A tool design for sintering rings is also showed....

  13. Modeling Cavitation in ICE Pistons Made with Isothermal Forging

    Directory of Open Access Journals (Sweden)

    V.V. Astanin

    2014-07-01

    Full Text Available Possible causes for cavitations in parts made with an Al-Si eutectic alloy AK12D (AlSi12 were explored with mathematical and physical modeling with involved acoustic emission. Pores were formed from micro-cracks, which appear during the early stages of a deformation process, with the help of micro-stresses appearing at phase boundaries (Al/Si interface due to thermal expansion. At the design stage of isothermal forgings of such products it is recommended to provide a scheme of the deformed shape, which is under uniform compression, to compensate for the inter-phase stresses.

  14. Automated ultrasonic shop inspection of reactor pressure vessel forgings

    International Nuclear Information System (INIS)

    Farley, J.M.; Dikstra, B.J.; Hanstock, D.J.; Pople, C.H.

    1986-01-01

    Automated ultrasonic shop inspection utilizing a computer-controlled system is being applied to each of the forgings for the reactor pressure vessel of the proposed Sizewell B PWR power station. Procedures which utilize a combination of high sensitivity shear wave pulse echo, 0 degrees and 70 degrees angled longitudinal waves, tandem and through-thickness arrays have been developed to provide comprehensive coverage and an overall reliability of inspection comparable to the best achieved in UKAEA defect detection trials and in PISC II. This paper describes the ultrasonic techniques, the automated system (its design, commissioning and testing), validation and the progress of the inspections

  15. Deducing material quality in cast and hot-forged steels by new bending test

    Science.gov (United States)

    Valberg, Henry; Langøy, Morten; Nedreberg, Mette; Helvig, Torgeir

    2017-10-01

    A special bend test has been developed and applied for the purpose of characterization and comparison of the material ductility in crankpin steel discs manufactured by casting, or casting subsequently followed by hot open-die forging (ODF) or closed-die forging (CDF). The bending test specimen consists of a small rectangular plate of material with a round hole cut out in the middle. The "eye-shape" specimens were cut out from various positions either near to the surface of, or from the interior of the discs. The test method revealed differences in ductility for the investigated materials, and for different depth positions inside the discs. The roughening of the specimen surface on the top-side of the specimen bend also varied dependent on the processing method for the material. Current results show that this test method is useful for evaluation of material quality in differently processed material. Experimental bend test results are presented for differently processed variants of the same material, i.e., crankpin discs either made by solely casting or casting subsequently followed by hot working either by ODF or CDF.

  16. Microstructure-based assessment of creep rupture behaviour of cast-forged P91 steel

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, Chandan, E-mail: chandanpy.1989@gmail.com [Department of Mechanical and Industrial Engineering, Indian Institute of Technology Roorkee, Uttrakhand 247667 (India); Mahapatra, M.M. [School of Mechanical Sciences, Indian Institute of Technology Bhubaneswar, Odisha 751013 (India); Kumar, Pradeep; Vidyrathy, R.S. [Department of Mechanical and Industrial Engineering, Indian Institute of Technology Roorkee, Uttrakhand 247667 (India); Srivastava, A. [Senior Engineer, HEEP Section, BHEL Haridwar (India)

    2017-05-17

    The work presented in this study was performed with the intent to characterize the microstructure evolution for short term creep exposure of cast-forged P91 steel. The short-term creep test was performed at temperature range of 620–650 °C and stresses ranging from 120 to 200 MPa. To characterize the sample after creep exposure, field emission scanning electron microscopy (FESEM) with energy dispersive X-ray spectroscopy (EDS), optical microscope and micro-hardness testing were utilized. Creep tests were performed on round creep specimens. For low temperature service condition, longer creep life was obtained. The fracture surface of creep ruptured specimen were characterized by using the FESEM. The transgranular fracture mode was noticed in all the tests condition. The creep rupture life was found to be decreased with increase in applied stress. The maximum rupture life was measured about to be 3329.28 h for the sample exposed at 620 °C for 120 MPa. A negligible microstructural change was measured in gripping area compared to the gauge area (necking area) of crept sample. The laves phase formation was also noticed along the grain boundaries for creep exposure life of 3329.28 h.

  17. Microstructure-based assessment of creep rupture behaviour of cast-forged P91 steel

    International Nuclear Information System (INIS)

    Pandey, Chandan; Mahapatra, M.M.; Kumar, Pradeep; Vidyrathy, R.S.; Srivastava, A.

    2017-01-01

    The work presented in this study was performed with the intent to characterize the microstructure evolution for short term creep exposure of cast-forged P91 steel. The short-term creep test was performed at temperature range of 620–650 °C and stresses ranging from 120 to 200 MPa. To characterize the sample after creep exposure, field emission scanning electron microscopy (FESEM) with energy dispersive X-ray spectroscopy (EDS), optical microscope and micro-hardness testing were utilized. Creep tests were performed on round creep specimens. For low temperature service condition, longer creep life was obtained. The fracture surface of creep ruptured specimen were characterized by using the FESEM. The transgranular fracture mode was noticed in all the tests condition. The creep rupture life was found to be decreased with increase in applied stress. The maximum rupture life was measured about to be 3329.28 h for the sample exposed at 620 °C for 120 MPa. A negligible microstructural change was measured in gripping area compared to the gauge area (necking area) of crept sample. The laves phase formation was also noticed along the grain boundaries for creep exposure life of 3329.28 h.

  18. Information about diagnosis and prognosis related to anxiety and depression in children with cancer aged 8-16 years

    NARCIS (Netherlands)

    Last, B. F.; van Veldhuizen, A. M.

    1996-01-01

    The aim of this study was to test the hypothesis that being openly informed about the diagnosis and prognosis benefits the emotional well-being of children with cancer. A stratified sample of 56 children with cancer aged 8-16 years and their parents participated. The parents were interviewed about

  19. Performance of the PRAXyS X-ray polarimeter

    Science.gov (United States)

    Iwakiri, W. B.; Black, J. K.; Cole, R.; Enoto, T.; Hayato, A.; Hill, J. E.; Jahoda, K.; Kaaret, P.; Kitaguchi, T.; Kubota, M.; Marlowe, H.; McCurdy, R.; Takeuchi, Y.; Tamagawa, T.

    2016-12-01

    The performance of the Time Projection Chamber (TPC) polarimeter for the Polarimeter for Relativistic Astrophysical X-ray Sources (PRAXyS) Small Explorer was evaluated using polarized and unpolarized X-ray sources. The PRAXyS mission will enable exploration of the universe through X-ray polarimetry in the 2-10 keV energy band. We carried out performance tests of the polarimeter at the Brookhaven National Laboratory, National Synchrotron Light Source (BNL-NSLS) and at NASA's Goddard Space Flight Center. The polarimeter was tested with linearly polarized, monochromatic X-rays at 11 different energies between 2.5 and 8.0 keV. At maximum sensitivity, the measured modulation factors at 2.7, 4.5 and 8.0 keV are 27%, 43% and 59%, respectively and the measured angle of polarization is consistent with the expected value at all energies. Measurements with a broadband, unpolarized X-ray source placed a limit of less than 1% on false polarization in the PRAXyS polarimeter.

  20. Influence of the hydrostatic stress component on critical surface expansion in forging compound products

    DEFF Research Database (Denmark)

    Vorm, T; Bay, Niels; Wanheim, Tarras

    1974-01-01

    of a superimposed hydrostatic pressure on the critical surface expansion during a forging process. The critical surface expansion appears to decrease with increasing hydrostatic pressure. This may be due to the fact that the close contact between the materials necessary to obtain bonding is created by a micro...

  1. Growth, characterization and estimation of lattice strain and size in CdS nanoparticles: X-ray peak profile analysis

    Science.gov (United States)

    Solanki, Rekha Garg; Rajaram, Poolla; Bajpai, P. K.

    2018-05-01

    This work is based on the growth, characterization and estimation of lattice strain and crystallite size in CdS nanoparticles by X-ray peak profile analysis. The CdS nanoparticles were synthesized by a non-aqueous solvothermal method and were characterized by powder X-ray diffraction (XRD), transmission electron microscopy (TEM), Raman and UV-visible spectroscopy. XRD confirms that the CdS nanoparticles have the hexagonal structure. The Williamson-Hall (W-H) method was used to study the X-ray peak profile analysis. The strain-size plot (SSP) was used to study the individual contributions of crystallite size and lattice strain from the X-rays peaks. The physical parameters such as strain, stress and energy density values were calculated using various models namely, isotropic strain model, anisotropic strain model and uniform deformation energy density model. The particle size was estimated from the TEM images to be in the range of 20-40 nm. The Raman spectrum shows the characteristic optical 1LO and 2LO vibrational modes of CdS. UV-visible absorption studies show that the band gap of the CdS nanoparticles is 2.48 eV. The results show that the crystallite size estimated from Scherrer's formula, W-H plots, SSP and the particle size calculated by TEM images are approximately similar.

  2. Prompt and isolated photons in 8.16 TeV p+Pb collisions with ATLAS

    CERN Document Server

    Hill, Kurt Keys; The ATLAS collaboration

    2018-01-01

    The inclusive production cross-section for isolated, prompt photons in p+Pb collisions at √sNN = 8.16 TeV is studied with the ATLAS detector at the LHC using a data set with an integrated luminosity of 162 nb−1. The cross-section is measured as a function of photon transverse energy from 25 to 500 GeV and over nearly five units of pseudorapidity, including kinematic regions in both the downstream proton– and nucleus–going directions. Results are reported in the nucleon–nucleon center of mass collision frame. The nuclear modification factor RpPb is reported using a extrapolation, derived using NLO pQCD, of a previous measurement of photon production in pp collisions at 8 TeV. The cross-sections and RpPb values are compared to the results of a next-to-leading order perturbative QCD calculation and to the expectations based on a picture of the energy loss of partons incoming to the hard scattering. At large nucleus-going rapidity, the cross-section is suppressed due to the different up and down valence...

  3. Studies on structural, optical, and photoelectric properties of CdS{sub 1-x}Se{sub x} films fabricated by selenization of chemical bath deposited CdS films

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Tianyu; Gu, Han; Ge, Zhenhua; Zhang, Lei; Wang, Zhicheng; Fang, Yong; Han, Zhida; Qian, Bin; Jiang, Xuefan [Department of Physics, Changshu Institute of Technology, Changshu (China); Wu, Wangping [School of Mechanical Engineering, Changzhou University, Changzhou (China)

    2017-02-15

    In this paper, high-photosensitive CdS{sub 1-x}Se{sub x} films are synthesized by a two-step technique, which includes the chemical bath deposition of CdS films and a following selenization process. The structural, optical, and photoelectric properties of the CdS{sub 1-x}Se{sub x} films were investigated. With the substitution of selenium for sulfur atoms, grain sizes of the as-prepared CdS{sub 1-x}Se{sub x} films are effectively enlarged and reach the scales of the films thickness when the selenization temperature exceeds 450 C. With increasing the selenization temperature from 350 to 550 C, the band gaps of CdS{sub 1-x}Se{sub x} films gradually decrease from 2.37 to 1.82 eV. Under the co-action of the grain-size enlargement and band-gap decrease, the CdS{sub 1-x}Se{sub x} films fabricated at 450 C show very pronounced photosensitivity. Noteworthy, the ratio of photo to dark conductivity of the CdS{sub 1-x}Se{sub x} film selenized at 450 C reaches 1.1 x 10{sup 5}, suggesting a promising application potential in the photoelectric devices. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Systemic mastocytosis uncommon in KIT D816V mutation positive core-binding factor acute myeloid leukemia

    DEFF Research Database (Denmark)

    Kristensen, Thomas; Preiss, Birgitte; Broesby-Olsen, Sigurd

    2012-01-01

    Abstract The KIT D816V mutation is detected in the vast majority of adult cases of systemic mastocytosis (SM). The mutation is also frequently detected in core-binding factor acute myeloid leukemia (CBF-AML) defined by the presence of t(8;21)(q22;q22); RUNX1-RUNX1T1 or inv(16)(p13.1;q22)/t(16;16)(p...

  5. Quaternary (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloys and photosensitive structures on their basis

    Energy Technology Data Exchange (ETDEWEB)

    Bodnar, I. V. [Belarusian State University of Informatics and Radioelectronics (Belarus); Rud, V. Yu., E-mail: rudvas.spb@gmail.com [St. Petersburg State Polytechnical University (Russian Federation); Rud, Yu. V. [Russian Academy of Sciences, Ioffe Physical Technical Institute (Russian Federation); Lozhkin, D. V. [Belarusian State University of Informatics and Radioelectronics (Belarus)

    2011-07-15

    Using directional crystallization of the melt of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloy, homogeneous crystals of a similar atomic composition are grown over the entire range of compositions 1 {>=} x {>=} 0. It is established that the crystals of the continuous series of quaternary alloys in the range x = 0-1 crystallize in the spinel structure and lattice parameter a linearly depends on x. It is established that it is possible to obtain In(Al)/(FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} photosensitive structures. Room-temperature spectra of relative quantum efficiency of photoconversion of the In(Al)/(FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} structures fabricated for the first time are obtained. From the analysis of these spectra, activation energies of direct and indirect band-to-band transitions for the crystals of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloys are determined and the dependence of these parameters on the composition of the position-disordered phases of mentioned alloys is discussed. It is concluded that the crystals of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloys can be used in broadband photoconverters of optical radiation.

  6. The AdS5xS5 superstring worldsheet S matrix and crossing symmetry

    International Nuclear Information System (INIS)

    Janik, Romuald A.

    2006-01-01

    An S matrix satisfying the Yang-Baxter equation with symmetries relevant to the AdS 5 xS 5 superstring recently has been determined up to an unknown scalar factor. Such scalar factors are typically fixed using crossing relations; however, due to the lack of conventional relativistic invariance, in this case its determination remained an open problem. In this paper we propose an algebraic way to implement crossing relations for the AdS 5 xS 5 superstring worldsheet S matrix. We base our construction on a Hopf-algebraic formulation of crossing in terms of the antipode and introduce generalized rapidities living on the universal cover of the parameter space which is constructed through an auxillary, coupling-constant dependent, elliptic curve. We determine the crossing transformation and write functional equations for the scalar factor of the S matrix in the generalized rapidity plane

  7. Magnetic and electrical properties of (FeIn2S4)1−x(CuIn5S8)x solid solutions

    International Nuclear Information System (INIS)

    Trukhanov, S.V.; Bodnar, I.V.; Zhafar, M.A.

    2015-01-01

    In this study, single crystals of FeIn 2 S 4 and CuIn 5 S 8 compounds, and (FeIn 2 S 4 ) 1−x (CuIn 5 S 8 ) x solid solutions were grown using the Bridgman method. The magnetic and electrical properties of the samples obtained were investigated at temperatures of 5–300 K and in a magnetic field range of 0–14 T. It was established that all of the solid solutions were paramagnets down to low temperatures of ~10 K. It was shown that the ground state of the magnetic phase of the samples was a spin glass state, where the freezing temperature increased monotonically with the increase in the concentration of Fe 2+ cations. All of the samples exhibited semiconductor characteristics in terms of electrical resistivity. The concentration-dependent critical magnetic temperatures, magnetic moment, and activation energy were plotted, which are probably explained by the magnetic state formation of the (FeIn 2 S 4 ) 1−x (CuIn 5 S 8 ) x solid solution single crystals based on the empirical Goodenough–Kanamori rules

  8. Study of surfaces and interfaces in CdS-Cu2S and (Cd sub(x) Zn sub(1-x))S-Cu2S solar cells

    International Nuclear Information System (INIS)

    Dhere, N.G.; Dhere, R.G.; Bloss, W.H.; Schock, H.W.; Bauer, E.; Cyris, P.

    1983-01-01

    Auger microprobe was used for the analysis of interfaces and surfaces in several stages involved in the preparation of solar cells, in order to study the origin of adhesion problems and to study the formation of CdS-Cu 2 S barrier by the wet method. The detachment of the first CdS and (Cd sub(x) Zn sub(1-x))S films, during the dip process, was attributed to the contamination of Cr-Ag metallic substrates by existing chlorine from the environment next to the sea, due to long film stocking, by degasified species from the evaporating material and by the ejection of particles together with CdS vapour during deposition. The formation of conical mounds on the surface and of the CdS-Cu 2 S barrier at aproximatelly 3000 A depth in the dipped samples were observed. The migration of copper towards surface direction and the formation of a superficial thin layer of copper oxide after treatment in H 2 plasma and air heating, were also verified. (C.L.B.) [pt

  9. Control of luminescence emitted by Cd{sub 1-x}Mn{sub x}S nanocrystals in a glass matrix: x concentration and thermal annealing

    Energy Technology Data Exchange (ETDEWEB)

    Freitas Neto, Ernesto S; Dantas, Noelio O [Laboratorio de Novos Materiais Isolantes e Semicondutores (LNMIS), Instituto de Fisica, Universidade Federal de Uberlandia, CP 593, CEP 38400-902, Uberlandia, Minas Gerais (Brazil); Barbosa Neto, Newton M [Grupo de Espectroscopia de Materiais (GEM), Instituto de Fisica, Universidade Federal de Uberlandia, CP 593, CEP 38400-902, Uberlandia, Minas Gerais (Brazil); Guedes, Ilde [Departamento de Fisica, Universidade Federal do Ceara, Campus do Pici, CEP 60455-760, Fortaleza, Ceara (Brazil); Chen, Felipe, E-mail: ernestosfn@yahoo.com.br [Centro de Ciencias Naturais e Humanas, Universidade Federal do ABC, CEP 09210-170, Santo Andre, Sao Paulo (Brazil)

    2011-03-11

    Cd{sub 1-x}Mn{sub x}S nanocrystals (NCs) were successfully grown in a glass matrix and investigated by photoluminescence (PL), electron paramagnetic resonance (EPR) and magnetic force microscopy (MFM). We verified that the luminescent properties of these NCs can be controlled both by changing the x concentration and by thermal annealing of the samples. The EPR and PL data showed that the characteristic emission of Mn{sup 2+} ions ({sup 4}T{sub 1}-{sup 6}A{sub 1}) is only observed when this magnetic impurity is substitutionally incorporated in the Cd{sub 1-x}Mn{sub x}S NC core (site S{sub I}). Besides, it was observed that the emission ({sup 4}T{sub 1}-{sup 6}A{sub 1}) suppression, caused by the Mn{sup 2+} ion presence near the surface (site S{sub II}) of the Cd{sub 1-x}Mn{sub x}S NCs, is independent of the host material. The MFM images also confirmed the high quality of the Cd{sub 1-x}Mn{sub x}S NC samples, showing a uniform distribution of total magnetic moments in the nanoparticles.

  10. First principles prediction of the magnetic properties of Fe-X6 (X = S, C, N, O, F) doped monolayer MoS2

    KAUST Repository

    Feng, Nan; Mi, Wenbo; Cheng, Yingchun; Guo, Zaibing; Schwingenschlö gl, Udo; Bai, Haili

    2014-01-01

    Using first-principles calculations, we have investigated the electronic structure and magnetic properties of Fe-X 6 clusters (X = S, C, N, O, and F) incorporated in 4 4 monolayer MoS 2, where a Mo atom is substituted by Fe and its nearest S atoms are substituted by C, N, O, and F. Single Fe and Fe-F 6 substituions make the system display half-metallic properties, Fe-C 6 and Fe-N 6 substitutions lead to a spin gapless semiconducting behavior, and Fe-O 6 doped monolayer MoS 2 is semiconducting. Magnetic moments of 1.93, 1.45, 3.18, 2.08, and 2.21...? B are obtained for X = S, C, N, O, and F, respectively. The different electronic and magnetic characters originate from hybridization between the X and Fe/Mo atoms. Our results suggest that cluster doping can be an efficient strategy for exploring two-dimensional diluted magnetic semiconductors.

  11. First principles prediction of the magnetic properties of Fe-X6 (X = S, C, N, O, F) doped monolayer MoS2

    KAUST Repository

    Feng, Nan

    2014-02-05

    Using first-principles calculations, we have investigated the electronic structure and magnetic properties of Fe-X 6 clusters (X = S, C, N, O, and F) incorporated in 4 4 monolayer MoS 2, where a Mo atom is substituted by Fe and its nearest S atoms are substituted by C, N, O, and F. Single Fe and Fe-F 6 substituions make the system display half-metallic properties, Fe-C 6 and Fe-N 6 substitutions lead to a spin gapless semiconducting behavior, and Fe-O 6 doped monolayer MoS 2 is semiconducting. Magnetic moments of 1.93, 1.45, 3.18, 2.08, and 2.21...? B are obtained for X = S, C, N, O, and F, respectively. The different electronic and magnetic characters originate from hybridization between the X and Fe/Mo atoms. Our results suggest that cluster doping can be an efficient strategy for exploring two-dimensional diluted magnetic semiconductors.

  12. The Use of 3D Scanning Methods to Evaluate the Hybrid Layer Used in Forging Tools in Order to Improve their Durability

    Directory of Open Access Journals (Sweden)

    Gronostajski Z.

    2017-09-01

    Full Text Available This study is focused on tools used in the industrial process of hot forging of a front wheel forging (gear wheel manufactured for the automotive industry. Five different variants were applied for the tools: 3 die inserts were coated with three different hybrid layers (PN + PVD type, i.e. AlCrTiN, AlCrTiSiN and CrN, one insert was only nitrided, and one was pad welded, to improve tool durability. The tool wear was analysed and represented by the material degradation on the working surface, based on the 3D scanning and the material growth of the periodically collected forgings. Additionally, the scanned tools were divided into two areas, in which it was found, based on the analysis, that various degradation mechanisms are predominant. Microstructural tests and hardness measurements of the analyzed tools were also performed. Based on the results, it was found that, in the central part of the die insert, thermo-mechanical fatigue, abrasive wear and plastic deformation occurred, while in the area of the bridge insert, only abrasive wear could be observed. For these areas, the loss of material was determined separately. It was established that the use of the GN+CrN and GN+AlCrTiN hybrid layers on forging tools improves their durability, while the best results in the central area were observed on the tool with the GN+CrN layer, which is the most resistant to thermo-mechanical fatigue. In the second analyzed area, good wear resistance occurred on GN+CrN, GN+AlCrTiN and pad welded inserts, for which, together with the increase of the forging number, a proportional, slight growth of the loss of material occurred.

  13. Press forging of single crystal calcium fluoride

    International Nuclear Information System (INIS)

    Turk, R.R.

    1975-01-01

    Single crystals of high-purity calcium fluoride have been deformed uniaxially in an attempt to improve strength and resistance to cleavage, without impairing infrared transmission. Order of magnitude increases in strength, such as those found in forged KCl, have not been attained, but fine-grained polycrystalling material has been produced which is resistant to crystalline cleavage. Deformation rates of 10 -2 min -1 , reductions of 10 to 73 percent in height, and deformation temperatures of 550 to 1000 0 C have been used. Flexural strengths over 13,000 psi and grain sizes down to 5 μm have been obtained. Reduction of residual stress through heat treatment has been studied, and resultant techniques applied before, during, and after deformation. No increase in infrared absorption has been noted at the CO laser wavelength of 5.3 μm

  14. Reaction π-p→X deg n, X deg → 2γ at momenta 15 and 40 GeV/c

    International Nuclear Information System (INIS)

    Apel, W.D.; Bertolucci, E; Donskov, S.V.

    1974-01-01

    The cross sections for reaction π - p→X deg n with X deg → 2γ decay have been measured at momenta 15 and 40 GeV/c. About 500 events have been detected. A hodoscope spectrometer with the computer on-line was used to detect photon pairs. t-dependence of differential cross section has been obtained similar to that of reaction π - p→eta deg n. From the ratio of differential cross section for X deg and eta deg production at t=0 an angle of the singlet-octet mixing of pseudoscalar mesons has been found to be equal to β=-19 deg

  15. Effect of Welding Parameters on Microstructure and Mechanical Properties of Cast Fe-40Al Alloy

    Directory of Open Access Journals (Sweden)

    Osman Torun

    2016-09-01

    Full Text Available Friction welding of cast Fe-40Al alloy was carried out at 1000 rmp for various friction times, friction pressures, and forging pressures. The microstructures of the interface of welded samples were analyzed by optical and scanning electron microscopy (SEM. Micrographs demonstrated that excellent welding formed continuously along the interface, except for samples welded for 3 s. Chemical compositions of the interface of the friction welded samples and of the fractured surface of all the specimens were determined using energy dispersive spectroscopy (EDS. After the welding process, shear tests were applied to the welded samples to determine the shear strength of joints. Test results indicated that the maximum shear strength was 469.5 MPa.

  16. Investigation on spectroscopic parameters and molecular constants of BeS(X1Σ+) using MRCI theory

    International Nuclear Information System (INIS)

    Liu Hui; Xing Wei; Shi Deheng; Sun Jinfeng

    2012-01-01

    The potential energy curve (PEC) of BeS(X 1 Σ + ) molecule has been studied using MRCI approach with Davidson modification in conjunction with the cc-pV5Z basis set. Effects on the PECs by the core-valence correlation corrections and relativistic effects have been taken into account. The way to consider the relativistic effects is to use the second-order Douglas-Kroll Hamiltonian approximation. With the PEC including the core-valence correlation corrections and relativistic effects, the spectroscopic parameters of BeS(X 1 Σ + ) have been determined. These parameters are compared in detail with those of previous studies reported in the literature, and excellent agreement has been found between the available experimental data and the present ones. With the PEC corrected, the first 40 vibrational states for the non-rotating BeS are computed, and the vibrational level, inertial rotation and centrifugal distortion constants for each vibrational state are predicted. (authors)

  17. Local structure and influence of bonding on the phase-change behavior of the chalcogenide compounds K{sub 1-} {sub x} Rb {sub x} Sb{sub 5}S{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Wachter, J B [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States); Chrissafis, K [Department of Physics, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Petkov, V [Department of Physics, Central Michigan University, Mount Pleasant, MI 48859 (United States); Malliakas, C D [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States); Bilc, D [Department of Physics, Central Michigan University, Mount Pleasant, MI 48859 (United States); Kyratsi, Th [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States); Paraskevopoulos, K M [Department of Physics, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Mahanti, S D [Department of Physics, Michigan State University, East Lansing, MI 48824 (United States); Torbruegge, T [Institut fuer Physikalische Chemie, Westf. Wilhelms-Universitaet Muenster (Germany); Eckert, H [Institut fuer Physikalische Chemie, Westf. Wilhelms-Universitaet Muenster (Germany); Kanatzidis, M.G. [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States)], E-mail: m-kanatzidis@northwestern.edu

    2007-02-15

    KSb{sub 5}S{sub 8} and its solid solution analogs with Rb and Tl were found to exhibit a reversible and tunable glass{sup {yields}}crystal{sup {yields}}glass phase transition. Selected members of this series were analyzed by differential scanning calorimetry to measure the effect of the substitution on the thermal properties. The solid solutions K{sub 1-} {sub x} Rb {sub x} Sb{sub 5}S{sub 8} exhibited clear deviations in melting and crystallization behavior and temperatures from the parent structure. The crystallization process of the glassy KSb{sub 5}S{sub 8} as a function of temperature could clearly be followed with Raman spectroscopy. The thermal conductivity of both glassy and crystalline KSb{sub 5}S{sub 8} at room temperature is {approx}0.40 W/m K, among the lowest known values for any dense solid-state material. Electronic band structure calculations carried out on KSb{sub 5}S{sub 8} and TlSb{sub 5}S{sub 8} show the presence of large indirect band-gaps and confirm the coexistence of covalent Sb-S bonding and predominantly ionic K(Tl)...S bonding. Pair distribution function analyses based on total X-ray scattering data on both crystalline and glassy K{sub 1-} {sub x} Rb {sub x} Sb{sub 5}S{sub 8} showed that the basic structure-defining unit is the same and it involves a distorted polyhedron of 'SbS{sub 7}' fragment of {approx}7 A diameter. The similarity of local structure between the glassy and crystalline phases accounts for the facile crystallization rate in this system. - Graphical abstract: The KSb{sub 5}S{sub 8} is a good example of a phase-change material with a mixed ionic/covalent bonding. The members of the K{sub 1-} {sub x} Rb {sub x} Sb{sub 5}S{sub 8} series exhibit phase-change properties with greater glass forming ability (GFA) than KSb{sub 5}S{sub 8}. The GFA increases with increasing Rb content. In this case, the random alloy disorder in the alkali metal sublattice seems to predominate over the increased degree of ionicity in going from K...S

  18. Differential effects of CSF-1R D802V and KIT D816V homologous mutations on receptor tertiary structure and allosteric communication.

    Directory of Open Access Journals (Sweden)

    Priscila Da Silva Figueiredo Celestino Gomes

    Full Text Available The colony stimulating factor-1 receptor (CSF-1R and the stem cell factor receptor KIT, type III receptor tyrosine kinases (RTKs, are important mediators of signal transduction. The normal functions of these receptors can be compromised by gain-of-function mutations associated with different physiopatological impacts. Whereas KIT D816V/H mutation is a well-characterized oncogenic event and principal cause of systemic mastocytosis, the homologous CSF-1R D802V has not been identified in human cancers. The KIT D816V oncogenic mutation triggers resistance to the RTK inhibitor Imatinib used as first line treatment against chronic myeloid leukemia and gastrointestinal tumors. CSF-1R is also sensitive to Imatinib and this sensitivity is altered by mutation D802V. Previous in silico characterization of the D816V mutation in KIT evidenced that the mutation caused a structure reorganization of the juxtamembrane region (JMR and facilitated its departure from the kinase domain (KD. In this study, we showed that the equivalent CSF-1R D802V mutation does not promote such structural effects on the JMR despite of a reduction on some key H-bonds interactions controlling the JMR binding to the KD. In addition, this mutation disrupts the allosteric communication between two essential regulatory fragments of the receptors, the JMR and the A-loop. Nevertheless, the mutation-induced shift towards an active conformation observed in KIT D816V is not observed in CSF-1R D802V. The distinct impact of equivalent mutation in two homologous RTKs could be associated with the sequence difference between both receptors in the native form, particularly in the JMR region. A local mutation-induced perturbation on the A-loop structure observed in both receptors indicates the stabilization of an inactive non-inhibited form, which Imatinib cannot bind.

  19. Differential Effects of CSF-1R D802V and KIT D816V Homologous Mutations on Receptor Tertiary Structure and Allosteric Communication

    Science.gov (United States)

    Da Silva Figueiredo Celestino Gomes, Priscila; Panel, Nicolas; Laine, Elodie; Pascutti, Pedro Geraldo; Solary, Eric; Tchertanov, Luba

    2014-01-01

    The colony stimulating factor-1 receptor (CSF-1R) and the stem cell factor receptor KIT, type III receptor tyrosine kinases (RTKs), are important mediators of signal transduction. The normal functions of these receptors can be compromised by gain-of-function mutations associated with different physiopatological impacts. Whereas KIT D816V/H mutation is a well-characterized oncogenic event and principal cause of systemic mastocytosis, the homologous CSF-1R D802V has not been identified in human cancers. The KIT D816V oncogenic mutation triggers resistance to the RTK inhibitor Imatinib used as first line treatment against chronic myeloid leukemia and gastrointestinal tumors. CSF-1R is also sensitive to Imatinib and this sensitivity is altered by mutation D802V. Previous in silico characterization of the D816V mutation in KIT evidenced that the mutation caused a structure reorganization of the juxtamembrane region (JMR) and facilitated its departure from the kinase domain (KD). In this study, we showed that the equivalent CSF-1R D802V mutation does not promote such structural effects on the JMR despite of a reduction on some key H-bonds interactions controlling the JMR binding to the KD. In addition, this mutation disrupts the allosteric communication between two essential regulatory fragments of the receptors, the JMR and the A-loop. Nevertheless, the mutation-induced shift towards an active conformation observed in KIT D816V is not observed in CSF-1R D802V. The distinct impact of equivalent mutation in two homologous RTKs could be associated with the sequence difference between both receptors in the native form, particularly in the JMR region. A local mutation-induced perturbation on the A-loop structure observed in both receptors indicates the stabilization of an inactive non-inhibited form, which Imatinib cannot bind. PMID:24828813

  20. Formation of CdS/Cd{sub 1−x}Zn{sub x}S sandwich-structured quantum dots with high quantum efficiency in silicate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Xia, Mengling; Liu, Chao, E-mail: hite@whut.edu.cn; Han, Jianjun; Zhao, Xiujian

    2017-06-15

    CdS/Cd{sub 1−x}Zn{sub x}S sandwich-structured quantum dots (QDs) were precipitated in silicate glasses with high quantum efficiency up to 53%. The QDs were composed by a CdS core with a Cd{sub 1−x}Zn{sub x}S shell of about 1–3 nm in thickness through heat-treatment at 550 °C for 10 h. With the increased heat-treatment temperature, the intensity ratio between the intrinsic emission and the defects emission increased and the Stokes shift decreased from 84 to 4 meV, which was caused by both the increased size and passivated surface defects of the QDs.

  1. Electric-Field Control of Magnetism in Co40Fe40B20/(1-x)Pb(Mg1/3Nb2/3)O3-xPbTiO3 Multiferroic Heterostructures with Different Ferroelectric Phases.

    Science.gov (United States)

    Liu, Yan; Zhao, Yonggang; Li, Peisen; Zhang, Sen; Li, Dalai; Wu, Hao; Chen, Aitian; Xu, Yang; Han, X F; Li, Shiyan; Lin, Di; Luo, Haosu

    2016-02-17

    Electric-field control of magnetism in multiferroic heterostructures composed of Co40Fe40B20 (CoFeB) and (1-x)Pb(Mg1/3Nb2/3)O3-xPbTiO3 (PMN-xPT) with different ferroelectric phases via changing composition and temperature is explored. It is demonstrated that the nonvolatile looplike bipolar-electric-field-controlled magnetization, previously found in the CoFeB/PMN-xPT heterostructures with PMN-xPT in the rhombohedral (R) phase around the morphotropic phase boundary (MPB), also occurs for PMN-xPTs with both R phase (far away from MPB) and monoclinic (M) phase, suggesting that the phenomenon is the common feature of CoFeB/PMN-xPT multiferroic heterostructures for PMN-xPT with different phases. The magnitude of the effect changes with increasing temperature and volatile bipolar-electric-field-controlled magnetization with a butterflylike behavior occurs when the ferroelectric phase changes to the tetragonal phase (T). Moreover, for the R-phase sample with x = 0.18, an abrupt and giant increase of magnetization is observed at a characteristic temperature in the temperature dependence of magnetization curve. These results are discussed in terms of coupling between magnetism and ferroelectric domains including macro- and microdomains for different ferroelectric phases. This work is helpful for understanding the phenomena of electric-field control of magnetism in FM/FE multiferroic heterostructures and is also important for applications.

  2. AgSb(S{sub x}Se{sub 1−x}){sub 2} thin films for solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    González, J.O. [Universidad Autónoma de Nuevo León, Facultad de Ingeniería Mecánica y Eléctrica, San Nicolás de los Garza, Nuevo León 66450, México (Mexico); Shaji, S.; Avellaneda, D. [Universidad Autónoma de Nuevo León, Facultad de Ingeniería Mecánica y Eléctrica, San Nicolás de los Garza, Nuevo León 66450, México (Mexico); Universidad Autónoma de Nuevo León-CIIDIT, Apodaca, Nuevo León, México (Mexico); Castillo, A.G.; Roy, T.K. Das [Universidad Autónoma de Nuevo León, Facultad de Ingeniería Mecánica y Eléctrica, San Nicolás de los Garza, Nuevo León 66450, México (Mexico); and others

    2013-05-15

    Highlights: ► AgSb(S{sub x}Se{sub 1−x}){sub 2} thin films were formed by heating Na{sub 2}SeSO{sub 3} dipped Sb{sub 2}S{sub 3}/Ag layers. ► S/Se ratio was varied by changing the dipping time in Na{sub 2}SeSO{sub 3} solution. ► Characterized the films using XRD, XPS, SEM, Optical and electrical measurements. ► Band gap engineering of 1−1.1 eV for x = 0.51 and 0.52 respectively. ► PV Glass/FTO/CdS/AgSb(S{sub x}Se{sub 1−x}){sub 2}/C were prepared showing V{sub oc} = 410 mV, J{sub sc} = 5.7 mA/cm{sup 2}. - Abstract: Silver antimony sulfoselenide (AgSb(S{sub x}Se{sub 1−x}){sub 2}) thin films were prepared by heating glass/Sb{sub 2}S{sub 3}/Ag layers after selenization using sodium selenosulphate solution. First, Sb{sub 2}S{sub 3} thin films were deposited on glass substrates from a chemical bath containing SbCl{sub 3} and Na{sub 2}S{sub 2}O{sub 3}. Then Ag thin films were thermally evaporated onto glass/Sb{sub 2}S{sub 3}, followed by selenization by dipping in an acidic solution of Na{sub 2}SeSO{sub 3}. The duration of selenium dipping was varied as 30 min and 2 h. The heating condition was at 350 °C for 1 h in vacuum. Analysis of X-ray diffraction pattern of the thin films formed after heating showed the formation of AgSb(S{sub x}Se{sub 1−x}){sub 2}. Morphology and elemental analysis were done by scanning electron microscopy and energy dispersive X-ray detection. Depth profile of composition of the thin films was performed by X-ray Photoelectron Spectroscopy. The spectral study showed the presence of Ag, Sb, S, and Se, and the corresponding binding energy analysis confirmed the formation of AgSb(S{sub x}Se{sub 1−x}){sub 2}. Photovoltaic structures (PV) were prepared using AgSb(S{sub x}Se{sub 1−x}){sub 2} thin films as absorber and CdS thin films as window layers on FTO coated glass substrates. The PV structures were heated at 60–80 °C in air for 1 h to improve ohmic contact. Analysis of J–V characteristics of the PV structures showed V

  3. Assessment of residual stress of 7050-T7452 aluminum alloy forging using the contour method

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zheng [College of Mechanical and Electrical Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China); Yang, Yinfei, E-mail: yyfgoat@nuaa.edu.cn [College of Mechanical and Electrical Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China); Li, Liang [College of Mechanical and Electrical Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China); Chen, Bo; Tian, Hui [Xi’an Aircraft Industrial (Group) Co. Ltd., Xi’an 710000 (China)

    2015-09-17

    The cold-compression stress relief process has been used to reduce the quench-induced stresses in high-strength aerospace aluminum alloy forgings. However, this method does not completely relieve the stress. Longitudinal residual stresses in 7050-T7452 aluminum alloy forging were measured with contour method. The measuring procedure of the contour method including specimen cutting under clamps with a wire electrical discharge machine, contour measurement of the cut surface with a laser scanner, careful data processing and elastic finite element analysis was introduced in detail. In addition, multiple cuts were used to map cross sectional stress at different cut surfaces. Finally, the longitudinal residual stress throughout the cut plane was mapped, and through thickness longitudinal stress profiles were also analyzed. Investigated results suggest that spatial variation of stress distribution can be attributed to the non-uniform plastic deformation of the cold-compression stress relief process. The overall reduction of peak stress magnitudes is approximately 43–79%.

  4. Assessment of residual stress of 7050-T7452 aluminum alloy forging using the contour method

    International Nuclear Information System (INIS)

    Zhang, Zheng; Yang, Yinfei; Li, Liang; Chen, Bo; Tian, Hui

    2015-01-01

    The cold-compression stress relief process has been used to reduce the quench-induced stresses in high-strength aerospace aluminum alloy forgings. However, this method does not completely relieve the stress. Longitudinal residual stresses in 7050-T7452 aluminum alloy forging were measured with contour method. The measuring procedure of the contour method including specimen cutting under clamps with a wire electrical discharge machine, contour measurement of the cut surface with a laser scanner, careful data processing and elastic finite element analysis was introduced in detail. In addition, multiple cuts were used to map cross sectional stress at different cut surfaces. Finally, the longitudinal residual stress throughout the cut plane was mapped, and through thickness longitudinal stress profiles were also analyzed. Investigated results suggest that spatial variation of stress distribution can be attributed to the non-uniform plastic deformation of the cold-compression stress relief process. The overall reduction of peak stress magnitudes is approximately 43–79%

  5. Forging of eccentric co-extruded Al-Mg compounds and analysis of the interface strength

    International Nuclear Information System (INIS)

    Förster, W; Binotsch, C; Awiszus, B; Lehmann, T; Müller, J; Kirbach, C; Stockmann, M; Ihlemann, J

    2016-01-01

    Within the subproject B3 of the Collaborative Research Center 692 it has been shown that Al-Mg compounds with a good bonding quality can be produced by hydrostatic coextrusion. During processing by forging, the aluminum sleeve is thinned in areas of high strains depending on the component geometry. To solve this problem an eccentric core arrangement during co-extrusion was investigated. Based on the results of FE-simulations, the experimental validation is presented in this work. Rods with an offset of 0.25, 0.5 and 0.75 mm were produced by eccentric hydrostatic co-extrusion. Ultrasonic testing was used to evaluate the bonding quality across the entire rods. For the forging investigations the basic process Rising was chosen. The still good bonding quality after forging was examined by dye penetrant testing and optical microscopy. For an optimal stress transfer between the materials across the entire component, a sufficient bonding between the materials is essential. To evaluate the interface strength, a special bending test was developed. For the conception of the bending specimens it was required to analyze the Rising specimens geometry. These analyses were performed using a reconstruction of the geometrical data based on computer tomography (CT) investigations. The comparison with the numerically deter-mined Rising specimen geometry shows good correlation. Parametric Finite Element Analyses of the bending test were used to develop the load case and the specimen geometry. By means of iterative adaption of load application, bearing and specimen geometry parameters, an advantageous stress state and experimentally applicable configuration were found. Based on this conception, the experimental setup was configured and bending tests were performed. The interface strength was deter-mined by the calculation of the maximum interlaminar interfacial tension stress using the experimental interface failure force and the bending FE model. (paper)

  6. PILATUS: a two-dimensional X-ray detector for macromolecular crystallography

    CERN Document Server

    Eikenberry, E F; Huelsen, G; Toyokawa, H; Horisberger, R P; Schmitt, B; Schulze-Briese, C; Tomizaki, T

    2003-01-01

    A large quantum-limited area X-ray detector for protein crystallography is under development at the Swiss Light Source. The final detector will be 2kx2k pixels covering 40x40 cm sup 2. A three-module prototype with 1120x157 pixels covering an active area of 24.3x3.4 cm sup 2 has been tested. X-rays above 6 keV with peak count rates exceeding 5x10 sup 5 X-ray/pixel/s could be detected in single photon counting mode. Statistics of module production and results of threshold trimming are presented. To demonstrate the potential of this new detector, protein crystal data were collected at beamline 6S of the SLS.

  7. Simultaneous iris and hinode/eis observations and modeling of the 2014 October 27 X2.0. class flare

    Czech Academy of Sciences Publication Activity Database

    Polito, V.; Reep, W.J.; Reeves, K.K.; Simoes, P.J.A.; Dudík, Jaroslav; Del Zanna, G.; Mason, H. E.; Golub, L.

    2016-01-01

    Roč. 816, č. 2 (2016), 89/1-89/20 ISSN 0004-637X Grant - others:The Royal Society /Newton Fellowship(GB) NFAluminiNF120818; EC(XE) 606862 Program:FP7 Institutional support: RVO:67985815 Keywords : Sun * chromosphere * flares Subject RIV: BN - Astronomy , Celestial Mechanics, Astrophysics Impact factor: 5.533, year: 2016

  8. Weldability Characteristics of Sintered Hot-Forged AISI 4135 Steel Produced through P/M Route by Using Pulsed Current Gas Tungsten Arc Welding

    Science.gov (United States)

    Joseph, Joby; Muthukumaran, S.; Pandey, K. S.

    2016-01-01

    Present investigation is an attempt to study the weldability characteristics of sintered hot-forged plates of AISI 4135 steel produced through powder metallurgy (P/M) route using matching filler materials of ER80S B2. Compacts of homogeneously blended elemental powders corresponding to the above steel were prepared on a universal testing machine (UTM) by taking pre-weighed powder blend with a suitable die, punch and bottom insert assembly. Indigenously developed ceramic coating was applied on the entire surface of the compacts in order to protect them from oxidation during sintering. Sintered preforms were hot forged to flat, approximately rectangular plates, welded by pulsed current gas tungsten arc welding (PCGTAW) processes with aforementioned filler materials. Microstructural, tensile and hardness evaluations revealed that PCGTAW process with low heat input could produce weldments of good quality with almost nil defects. It was established that PCGTAW joints possess improved tensile properties compared to the base metal and it was mainly attributed to lower heat input, resulting in finer fusion zone grains and higher fusion zone hardness. Thus, the present investigation opens a new and demanding field in research.

  9. Electrical conductivity studies in (Ag3AsS3)x(As2S3)1-x superionic glasses and composites

    Science.gov (United States)

    Studenyak, I. P.; Neimet, Yu. Yu.; Kranjčec, M.; Solomon, A. M.; Orliukas, A. F.; Kežionis, A.; Kazakevičius, E.; Šalkus, T.

    2014-01-01

    Compositional, frequency, and temperature studies of impedance and electrical conductivity in (Ag3AsS3)x(As2S3)1-x superionic glasses and composites were performed. Frequency range from 10 Hz to 3 × 109 Hz and temperature interval 300-400 K were used for the measurements. Compositional dependences of electrical conductivity and activation energy are analyzed; the most substantial changes are observed with the transition from (Ag3AsS3)0.4(As2S3)0.6 glass to (Ag3AsS3)0.5(As2S3)0.5 composite. With increase of Ag3AsS3 content, the investigated materials are found to have crystalline inclusions and show the two-phase composite nature. Addition of Ag3AsS3 leads to the increase of electrical conductivity whereas the activation energy decreases.

  10. The influence of Sr on the microstructure, degradation and stress corrosion cracking of the Mg alloys - ZK40xSr.

    Science.gov (United States)

    Chen, Lianxi; Bin, Yuanhong; Zou, Wenqi; Wang, Xiaojian; Li, Wei

    2017-02-01

    In the present work, new magnesium (Mg) alloys (Mg-4Zn-0.6Zr-xSr, x=0, 0.4, 0.8, 1.2, 1.6wt%; ZK40xSr) were prepared and studied as potential biodegradable materials. The influence of strontium (Sr) addition on the properties of the new Mg alloys was investigated, which included microstructure, corrosion degradation, and the stress corrosion cracking (SCC) susceptibility. The average grain size of the ZK40Sr was approximately 100µm, which was significantly smaller than that of ZK40 alloy without Sr (402.3±40.2µm). The size of grain boundaries precipitates in the ZK40xSr alloys gradually increased with the increase of Sr content. The grain boundaries finally showed a continuously distribution and net-like shape. The degradation test showed that the average degradation rate of the ZK40xSr alloys increased with the increase of Sr addition. In the case of Mg-4Zn-0.6Zr, the degradation rate was 2.2mgcm -2 day -1 , which was lower than that of Mg-4Zn-0.6Zr-1.6Sr (4.93mgcm -2 day -1 ). When the ZK40xSr alloys were immersed in m-SBF, the rod-like Sr-contained hydroxyapatite (HA) substance was detected, which was known to enhance cell growth around bone implants. The fracture surfaces of the as-cast Mg-4Zn-0.6Zr-1.6Sr were shown intergranular stress corrosion cracking (IGSCC) patterns. The increase of SCC susceptibility of the higher Sr ZK40xSr alloys was attributed to the increase of micro-galvanic corrosion between the α-Mg and the grain boundaries precipitates. The SCC susceptibility values were ≈0.13 and ≈0.41 for the Mg-4Zn-0.6Zr-0.4Sr and the Mg-4Zn-0.6Zr-1.6Sr, respectively. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. X-ray diffraction studies of the Tl(GaS{sub 2}){sub 1–x}(InSe{sub 2}){sub x} solid solutions

    Energy Technology Data Exchange (ETDEWEB)

    Sheleg, A. U.; Hurtavy, V. G., E-mail: hurtavy@physics.by; Chumak, V. A. [National Academy of Sciences of Belarus, Scientific-Practical Materials Research Center (Belarus); Mustafaeva, S. N.; Kerimova, E. M. [Azerbaijan National Academy of Sciences, Institute of Physics (Azerbaijan)

    2016-07-15

    The unit-cell parameters of crystals obtained in the Tl(GaS{sub 2}){sub 1–x}(InSe{sub 2}){sub x} system are measured by X-ray diffraction. The relationship between these parameters and composition is determined. It is shown that, with growing x, the a, b, and c parameters increase and the β angle decreases. Two types of solid solutions are found in the Tl(GaS{sub 2}){sub 1–x}(InSe{sub 2}){sub x} system: one is based on compound TlGaS{sub 2} with monoclinic structure and the other is based on TlInSe{sub 2} with tetragonal structure.

  12. Purinergní P2X rodina a specifické vlastnosti P2X7 podtypu

    Czech Academy of Sciences Publication Activity Database

    Jindřichová, Marie; Zemková, Hana

    2013-01-01

    Roč. 62, č. 2 (2013), s. 40-46 ISSN 1210-6313 R&D Projects: GA ČR(CZ) GPP304/12/P371 Institutional support: RVO:67985823 Keywords : extracellular ATP * purinergic P2X family * P2X7 receptor * cell proliferation and apoptosis Subject RIV: ED - Physiology

  13. Follow-up of hearing thresholds among forge hammering workers

    Energy Technology Data Exchange (ETDEWEB)

    Kamal, A.A.; Mikael, R.A.; Faris, R. (Ain Shams Univ., Abbasia, Cairo (Egypt))

    1989-01-01

    Hearing threshold was reexamined in a group of forge hammering workers investigated 8 years ago with consideration of the age effect and of auditory symptoms. Workers were exposed to impact noise that ranged from 112 to 139 dB(A)--at an irregular rate of 20 to 50 drop/minute--and a continuous background noise that ranged from 90 to 94 dB(A). Similar to what was observed 8 years ago, the present permanent threshold shift (PTS) showed a maximum notch at the frequency of 6 kHz and considerable elevations at the frequencies of 0.25-1 kHz. The age-corrected PTS and the postexposure hearing threshold were significantly higher than the corresponding previous values at the frequencies 0.25, 0.5, 1, and 8 kHz only. The rise was more evident at the low than at the high frequencies. Temporary threshold shift (TTS) values were significantly less than those 8 years ago. Contrary to the previous TTS, the present TTS were higher at low than at high frequencies. Although progression of PTS at the frequencies 0.25 and 0.5 kHz was continuous throughout the observed durations of exposure, progression at higher frequencies occurred essentially in the first 10 to 15 years of exposure. Thereafter, it followed a much slower rate. Tinnitus was significantly associated with difficulty in hearing the human voice and with elevation of PTS at all the tested frequencies, while acoustic after-image was significantly associated with increment of PTS at the frequencies 0.25-2 kHz. No relation between PTS and smoking was found. PTS at low frequencies may provide an indication of progression of hearing damage when the sensitivity at 6 and 4 kHz diminishes after prolonged years of exposure. Tinnitus and acoustic after-image are related to the auditory effect of forge hammering noise.

  14. Disruption of dopamine homeostasis has sexually dimorphic effects on senescence characteristics of Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Bednářová, Andrea; Hanna, M. E.; Rakshit, K.; O’Donnell, J. M.; Krishnan, N.

    2017-01-01

    Roč. 45, č. 6 (2017), s. 816-825 ISSN 0953-816X R&D Projects: GA MŠk(CZ) LH14047 Grant - others:GA JU(CZ) 038/2014/P Institutional support: RVO:60077344 Keywords : 4-hydroxynonenal * aging * circadian rhythms Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.941, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/ejn.13525/pdf

  15. Integrable systems from membranes on AdS4 x S7

    International Nuclear Information System (INIS)

    Bozhilov, P.

    2008-01-01

    We describe how Neumann and Neumann-Rosochatius type integrable systems, as well as the continuous limit of the SU(2) integrable spin chain, can be obtained from membranes on AdS 4 x S 7 background, in the framework of AdS/CFT correspondence. (Abstract Copyright [2008], Wiley Periodicals, Inc.)

  16. Composition tuning of rectifying polarity of colloidal CdS{sub 1−x}Se{sub x} nanocrystal-based devices

    Energy Technology Data Exchange (ETDEWEB)

    An, Yuehua; Wu, Zhenping; Chu, Xulong; Guo, Daoyou; Guo, Xuncai [Beijing University of Posts and Telecommunications, Laboratory of Optoelectronics Materials and Devices, School of Science (China); Li, Linghong [The State University of New York at Potsdam, Physics Department (United States); Li, Peigang, E-mail: pgli@zstu.edu.cn [Zhejiang Sci-Tech University, Department of Physics, Center for Optoelectronics Materials and Devices (China); Tang, Hao [The University of Tennessee at Knoxville, Department of Chemistry (United States); Tang, Weihua, E-mail: whtang@bupt.edu.cn [Beijing University of Posts and Telecommunications, Laboratory of Optoelectronics Materials and Devices, School of Science (China)

    2015-03-15

    CdS{sub 1–x}Se{sub x} colloidal nanocrystals (NCs) were synthesized by colloidal chemistry route. Both lattice parameters and band structure were modulated by tuning the content of Se. As the Se content increases, the peak of UV–Visible absorbance spectrum of CdS{sub 1−x}Se{sub x} shifts toward longer wavelength direction, indicating the reduction of band gap. Devices with Au/CdS{sub 1−x}Se{sub x} NCs/Au structures have been fabricated by assembling the obtained CdS{sub 1−x}Se{sub x} NCs into Au microelectrodes via dielectrophoresis method. It is found that the rectifying polarities of the devices are strongly dependent on the content of Se. With the increasing Se content, the rectification polarity changes from backward to forward. This polarity tuning could be caused by the change of the relative height of the Fermi levels between CdS{sub 1−x}Se{sub x} and Au. The Se-content-dependent rectifying behavior may offer us an opportunity to design novel logical structure in NC-based nanoelectronics.

  17. Spectrum and quantum symmetries of the AdS{sub 5} x S{sup 5} superstring

    Energy Technology Data Exchange (ETDEWEB)

    Heinze, Martin

    2014-12-18

    The initial AdS/CFT duality pair, the duality between N=4 SYM and the AdS{sub 5} x S{sup 5} superstring, appears to enjoy quantum integrability in the planar limit, which allowed to devise powerful methods ostensibly solving the spectral problem. However, quantization of the AdS{sub 5} x S{sup 5} superstring from first principles is still an open question and especially the spectrum of short string states has previously been derived only at leading order in large 't Hooft coupling. In this thesis we investigate possible routes to quantize short string states perturbatively beyond the leading order, where equally our aim is to gain better appreciation of the quantum symmetries at play. A prominent role is played by the lowest excited string states, dual to the Konishi supermultiplet, and we start by reviewing critically an asserted derivation of the Konishi anomalous dimension in the setup of pure spinor string theory. Next, we constrain ourselves to bosonic AdS{sub 5} x S{sup 5} String in static gauge, where we construct a so-called single-mode string solution, a generalization of the pulsating string allowing for unconstrained zero-modes. This solution shows classical integrability and invariance under the isometries SO(2,4) x SO(6) at the quantum level. Arguing heuristically about the effects of supersymmetry, we indeed recover the first non-trivial quantum correction to the Konishi anomalous dimension. We continue by implementing static gauge for the full AdS{sub 5} x S{sup 5} superstring and find elegant expressions for the Lagrangian density and the supercharges. We then constrain our interest to the superparticle and, using two different methods, find canonical coordinates at quadratic order in fermions. We conclude by exploring another quantization scheme: As the single-mode string is nothing but the SO(2,4) x SO(6) orbit of the pulsating string, we apply orbit method quantization to the particle and spinning string solutions in bosonic AdS{sub 3} x S

  18. S1 new

    Indian Academy of Sciences (India)

    DMSO Release. ATRi Release. Only EdU. Only ATRi. *. *. *. n.s. n.s. B. 0. 10. 20. 30. 40. 50. 60. 15 mins 20 mins 30 mins 40 mins 60 mins. % o. f p. R a d. 1. 7 p o s tiv e c e lls. HU + DMSO. HU + ATRi. *. *. *. *. n.s. 0. 0. 20. 30. 40. 50. 60. 70. 80. 2 h Treatment. 24 h Treatment γ. H. 2. A. X. P o s i t i v e. N u c l e i. HU+DMSO ...

  19. Electro-optical properties of Cd1-xZnxS films and fabrication of Cd1-xZnxS/InP heterojunctions

    International Nuclear Information System (INIS)

    Pal, A.K.; Dhar, A.; Mondal, A.; Basak, R.L.; Chaudhuri, S.

    1988-01-01

    The authors describe Cd 1-x Zn x S films (0 ≤ x ≤ 0.2) characterized by electrical and optical measurements to obtain optimum deposition condition for device fabrication on p-type single crystal InP (Zn doped) with (100) orientation. The devices were studied by I-V, C-V and spectral response measurements

  20. {\\rm{ZnO}}_{1-{{x}}}{\\rm{Te}}_{{{x}}} and {\\rm{ZnO}}_{1-{{x}}}\\rm{S}_{{{x}}} semiconductor alloys as competent materials for opto-electronic and solar cell applications: a comparative analysis

    Science.gov (United States)

    Das, Utsa; Pal, Partha P.

    2017-08-01

    ZnO1-x Te x ternary alloys have great potential to work as a photovoltaic (PV) absorber in solar cells. ZnO1-x S x is also a ZnO based alloy that have uses in solar cells. In this paper we report the comparative study of various parameters of ZnO1-x Te x and ZnO1-x S x for selecting it to be a competent material for solar cell applications. The parameters are mainly being calculated using the well-known VCA (virtual crystal approximation) and VBAC (Valence Band Anti-Crossing) model. It was certainly being analysed that the incorporation of Te atoms produces a high band gap lower than S atoms in the host ZnO material. The spin-orbit splitting energy value of ZnO1-x Te x was found to be higher than that of ZnO1-x S x . Beside this, the strain effects are also higher in ZnO1-x Te x than ZnO1-x S x . The remarkable notifying result which the paper is reporting is that at a higher percentage of Te atoms in ZnO1-x Te x , the spin-orbit splitting energy value rises above the band gap value, which signifies a very less internal carrier recombination that decreases the leakage current and increases the efficiency of the solar cell. Moreover, it also covers a wide wavelength range compared to ZnO1-x S x .

  1. One-pot synthesis of Zn{sub x}Cd{sub 1-x}S nanocrystals with tunable optical properties from molecular precursors

    Energy Technology Data Exchange (ETDEWEB)

    Chen Zhigang, E-mail: zgchen@dhu.edu.c [State Key Laboratory for Modification of Chemical Fibers and Polymer Materials, College of Materials Science and Engineering, Donghua University, Shanghai 201620 (China); Tian Qiwei; Song Yuelin [State Key Laboratory for Modification of Chemical Fibers and Polymer Materials, College of Materials Science and Engineering, Donghua University, Shanghai 201620 (China); Yang Jianmao [Research Center for Analysis and Measurement, Donghua University, Shanghai 201620 (China); Hu Junqing, E-mail: hu.junqing@dhu.edu.c [State Key Laboratory for Modification of Chemical Fibers and Polymer Materials, College of Materials Science and Engineering, Donghua University, Shanghai 201620 (China)

    2010-09-17

    We have reported a non-injection one-pot synthesis of the alloyed Zn{sub x}Cd{sub 1-x}S semiconductor nanocrystals (SNCs) with controlled shapes and compositions. This non-injection approach involves heating two molecular precursors (cadmium ethylxanthate and zinc ethylxanthate) as metal and S sources in organic solvents at 320 {sup o}C for 30 min, which results in the thermal decompositions of the molecular precursors to produce Zn{sub x}Cd{sub 1-x}S. The effects of solvents and compositions on the shapes and structures of Zn{sub x}Cd{sub 1-x}S SNCs have been investigated. The mixture solvent containing oleic acid, paraffin oil and oleylamine (such as a volume ratio: 1/2/1) results in the preparation of uniform Zn{sub x}Cd{sub 1-x}S nanoparticles with diameters of 7-13 nm, while pure oleylamine or the mixture of oleylamine and paraffin oil as the solvent leads to the formation of uniform Zn{sub x}Cd{sub 1-x}S nanorods. Monodisperse wurtzite Zn{sub x}Cd{sub 1-x}S nanorods with different compositions have been prepared in pure oleylamine, and no obvious effects of the compositions on their shapes are found. Their alloying nature is consistently confirmed by the results of high-resolution transmission electron microscopy (HRTEM), X-ray diffraction (XRD) and optical measurements. These alloyed Zn{sub x}Cd{sub 1-x}S nanorods exhibit composition-dependent absorption and emission properties, and therefore they can be promising candidates as emitting materials.

  2. Process parameter influence on Electro-sinter-forging (ESF) of titanium discs

    DEFF Research Database (Denmark)

    Cannella, Emanuele; Nielsen, Chris Valentin; Bay, Niels

    Electro-sinter-forging (ESF) is a sintering process based on the resistance heating principle, which makes it faster than conventional sintering. The process is investigated as a function of the main process parameters, namely compacting pressure, electrical current density and sintering time....... The present work is focused on analysing the influence of these process parameters on the final density of a disc sample made from commercially pure titanium powder. Applying the design of experiments (DoE) approach, the electrical current was seen to be of largest influence. The maximum obtained density...

  3. Slip-line field analysis of metal flow during two dimensional forging

    International Nuclear Information System (INIS)

    Fenton, R.G.; Khataan, H.A.

    1981-01-01

    A method of computation and a computer software package were developed for solving problems of two dimensional plastic flow between symmetrical dies of any specified shape. The load required to initiate plastic flow, the stress and velocity distributions in the plastic region of the metal, and the pressure distribution acting on the die are determined. The method can be used to solve any symmetrical plane strain flow problem regardless of the complexity of the die. The accurate solution obtained by this efficient method can provide valuable help to forging die designers. (Author) [pt

  4. Photosensitive thin-film In/p-Pb{sub x}Sn{sub 1-x}S Schottky barriers: Fabrication and properties

    Energy Technology Data Exchange (ETDEWEB)

    Gremenok, V. F., E-mail: gremenok@ifttp.bas-net.by [Scientific-Practical Center of the National Academy of Sciences of Belarus State Scientific and Production Association (Belarus); Rud' , V. Yu., E-mail: rudvas.spb@gmail.com [St. Petersburg State Polytechnic University (Russian Federation); Rud' , Yu. V. [Russian Academy of Sciences, Ioffe Physical Technical Institute (Russian Federation); Bashkirov, S. A.; Ivanov, V. A. [Scientific-Practical Center of the National Academy of Sciences of Belarus State Scientific and Production Association (Belarus)

    2011-08-15

    Thin Pb{sub x}Sn{sub 1-x}S films are obtained by the 'hot-wall' method at substrate temperatures of 210-330 Degree-Sign C. The microstructure, composition, morphology, and electrical characteristics of films are investigated. On the basis of the obtained films, photosensitive In/p-Pb{sub x}Sn{sub 1-x}S Schottky barriers are fabricated for the first time. The photosensivity spectra of these structures are investigated, and the character of interband transitions and the band-gap values are determined from them. The conclusion is drawn that Pb{sub x}Sn{sub 1-x}S thin polycrystalline films may be used in solar-energy converters.

  5. Movement Synchrony Forges Social Bonds Across Group Divides

    Directory of Open Access Journals (Sweden)

    Bahar eTuncgenc

    2016-05-01

    Full Text Available Group dynamics play an important role in the social interactions of both children and adults. A large amount of research has shown that merely being allocated to arbitrarily defined groups can evoke disproportionately positive attitudes toward one’s in-group and negative attitudes toward out-groups, and that these biases emerge in early childhood. This prompts important empirical questions with far-reaching theoretical and applied significance. How robust are these inter-group biases? Can biases be mitigated by behaviors known to bond individuals and groups together? How can bonds be forged across existing group divides? To explore these questions, we examined the bonding effects of interpersonal synchrony on minimally constructed groups in a controlled experiment. In-group and out-group bonding were assessed using questionnaires administered before and after a task in which groups performed movements either synchronously or non-synchronously in a between-participants design. We also developed an implicit behavioral measure, the Island Game, in which physical proximity was used as an indirect measure of interpersonal closeness. Self-report and behavioral measures showed increased bonding between groups after synchronous movement. Bonding with the out-group was significantly higher in the condition in which movements were performed synchronously than when movements were performed non-synchronously between groups. The findings are discussed in terms of their importance for the developmental social psychology of group dynamics as well as their implications for applied intervention programs.

  6. Weld-forged rotors of the turbines for nuclear and thermal power plants

    International Nuclear Information System (INIS)

    Rudkovskij, A.F.; German, S.I.

    1979-01-01

    Considered is a principally new technology and equipment for assembling and welding superheavy rotors with mass up to 200 tons. Construction peculiarities and advantages of the application of weld-forged rotors are noted. The technology proposed permits to provide for a horizontal assembling, subsequent welding and quality control of rotors, one bench being used instead of three ones. The application of horizontal assembling and complex welding of rotors in one position permits not only to shorten the cycle of assembling and welding, too decrease the equipment costs and release production capacities, but also to improve substantially the quality of welds and especially the accuracy of rotor production. The equipment allows one to assemble and weld rotors with the mass up to 250 tons at maximum rotor diameter up to 2500 mm and length up to 13000 mm. Presented are data characterizing chemical composition and mechanical properties of steels used for forging of welded rotors. Also given are the results of studying mechanical properties of welded joints, welding and thermal treatment of which were made in accordance with the technology proposed. Serial production of rotors for turbines with the power of 500, 1000 and 1200 Mw is shown to be mastered along with the manufacture of welded rotors for cylinders of low, medium and high pressure turbines

  7. Band alignment at the Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4}/CdS interface

    Energy Technology Data Exchange (ETDEWEB)

    Haight, Richard; Barkhouse, Aaron; Gunawan, Oki; Shin, Byungha; Copel, Matt; Hopstaken, Marinus; Mitzi, David B [IBM TJ Watson Research Center, P.O. Box 218, Yorktown Hts., New York 10598 (United States)

    2011-06-20

    Energy band alignments between CdS and Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} (CZTSSe) grown via solution-based and vacuum-based deposition routes were studied as a function of the [S]/[S+Se] ratio with femtosecond laser ultraviolet photoelectron spectroscopy, photoluminescence, medium energy ion scattering, and secondary ion mass spectrometry. Band bending in the underlying CZTSSe layer was measured via pump/probe photovoltage shifts of the photoelectron spectra and offsets were determined with photoemission under flat band conditions. Increasing the S content of the CZTSSe films produces a valence edge shift to higher binding energy and increases the CZTSSe band gap. In all cases, the CdS conduction band offsets were spikes.

  8. Taking the Lead in Science Education: Forging Next-Generation Science Standards. International Science Benchmarking Report. Appendix

    Science.gov (United States)

    Achieve, Inc., 2010

    2010-01-01

    This appendix accompanies the report "Taking the Lead in Science Education: Forging Next-Generation Science Standards. International Science Benchmarking Report," a study conducted by Achieve to compare the science standards of 10 countries. This appendix includes the following: (1) PISA and TIMSS Assessment Rankings; (2) Courses and…

  9. Hard x-ray measurements of the hot-electron rings in EBT-S

    International Nuclear Information System (INIS)

    Hillis, D.L.

    1982-06-01

    A thorough understanding of the hot electron rings in ELMO Bumpy Torus-Scale (EBT-S) is essential to the bumpy torus concept of plasma production, since the rings provide bulk plasma stability. The hot electrons are produced via electron cyclotron resonant heating using a 28-GHz cw gyrotron, which has operated up to power levels of 200 kW. The parameters of the energetic electron rings are studied via hard x-ray measurement techniques and with diamagnetic pickup coils. The hard x-ray measurements have used collimated NaI(Tl) detectors to determine the electron temperature T/sub e/ and electron density n/sub e/ for the hot electron annulus. Typical values of T/sub e/ are 400 to 500 keV and of n/sub e/ 2 to 5 x 10 11 cm -3 . The total stored energy of a single energetic electron ring as measured by diamagnetic pickup loops approaches approx. 40 J and is in good agreement with that deduced from hard x-ray measurements. By combining the experimental measurements from hard x-rays and the diamagnetic loops, an estimate can be obtained for the volume of a single hot electron ring. The ring volume is determined to be approx. 2.2 litres, and this volume remains approximately constant over the T-mode operating regime. Finally, the power in the electrons scattered out of the ring is measured indirectly by measuring the x-ray radiation produced when those electrons strike the chamber walls. The variation of this radiation with increasing microwave power levels is found to be consistent with classical scattering estimates

  10. A Comparative Study on Wear Properties of As Cast, Cast Aged and Forge Aged A356 Alloy with Addition of Grain Refiner and/or Modifier

    Directory of Open Access Journals (Sweden)

    D.G. Mallapur

    2015-03-01

    Full Text Available In the present work, a comparative wear behavior study of three categories of materials viz, as cast, cast aged (casting followed by T6 and forge aged (forging followed by T6 has been investigated. Neither melt treatment nor solid state processing (like aging and forging seems to be altering the wear behavior of the materials drastically. Cast aged A356 materials exhibit higher wear resistance compared to as cast and forge aged A356 materials. Further, it was observed that cast aged samples register lower coefficient of friction compared to other samples. It is also noted that the difference in wear behavior is revealed only at conditions of higher load, higher speed and longer sliding distance of testing. At lower regimes the difference is marginal. Among cast aged samples, ones treated with combined addition exhibit better wear resistance compared to other materials. Samples treated with combined addition register lowest coefficient of friction followed by samples treated with Sr, those with B, those with Ti and untreated ones. Abrasive wear mechanism is found to be operative in the regime of higher loading and higher velocity of sliding. Adhesive wear mechanism seems to be dominating the wear process at the lower regime of load and velocity of sliding.

  11. Synthesis and Thermoelectric Properties in the 2D Ti1 ? x Nb x S3 Trichalcogenides

    OpenAIRE

    Misse, Patrick R. N.; Berthebaud, David; Lebedev, Oleg I.; Maignan, Antoine; Guilmeau, Emmanuel

    2015-01-01

    A solid solution of Ti1 ? x Nb x S3 composition (x = 0, 0.05, 0.07, 0.10) was synthesized by solid-liquid-vapor reaction followed by spark plasma sintering. The obtained compounds crystallize in the monoclinic ZrSe3 structure type. For the x = 0.07 sample, a mixture of both A and B variants of the MX3 structure is evidenced by transmission electron microscopy. This result contrasts with those of pristine TiS3, prepared within the same conditions, which crystallizes as a large majority of A va...

  12. Continuum enhancements in the ultraviolet, the visible and the infrared during the X1 flare on 2014 March 29

    Czech Academy of Sciences Publication Activity Database

    Klient, L.; Heinzel, Petr; Judge, P.; Krucker, S.

    2016-01-01

    Roč. 816, č. 2 (2016), 88/1-88/14 ISSN 0004-637X R&D Projects: GA ČR GAP209/12/1652 Grant - others:EC(XE) 606862 Program:FP7 Institutional support: RVO:67985815 Keywords : Sun flares * techniques * spectroscopic Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.533, year: 2016

  13. Interpretation of the Raman spectra of the glassy states of Si{sub x}S{sub 1−x} and Si{sub x}Se{sub 1−x}

    Energy Technology Data Exchange (ETDEWEB)

    Devi, V. Radhika [M.L.R. Institute of Technology, Affiliated to Jawaharlal Nehru Technological University, Dundigal, Hyderabad 500043 (India); Zabidi, Noriza Ahmad [Department of Physics, Centre for Defence Foundation Studies, National Defence University of Malaysia, Kem Sungai Besi, Kuala Lumpur 57000 (Malaysia); Shrivastava, Keshav N., E-mail: keshav1001@yahoo.com [School of Physics, University of Hyderabad, Hyderabad 50046 (India); Department of Physics, University of Malaya, Kuala Lumpur 50603 (Malaysia)

    2013-09-16

    We use the density-functional theory to make models of Si{sub x}S{sub y} and Si{sub x}Se{sub y} for the values of x,y = 1–6. The vibrational frequencies are calculated for each model. The stable clusters are selected on the basis of positive vibrational frequencies. In the case of Si{sub x}S{sub 1−x}, the values of the vibrational frequencies calculated from the first principles for Si{sub 2}S(triangular)cluster of atoms, 364.1 cm{sup −1} and 380.8 cm{sup −1}, agree with the experimentally measured values of 367 cm{sup −1} and 381 cm{sup −1}, indicating that Si{sub 2}S clusters occur in the glassy state of SiS. The calculated values of the vibrational frequencies of SiSe{sub 4} (pyramidal) which agree with the experimental Raman frequencies of glassy Si{sub x}Se{sub 1−x} are 114, 166 and 361 cm{sup −1}. The calculated values for Si{sub 2}Se{sub 4} (bipyramidal) which agree with the experimental data of Si{sub x}Se{sub 1−x} are 166 and 464 cm{sup −1}. In Si{sub 4}Se (pyramidal) the values 246 and 304 cm{sup −1} agree with the measured values. In Si{sub 4}Se{sub 2} (bipyramidal), the calculated values 162, 196 and 304 cm{sup −1} agree with the measured values. The calculated values of 473 cm{sup −1} for Si{sub 6}Se{sub 2} (bipyramidal) also agree with the experimentally measured values. We thus find that pyramidal structures are present in the amorphous Si{sub x}Se{sub 1−x} glassy state. - Highlights: • A first principles calculation is performed to calculate the vibrational frequencies. • The calculated frequencies of clusters agree with measured Raman values. • The structures, bond lengths and symmetries are determined. • The importance of Jahn–Teller effect in SiS and in SiSe is clearly seen. • The clusters of SiS and SiSe are found to stabilize in different symmetries.

  14. On the Effects of Hot Forging and Hot Rolling on the Microstructural Development and Mechanical Response of a Biocompatible Ti Alloy

    Science.gov (United States)

    Okazaki, Yoshimitsu

    2012-01-01

    Zr, Nb, and Ta as alloying elements for Ti alloys are important for attaining superior corrosion resistance and biocompatibility in the long term. However, note that the addition of excess Nb and Ta to Ti alloys leads to higher manufacturing cost. To develop low-cost manufacturing processes, the effects of hot-forging and continuous-hot-rolling conditions on the microstructure, mechanical properties, hot forgeability, and fatigue strength of Ti-15Zr-4Nb-4Ta alloy were investigated. The temperature dependences with a temperature difference (ΔT) from β-transus temperature (Tβ) for the volume fraction of the α- and β-phases were almost the same for both Ti-15Zr-4Nb-4Ta and Ti-6Al-4V alloys. In the α-β-forged Ti-15Zr-4Nb-4Ta alloy, a fine granular α-phase structure containing a fine granular β-phase at grain boundaries of an equiaxed α-phase was observed. The Ti-15Zr-4Nb-4Ta alloy billet forged at Tβ-(30 to 50) °C exhibited high strength and excellent ductility. The effects of forging ratio on mechanical strength and ductility were small at a forging ratio of more than 3. The maximum strength (σmax) markedly increased with decreasing testing temperature below Tβ. The reduction in area (R.A.) value slowly decreased with decreasing testing temperature below Tβ. The temperature dependences of σmax for the Ti-15Zr-4Nb-4Ta and Ti-6Al-4V alloys show the same tendency and might be caused by the temperature difference (ΔT) from Tβ. It was clarified that Ti-15Zr-4Nb-4Ta alloy could be manufactured using the same manufacturing process as for previously approved Ti-6Al-4V alloy, taking into account the difference (ΔT) between Tβ and heat treatment temperature. Also, the manufacturing equivalency of Ti-15Zr-4Nb-4Ta alloy to obtain marketing approval of implants was established. Thus, it was concluded that continuous hot rolling is useful for manufacturing α-β-type Ti alloy.

  15. Occupational noise exposure in small scale hand tools manufacturing (forging) industry (SSI) in Northern India.

    Science.gov (United States)

    Singh, Lakhwinder Pal; Bhardwaj, Arvind; Deepak, K K; Bedi, Raman

    2009-08-01

    Occupational noise has been recognized as hazardous for the human beings. A high noise level in forging shops is considered to lower the labour productivity and cause illness however occupational noise is being accepted as an integral part of the job. The present study has been carried out in 5 small scale hand tool forging units (SSI) of different sizes in Northern India in Punjab. Noise levels at various sections were measured. OSHA norms for hearing conservation has been incorporated which includes an exchange rate of 5 dB (A), criterion level at 90 dB (A), criterion time of 8 h, threshold level=80 dB (A), upper limit=140 dB (A) and with F/S response rate. Equivalent sound pressure level (L(eq)) has been measured in various sections of these plants. Noise at various sections like hammer section, cutting presses, punching, grinding and barrelling process was found to be >90 dB (A), which is greater than OSHA norms. A cross-sectional study on the basis of questionnaire has been carried out. The results of which revealed that 68% of the workers are not wearing ear protective equipments out of these 50% were not provided with PPE by the company. About 95% of the workers were suffering speech interference though high noise annoyance was reported by only 20%. It has been established that the maximum noise exposure is being taken by the workers as they are working more than 8h a day for six days per week. More than 90% workers are working 12 to 24 h over time per week which lead to very high noise exposure i.e. 50 to 80% per week higher than exposure time/week in USA or European countries(15, 16)).

  16. 76 FR 24856 - Heavy Forged Hand Tools (i.e., Axes & Adzes, Bars & Wedges, Hammers & Sledges, and Picks...

    Science.gov (United States)

    2011-05-03

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-803] Heavy Forged Hand Tools (i.e... Administration, International Trade Administration, Department of Commerce. SUMMARY: On January 3, 2011, the Department of Commerce (``Department'') initiated a sunset review of the antidumping duty orders on heavy...

  17. Development of seamless forged pipe and fitting for BWR recirculation loop piping with improved resistance to intergranular stress corrosion cracking

    International Nuclear Information System (INIS)

    Ohnishi, Keizo; Tsukada, Hisashi; Kobayashi, Masayoshi; Iwadate, Tadao; Ono, Shinichi

    1981-01-01

    As a primary remedy for IGSCC of primary loop piping, especially Recirculation Loop Piping of BWR, extra low carbon stainless steel with high nitrogen content has become to be used. While, in order to make In-service Inspection easier and complete, new design of piping which decrease both number and total length of weld line has been considered. Japan Steel Works has developed the research on large size seamless forged pipe and fitting made from high nitrogen extra low carbon 316 stainless steel. This paper describes the key points of manufacturing technology as well as the material properties, especially strength and intergranular-corrosion and intergranular- stress-corrosion-cracking-resistivities of these forged pipe and fitting. (author)

  18. Lightweight Combat Vehicle S and T Campaign

    Science.gov (United States)

    2014-10-06

    reducing half- shaft torque requirement, keeping each motor centrally located between each wheel set and providing high drive efficiency. Design ...that could be applied to these components are: 1. Redesign and change the hub, road arm, and spindle away from a solid forged design to hollow cross...X Drivetrain  Topology for gear design o Composite construction (steel teeth pressed onto Al or Mg hub)  Drill axial holes in shafts for

  19. Transmission electron microscopy of aged Ti-10Mo-20Nb alloy after hot swaging; Microscopia eletronica de transmissao da liga Ti-10Mo-20Nb envelhecida apos forjamento a quente

    Energy Technology Data Exchange (ETDEWEB)

    Gabriel, Sinara Borborema, E-mail: sinarab@msn.com [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil); Baldan, Renato, E-mail: renatobaldan@gmail.com [Universidade de Sao Paulo (EEL/USP), Lorena, SP (Brazil). Escola de Engenharia; Torres, Juliana; Oliveira, Nathalia Rodrigues, E-mail: juliana_torres_5@hotmail.com, E-mail: nathalia_roliveira@yahoo.com.br [Centro Universitario de Volta Redonda (UNIFOA), Volta Redonda, RJ (Brazil); Nunes, Carlos Angelo; Mei, Paulo Roberto, E-mail: cnunes@demar.eel.usp.br, E-mail: pmei@fem.unicamp.br [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil)

    2014-08-15

    Ti alloys are widely used in biomedical applications. Within this class, metastable β -Ti alloys stand, because through thermomechanical processing it is possible to obtain mechanical properties and in particular one suitable Young's modulus for biomedical applications. These alloys require high mechanical strength and a low Young's modulus to avoid stress shielding. Preliminary studies showed that the microstructure of the Ti-10Mo- 20Nb alloy after cold forging and aging 500 °C/24 h consisted in bimodal distribution of α phase in the β matrix. The aim of this study was to characterize the microstructure of Ti-10Mo-20Nb alloy after hot forging and aging at 500 °C for 24 hours. Microstructural characterization consisted of analyzes by X-ray diffraction and transmission electron microscopy. According to the results, while the cold forging resulted in a bimodal α distribution in the β matrix, hot forging resulted in a thin and homogeneous α precipitation in the β matrix. (author)

  20. SphinX: A Fast Solar Photometer in X-rays J. Sylwester , S. Kuzin ...

    Indian Academy of Sciences (India)

    NAS solar mission. SphinX (Solar Photometer in X-rays) will use PIN silicon detectors for high time resolution (0.01 s) measurements of the solar spectra of .... right panel of Fig. 2. In this NBF concept, three fluorescing targets illuminate a single. PIN detector. The fluorescence radiation is coming from three different pure ...