WorldWideScience

Sample records for foca transporters identified

  1. Grisms Developed for FOCAS

    CERN Document Server

    Ebizuka, Noboru; Oka, Keiko; Yamada, Akiko; Kashiwagi, Masako; Kodate, Kashiko; Hattori, Takashi; Kashikawa, Nobunari; Iye, Masanori

    2011-01-01

    Faint Object Camera and Spectrograph (FOCAS) is a versatile common-use optical instrument for the 8.2m Subaru Telescope, offering imaging and spectroscopic observations. FOCAS employs grisms with resolving powers ranging from 280 to 8200 as dispersive optical elements. A grism is a direct-vision grating composed of a transmission grating and prism(s). FOCAS has five grisms with replica surface-relief gratings including an echelle-type grism, and eight grisms with volume-phase holographic (VPH) gratings. The size of these grisms is 110 mm X 106 mm in aperture with a maximum thickness of 110 mm. We employ not only the dichromated gelatin, but also the hologram resin as a recording material for VPH gratings. We discuss the performance of these FOCAS grisms measured in the laboratory, and verify it by test observations, and show examples of astronomical spectroscopic observations.

  2. The formate channel FocA exports the products of mixed-acid fermentation.

    Science.gov (United States)

    Lü, Wei; Du, Juan; Schwarzer, Nikola J; Gerbig-Smentek, Elke; Einsle, Oliver; Andrade, Susana L A

    2012-08-14

    Formate is a major metabolite in the anaerobic fermentation of glucose by many enterobacteria. It is translocated across cellular membranes by the pentameric ion channel/transporter FocA that, together with the nitrite channel NirC, forms the formate/nitrite transporter (FNT) family of membrane transport proteins. Here we have carried out an electrophysiological analysis of FocA from Salmonella typhimurium to characterize the channel properties and assess its specificity toward formate and other possible permeating ions. Single-channel currents for formate, hypophosphite and nitrite revealed two mechanistically distinct modes of gating that reflect different types of structural rearrangements in the transport channel of each FocA protomer. Moreover, FocA did not conduct cations or divalent anions, but the chloride anion was identified as further transported species, along with acetate, lactate and pyruvate. Formate, acetate and lactate are major end products of anaerobic mixed-acid fermentation, the pathway where FocA is predominantly required, so that this channel is ideally adapted to act as a multifunctional export protein to prevent their intracellular accumulation. Because of the high degree of conservation in the residues forming the transport channel among FNT family members, the flexibility in conducting multiple molecules is most likely a general feature of these proteins.

  3. La foca extinta

    OpenAIRE

    Blanco Domínguez, M.; Borroto-Páez, R.; Mancina, C. A.

    2011-01-01

    La foca monje del Caribe fue objeto de sobrexplotación aunque son pocos los datos científicos encontrados. La mayoría son crónicas de las diferentes expediciones en las cuales se hace alusión de forma somera a la especie. Incluye una cronología de la extinción.

  4. Kunarac, Kovac, and Vukovic case (Foca)

    NARCIS (Netherlands)

    de Brouwer, A.L.M.

    2001-01-01

    The annotation discusses the prosecution of sexual violence crimes against women before the International Criminal Tribunal for the former Yugoslavia (ICTY) in the Kunarac, Kovac, and Vukovic case (Foca). It is specifically focussed on the definition of rape, the prosecution of rape as a crime again

  5. Subaru FOCAS Spectroscopic Observations of High-Redshift Supernovae

    CERN Document Server

    Morokuma, Tomoki; Lidman, Christopher; Doi, Mamoru; Yasuda, Naoki; Aldering, Greg; Amanullah, Rahman; Barbary, Kyle; Dawson, Kyle; Fadeyev, Vitaliy; Fakhouri, Hannah K; Goldhaber, Gerson; Goobar, Ariel; Hattori, Takashi; Hayano, Junji; Hook, Isobel M; Howell, D Andrew; Furusawa, Hisanori; Ihara, Yutaka; Kashikawa, Nobunari; Knop, Rob A; Konishi, Kohki; Meyers, Joshua; Oda, Takeshi; Pain, Reynald; Perlmutter, Saul; Rubin, David; Spadafora, Anthony L; Suzuki, Nao; Takanashi, Naohiro; Totani, Tomonori; Utsunomiya, Hiroyuki; Wang, Lifan

    2009-01-01

    We present spectra of high-redshift supernovae (SNe) that were taken with the Subaru low resolution optical spectrograph, FOCAS. These SNe were found in SN surveys with Suprime-Cam on Subaru, the CFH12k camera on the Canada-France-Hawaii Telescope (CFHT), and the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST). These SN surveys specifically targeted z>1 Type Ia supernovae (SNe Ia). From the spectra of 39 candidates, we obtain redshifts for 32 candidates and spectroscopically identify 7 active candidates as probable SNe Ia, including one at z=1.35, which is the most distant SN Ia to be spectroscopically confirmed with a ground-based telescope. An additional 4 candidates are identified as likely SNe Ia from the spectrophotometric properties of their host galaxies. Seven candidates are not SNe Ia, either being SNe of another type or active galactic nuclei. When SNe Ia are observed within a week of maximum light, we find that we can spectroscopically identify most of them up to z=1.1. Beyond...

  6. Data of evolutionary structure change: 1ELTA-2FOCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ELTA-2FOCA 1ELT 2FOC A A VVGGRVAQPNSWPWQISLQYKSGSSYYHTCGGSLIRQGW...VGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPY... EEEEEEEEEEEE EEEEEEGG HHHHHHHHH 0 1ELT... A 1ELTA

  7. Development of the Free-space Optical Communications Analysis Software (FOCAS)

    Science.gov (United States)

    Jeganathan, M.; Mecherle, G.; Lesh, J.

    1998-01-01

    The Free-space Optical Communications Analysis Software (FOCAS) was developed at the Jet Propulsion Laboratory (JPL) to provide mission planners, systems engineers and communications engineers with an easy to use tool to analyze optical communications link.

  8. Classification of All Single Travelling Wave Solutions to Calogero-Degasperis-Focas Equation

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Under the travelling wave transformation, Calogero-Degasperis-Focas equation is reduced to an ordinary differential equation. Using a symmetry group of one parameter, this ODE is reduced to a second-order linear inho-mogeneous ODE. Furthermore, we apply the change of the variable and complete discrimination system for polynomial to solve the corresponding integrals and obtained the classification of all single travelling wave solutions to Calogero-Degasperis-Focas equation.

  9. Focal length estimation guided with object distribution on FocaLens dataset

    Science.gov (United States)

    Yan, Han; Zhang, Yu; Zhang, Shunli; Zhao, Sicong; Zhang, Li

    2017-05-01

    The focal length information of an image is indispensable for many computer vision tasks. In general, focal length can be obtained via camera calibration using specific planner patterns. However, for images taken by an unknown device, focal length can only be estimated based on the image itself. Currently, most of the single-image focal length estimation methods make use of predefined geometric cues (such as vanishing points or parallel lines) to infer focal length, which constrains their applications mainly on manmade scenes. The machine learning algorithms have demonstrated great performance in many computer vision tasks, but these methods are seldom used in the focal length estimation task, partially due to the shortage of labeled images for training the model. To bridge this gap, we first introduce a large-scale dataset FocaLens, which is especially designed for single-image focal length estimation. Taking advantage of the FocaLens dataset, we also propose a new focal length estimation model, which exploits the multiscale detection architecture to encode object distributions in images to assist focal length estimation. Additionally, an online focal transformation approach is proposed to further promote the model's generalization ability. Experimental results demonstrate that the proposed model trained on FocaLens can not only achieve state-of-the-art results on the scenes with distinct geometric cues but also obtain comparable results on the scenes even without distinct geometric cues.

  10. FoCa: a modular treatment planning system for proton radiotherapy with research and educational purposes.

    Science.gov (United States)

    Sánchez-Parcerisa, D; Kondrla, M; Shaindlin, A; Carabe, A

    2014-12-07

    FoCa is an in-house modular treatment planning system, developed entirely in MATLAB, which includes forward dose calculation of proton radiotherapy plans in both active and passive modalities as well as a generic optimization suite for inverse treatment planning. The software has a dual education and research purpose. From the educational point of view, it can be an invaluable teaching tool for educating medical physicists, showing the insights of a treatment planning system from a well-known and widely accessible software platform. From the research point of view, its current and potential uses range from the fast calculation of any physical, radiobiological or clinical quantity in a patient CT geometry, to the development of new treatment modalities not yet available in commercial treatment planning systems. The physical models in FoCa were compared with the commissioning data from our institution and show an excellent agreement in depth dose distributions and longitudinal and transversal fluence profiles for both passive scattering and active scanning modalities. 3D dose distributions in phantom and patient geometries were compared with a commercial treatment planning system, yielding a gamma-index pass rate of above 94% (using FoCa's most accurate algorithm) for all cases considered. Finally, the inverse treatment planning suite was used to produce the first prototype of intensity-modulated, passive-scattered proton therapy, using 13 passive scattering proton fields and multi-leaf modulation to produce a concave dose distribution on a cylindrical solid water phantom without any field-specific compensator.

  11. Development of a slicer integral field unit for the existing optical spectrograph FOCAS: progress

    Science.gov (United States)

    Ozaki, Shinobu; Tanaka, Yoko; Hattori, Takashi; Mitsui, Kenji; Fukushima, Mitsuhiro; Okada, Norio; Obuchi, Yoshiyuki; Tsuzuki, Toshihiro; Miyazaki, Satoshi; Yamashita, Takuya

    2014-07-01

    We are developing an integral field unit (IFU) with an image slicer for the existing optical spectrograph, Faint Object Camera And Spectrograph (FOCAS), on the Subaru Telescope. The slice width is 0.43 arcsec, the slice number is 23, and the field of view is 13.5 × 9.89 arcsec2. Sky spectrum separated by about 5.7 arcmin from an object field can be simultaneously obtained, which allows us precise background subtraction. Slice mirrors, pupil mirrors and slit mirrors are all glass, and their mirror surfaces are fabricated by polishing. Our IFU is about 200 mm × 300 mm × 80 mm in size and 1 kg in weight. It is installed into a mask storage in FOCAS along with one or two mask plates, and inserted into the optical path by using the existing mask exchange mechanism. This concept allow us flexible operation such as Targets of Opportunity observations. High reflectivity of multilayer dielectric coatings offers high throughput (>80%) of the IFU. In this paper, we will report a final optical layout, its performances, and results of prototyping works.

  12. D-serine transporter in Staphylococcus saprophyticus identified.

    Science.gov (United States)

    Marlinghaus, Lennart; Huß, Melanie; Korte-Berwanger, Miriam; Sakinc-Güler, Türkan; Gatermann, Sören G

    2016-07-01

    Among staphylococci Staphylococcus saprophyticus is the only species that is typically uropathogenic and an important cause of urinary tract infections in young women. The amino acid D-serine occurs in relatively high concentrations in human urine and has a bacteriostatic or toxic effect on many bacteria. In uropathogenic Escherichia coli and S. saprophyticus, the amino acid regulates the expression of virulence factors and can be used as a nutrient. The ability of uropathogens to respond to or to metabolize D-serine has been suggested as a factor that enables colonization of the urinary tract. Until now nothing is known about D-serine transport in S. saprophyticus We generated mutants of putative transporter genes in S. saprophyticus 7108 that show homology to the D-serine transporter cycA of E. coli and tested them in a D-serine depletion assay to analyze the D-serine uptake rate of the cells. The mutant of SPP1070 showed a strong decrease in D-serine uptake. Therefore, SSP1070 was identified as a major D-serine transporter in S. saprophyticus 7108 and was named D-serine transporter A (DstA). D-serine caused a prolonged lag phase of S. saprophyticus in a chemically defined medium. This negative effect was dependent on the presence of DstA.

  13. IDDTL: A Novel Identified Internet Data Transport Layer Mechanism

    Directory of Open Access Journals (Sweden)

    Yangyang Gao

    2014-01-01

    Full Text Available This paper proposes an identified data transport layer (IDDTL mechanism, which is implemented based on our present concepts of connection identifier (CID and CID additional information (CID-info. Since the fast evolved Internet scale and largely emerging various applications, especially with the new Internet architectures developed such as information centric network (ICN, the traditional end-to-end transport model has been exposed many defects in sorts of aspects, such as network management, flexibility and security. The novelty of the mechanism consists of two points: 1 it always conceals part of the communication information during the specific data transport process; 2 it splits the whole end-to-end communication process into two segments and forms a three-party and two-segment communication process model. Performance analysis shows that the mechanism could easily mitigate the problems such as distributed denial of service (D/DOS attacks and greatly improve the network management, flexibility and mobility. Furthermore, our simulation and test results demonstrate that IDDTL can be implemented with unique identifiers within an acceptable extra time cost of about 3.6 useconds compared with the traditional end-to-end model.

  14. Private Transport Access Among Older People: Identifying The Disadvantaged

    OpenAIRE

    Nerina Vecchio

    2003-01-01

    Private transport is important in enabling older people living in the community to maintain their independence and social networks. Access to this resource remains a major concern for older people. This study examines the demographic risk factors that restrict older people's access to private transport. The findings lead to policy recommendations directed towards self-reliance. Analysis, based on the study's household survey consisting of a sample of noninstitutionalised older Gold Coast peop...

  15. Un Tremissis bizantino de Focas, de la ceca de Cartagena, en la colección de la Real Academia de la Historia

    Directory of Open Access Journals (Sweden)

    Canto García, Alberto

    2005-12-01

    Full Text Available This paper deals with a very rare tremissis of the Byzantine emperor Phocas (Vllth., from the Spanish mint of Cartagena, in the Collection of the Real Academia de la Historia in Madrid since the XVIII century.Se presenta un raro tremissis bizantino de la ceca de Cartagena, de Focas, perteneciente a la colección de la Real Academia de la Historia, de la que forma parte desde el siglo XVIII.

  16. A kinome wide screen identifies novel kinases involved in regulation of monoamine transporter function

    DEFF Research Database (Denmark)

    Vuorenpää, Anne Elina; Ammendrup-Johnsen, Ina; Jorgensen, Trine N.

    2016-01-01

    cells (CAD) and rat chromocytoma (PC12) cells. Whereas SIK3 likely transcriptionally regulated expression of the three transfected transporters, depletion of PKA C-α was shown to decrease SERT function. Depletion of PrKX caused decreased surface expression and function of DAT without changing protein...... levels, suggesting that PrKX stabilizes the transporter at the cell surface. Summarized, our data provide novel insight into kinome regulation of the monoamine transporters and identifies PrKX as a yet unappreciated possible regulator of monoamine transporter function....... in regulation of monoamine transporter function and surface expression. A primary screen in HEK 293 cells stably expressing DAT or SERT with siRNAs against 573 human kinases revealed 93 kinases putatively regulating transporter function. All 93 hits, which also included kinases previously implicated...

  17. Turbulent Flow and Sand Dune Dynamics: Identifying Controls on Aeolian Sediment Transport

    Science.gov (United States)

    Weaver, C. M.; Wiggs, G.

    2007-12-01

    Sediment transport models are founded on cubic power relationships between the transport rate and time averaged flow parameters. These models have achieved limited success and recent aeolian and fluvial research has focused on the modelling and measurement of sediment transport by temporally varying flow conditions. Studies have recognised turbulence as a driving force in sediment transport and have highlighted the importance of coherent flow structures in sediment transport systems. However, the exact mechanisms are still unclear. Furthermore, research in the fluvial environment has identified the significance of turbulent structures for bedform morphology and spacing. However, equivalent research in the aeolian domain is absent. This paper reports the findings of research carried out to characterise the importance of turbulent flow parameters in aeolian sediment transport and determine how turbulent energy and turbulent structures change in response to dune morphology. The relative importance of mean and turbulent wind parameters on aeolian sediment flux was examined in the Skeleton Coast, Namibia. Measurements of wind velocity (using sonic anemometers) and sand transport (using grain impact sensors) at a sampling frequency of 10 Hz were made across a flat surface and along transects on a 9 m high barchan dune. Mean wind parameters and mass sand flux were measured using cup anemometers and wedge-shaped sand traps respectively. Vertical profile data from the sonic anemometers were used to compute turbulence and turbulent stress (Reynolds stress; instantaneous horizontal and vertical fluctuations; coherent flow structures) and their relationship with respect to sand transport and evolving dune morphology. On the flat surface time-averaged parameters generally fail to characterise sand transport dynamics, particularly as the averaging interval is reduced. However, horizontal wind speed correlates well with sand transport even with short averaging times. Quadrant

  18. A new transport mechanism of biomass burning from Indochina as identified by modeling studies

    Directory of Open Access Journals (Sweden)

    C.-Y. Lin

    2009-10-01

    Full Text Available Biomass burning in the Indochina Peninsula (Indochina is one of the important ozone sources in the low troposphere over East Asia in springtime. Moderate Resolution Imaging Spectroradiometer (MODIS data show that 20 000 or more active fire detections occurred annually in spring only from 2000 to 2007. In our tracer modeling study, we identify a new mechanism transporting the tracer over Indochina that is significantly different from the vertical transport mechanism over the equatorial areas such as Indonesia and Malaysia. Simulation results demonstrate that the leeside troughs over Indochina play a dominant role in the uplift of the tracer below 3 km, and that the strong westerlies prevailing above 3 km transport the tracer. These fundamental mechanisms have a major impact on the air quality downwind from Indochina over East Asia. The climatological importance of such a leeside trough is also discussed.

  19. FRIGA, A New Approach To Identify Isotopes and Hypernuclei In N-Body Transport Models

    CERN Document Server

    Fèvre, A Le; Aichelin, J; Hartnack, Ch; Kireyev, V; Bratkovskaya, E

    2015-01-01

    We present a new algorithm to identify fragments in computer simulations of relativistic heavy ion collisions. It is based on the simulated annealing technique and can be applied to n-body transport models like the Quantum Molecular Dynamics. This new approach is able to predict isotope yields as well as hyper-nucleus production. In order to illustrate its predicting power, we confront this new method to experimental data, and show the sensitivity on the parameters which govern the cluster formation.

  20. Towards smart grids: Identifying the risks that arise from the integration of energy and transport supply chains

    NARCIS (Netherlands)

    Eising, J.W.; van Ona, T.; Alkemade, F.

    2014-01-01

    This paper identifies the risks for the functionality and reliability of the grid that arise from the integration of the transport and supply chain. The electrification of transport is a promising option for the transition to a low carbon energy and transport system. But on the short term, the

  1. Towards smart grids: Identifying the risks that arise from the integration of energy and transport supply chains

    NARCIS (Netherlands)

    Eising, J.W.; van Ona, T.; Alkemade, F.

    2014-01-01

    This paper identifies the risks for the functionality and reliability of the grid that arise from the integration of the transport and supply chain. The electrification of transport is a promising option for the transition to a low carbon energy and transport system. But on the short term, the elect

  2. Identifying the Critical Links in Road Transportation Networks: Centrality-based approach utilizing structural properties

    Energy Technology Data Exchange (ETDEWEB)

    Chinthavali, Supriya [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2016-04-01

    Surface transportation road networks share structural properties similar to other complex networks (e.g., social networks, information networks, biological networks, and so on). This research investigates the structural properties of road networks for any possible correlation with the traffic characteristics such as link flows those determined independently. Additionally, we define a criticality index for the links of the road network that identifies the relative importance in the network. We tested our hypotheses with two sample road networks. Results show that, correlation exists between the link flows and centrality measures of a link of the road (dual graph approach is followed) and the criticality index is found to be effective for one test network to identify the vulnerable nodes.

  3. Use of Giardia, which appears to have a single nucleotide-sugar transporter for UDP-GlcNAc, to identify the UDP-Glc transporter of Entamoeba.

    Science.gov (United States)

    Banerjee, Sulagna; Cui, Jike; Robbins, Phillips W; Samuelson, John

    2008-05-01

    Nucleotide-sugar transporters (NSTs) transport activated sugars (e.g. UDP-GlcNAc) from the cytosol to the lumen of the endoplasmic reticulum or Golgi apparatus where they are used to make glycoproteins and glycolipids. UDP-Glc is an important component of the N-glycan-dependent quality control (QC) system for protein folding. Because Entamoeba has this QC system while Giardia does not, we hypothesized that transfected Giardia might be used to identify the UDP-Glc transporter of Entamoeba. Here we show Giardia membranes transport UDP-GlcNAc and have apyrases, which hydrolyze nucleoside-diphosphates to make the antiporter nucleoside-monophosphate. The only NST of Giardia (GlNst), which we could identify, transports UDP-GlcNAc in transfected Saccharomyces and is present in perinuclear and peripheral vesicles and increases in expression during encystation. Entamoeba membranes transport three nucleotide-sugars (UDP-Gal, UDP-GlcNAc, and UDP-Glc), and Entamoeba has three NSTs, one of which has been shown previously to transport UDP-Gal (EhNst1). Here we show recombinant EhNst2 transports UDP-Glc in transfected Giardia, while recombinant EhNst3 transports UDP-GlcNAc in transfected Saccharomyces. In summary, all three NSTs of Entamoeba and the single NST of Giardia have been molecularly characterized, and transfected Giardia provides a new system for testing heterologous UDP-Glc transporters.

  4. Nuclear waste transportation: case studies of identifying stakeholder risk information needs.

    Science.gov (United States)

    Drew, Christina H; Grace, Deirdre A; Silbernagel, Susan M; Hemmings, Erin S; Smith, Alan; Griffith, William C; Takaro, Timothy K; Faustman, Elaine M

    2003-03-01

    The U.S. Department of Energy (DOE) is responsible for the cleanup of our nation's nuclear legacy, involving complex decisions about how and where to dispose of nuclear waste and how to transport it to its ultimate disposal site. It is widely recognized that a broad range of stakeholders and tribes should be involved in this kind of decision. All too frequently, however, stakeholders and tribes are only invited to participate by commenting on processes and activities that are near completion; they are not included in the problem formulation stages. Moreover, it is often assumed that high levels of complexity and uncertainty prevent meaningful participation by these groups. Considering the types of information that stakeholders and tribes need to be able to participate in the full life cycle of decision making is critical for improving participation and transparency of decision making. Toward this objective, the Consortium for Risk Evaluation with Stakeholder Participation (CRESP) participated in three public processes relating to nuclear waste transportation and disposal in 1997-1998. First, CRESP organized focus groups to identify concerns about nuclear waste transportation. Second, CRESP conducted exit surveys at regional public workshops held by DOE to get input from stakeholders on intersite waste transfer issues. Third, CRESP developed visual tools to synthesize technical information and allow stakeholders and tribes with varying levels of knowledge about nuclear waste to participate in meaningful discussion. In this article we share the results of the CRESP findings, discuss common themes arising from these interactions, and comment on special considerations needed to facilitate stakeholder and tribal participation in similar decision-making processes.

  5. Airborne Quercus pollen in SW Spain: Identifying favourable conditions for atmospheric transport and potential source areas.

    Science.gov (United States)

    Maya-Manzano, José María; Fernández-Rodríguez, Santiago; Smith, Matt; Tormo-Molina, Rafael; Reynolds, Andrew M; Silva-Palacios, Inmaculada; Gonzalo-Garijo, Ángela; Sadyś, Magdalena

    2016-11-15

    The pollen grains of Quercus spp. (oak trees) are allergenic. This study investigates airborne Quercus pollen in SW Spain with the aim identifying favourable conditions for atmospheric transport and potential sources areas. Two types of Quercus distribution maps were produced. Airborne Quercus pollen concentrations were measured at three sites located in the Extremadura region (SW Spain) for 3 consecutive years. The seasonal occurrence of Quercus pollen in the air was investigated, as well as days with pollen concentrations ≥80Pm(-3). The distance that Quercus pollen can be transported in appreciable numbers was calculated using clusters of back trajectories representing the air mass movement above the source areas (oak woodlands), and by using a state-of-the-art dispersion model. The two main potential sources of Quercus airborne pollen captured in SW Spain are Q. ilex subsp. ballota and Q. suber. The minimum distances between aerobiological stations and Quercus woodlands have been estimated as: 40km (Plasencia), 66km (Don Benito), 62km (Zafra) from the context of this study. Daily mean Quercus pollen concentration can exceed 1,700Pm(-3), levels reached not less than 24 days in a single year. High Quercus pollen concentration were mostly associated with moderate wind speed events (6-10ms(-1)), whereas that a high wind speed (16-20ms(-1)) seems to be associated with low concentrations.

  6. Identifying fire plumes in the Arctic with tropospheric FTIR measurements and transport models

    Science.gov (United States)

    Viatte, C.; Strong, K.; Hannigan, J.; Nussbaumer, E.; Emmons, L. K.; Conway, S.; Paton-Walsh, C.; Hartley, J.; Benmergui, J.; Lin, J.

    2015-03-01

    We investigate Arctic tropospheric composition using ground-based Fourier transform infrared (FTIR) solar absorption spectra, recorded at the Polar Environment Atmospheric Research Laboratory (PEARL, Eureka, Nunavut, Canada, 80°05' N, 86°42' W) and at Thule (Greenland, 76°53' N, -68°74' W) from 2008 to 2012. The target species, carbon monoxide (CO), hydrogen cyanide (HCN), ethane (C2H6), acetylene (C2H2), formic acid (HCOOH), and formaldehyde (H2CO) are emitted by biomass burning and can be transported from mid-latitudes to the Arctic. By detecting simultaneous enhancements of three biomass burning tracers (HCN, CO, and C2H6), ten and eight fire events are identified at Eureka and Thule, respectively, within the 5-year FTIR time series. Analyses of Hybrid Single Particle Lagrangian Integrated Trajectory (HYSPLIT) model back-trajectories coupled with Moderate Resolution Imaging Spectroradiometer (MODIS) fire hotspot data, Stochastic Time-Inverted Lagrangian Transport (STILT) model footprints, and Ozone Monitoring Instrument (OMI) UV aerosol index maps, are used to attribute burning source regions and travel time durations of the plumes. By taking into account the effect of aging of the smoke plumes, measured FTIR enhancement ratios were corrected to obtain emission ratios and equivalent emission factors. The means of emission factors for extratropical forest estimated with the two FTIR data sets are 0.40 ± 0.21 g kg-1 for HCN, 1.24 ± 0.71 g kg-1 for C2H6, 0.34 ± 0.21 g kg-1 for C2H2, and 2.92 ± 1.30 g kg-1 for HCOOH. The emission factor for CH3OH estimated at Eureka is 3.44 ± 1.68 g kg-1. To improve our knowledge concerning the dynamical and chemical processes associated with Arctic pollution from fires, the two sets of FTIR measurements were compared to the Model for OZone And Related chemical Tracers, version 4 (MOZART-4). Seasonal cycles and day-to-day variabilities were compared to assess the ability of the model to reproduce emissions from fires and

  7. Identifying fire plumes in the Arctic with tropospheric FTIR measurements and transport models

    Directory of Open Access Journals (Sweden)

    C. Viatte

    2014-10-01

    Full Text Available We investigate Arctic tropospheric composition using ground-based Fourier Transform Infrared (FTIR solar absorption spectra, recorded at the Polar Environment Atmospheric Research Laboratory (PEARL, Eureka, Nunavut, Canada, 80°5' N, 86°42' W and at Thule (Greenland, 76°53' N, −68°74' W from 2008 to 2012. The target species: carbon monoxide (CO, hydrogen cyanide (HCN, ethane (C2H6, acetylene (C2H2, formic acid (HCOOH, and formaldehyde (H2CO are emitted by biomass burning and can be transported from mid-latitudes to the Arctic. By detecting simultaneous enhancements of three biomass burning tracers (HCN, CO, and C2H6, ten and eight fire events are identified at Eureka and Thule, respectively, within the five-year FTIR timeseries. Analyses of Hybrid Single Particle Lagrangian Integrated Trajectory Model (HYSPLIT back-trajectories coupled with Moderate Resolution Imaging Spectroradiometer (MODIS fire hot spot data, Stochastic Time-Inverted Lagrangian Transport model (STILT footprints, and Ozone Monitoring Instrument (OMI UV aerosol index maps are used to attribute burning source regions and travel time durations of the plumes. By taking into account the effect of aging of the smoke plumes, measured FTIR enhancement ratios were corrected to obtain emission ratios and equivalent emission factors. The means of emission factors for extratropical forest estimated with the two FTIR datasets are 0.39 ± 0.15 g kg−1 for HCN, 1.23 ± 0.49 g kg−1 for C2H6, 0.34 ± 0.16 g kg−1 for C2H2, 2.13 ± 0.92 g kg−1 for HCOOH, and 3.14 ± 1.28 g kg−1 for CH3OH. To improve our knowledge concerning the dynamical and chemical processes associated with Arctic pollution from fires, the two sets of FTIR measurements were compared to the Model for Ozone and Related chemical Tracers, version 4 (MOZART-4. Seasonal cycles and day-to-day variabilities were compared to assess the ability of the model to reproduce emissions from fires and their transport. Good

  8. Identifying sugarcane expressed sequences associated with nutrient transporters and peptide metal chelators

    Directory of Open Access Journals (Sweden)

    Antonio Figueira

    2001-12-01

    Full Text Available Plant nutrient uptake is an active process, requiring energy to accumulate essential elements at higher levels in plant tissues than in the soil solution, while the presence of toxic metals or excess of nutrients requires mechanisms to modulate the accumulation of ions. Genes encoding ion transporters isolated from plants and yeast were used to identify sugarcane putative homologues in the sugarcane expressed sequence tag (SUCEST database. Five cluster consensi with sequence homology to plant high-affinity phosphate transporter genes were identified. One cluster consensus allowed the prediction of a full-length protein containing 541 amino acids, with 81% amino acid identity to the Nicotiana tabacum NtPT1 gene, consisting of 12 membrane-spanning domains divided by a large hydrophilic charged region. Putative homologues to Arabidopsis thaliana micronutrient transporter genes were also detected in some of the SUCEST libraries. Iron uptake in grasses involves the release of the phytosiderophore mugeneic acid (MA which chelate Fe3+ which is then absorbed by a specific transporter. Sugarcane expressed sequence tag (EST homologous to genes coding for three enzymes of the mugeneic acid biosynthetic pathway [nicotianamine synthase; nicotianamine transferase; and putative mugeneic acid synthetase (ids3] and a putative Fe3+-phytosiderophore transporter were detected. Seven sugarcane sequence clusters were identified with strong homology to members of the ZIP gene family (ZIP1, ZIP3, ZIP4, IRT1 and ZNT1, while four clusters homologous to ZIP2 and three to ZAT were found. Homologues to members of another gene family, Nramp, which code for broad-specificity transition metal transporters were also detected with constitutive expression. Partial transcripts homologous to genes encoding gamma-glutamylcysteine synthetase, glutathione synthetase, and phytochelatin synthase (responsible for biosynthesis of the metal chelator phytochelatin and all four types of the

  9. Functional analysis of ABC transporter genes from Botrytis cinerea identifies BcatrB as a transporter of eugenol

    NARCIS (Netherlands)

    Schoonbeek, H.; Nistelrooy, van J.G.M.; Waard, de M.A.

    2003-01-01

    The role of multiple ATP-binding cassette (ABC) and major facilitator superfamily (MFS) transporter genes from the plant pathogenic fungus Botrytis cinerea in protection against natural fungitoxic compounds was studied by expression analysis and phenotyping of gene-replacement mutants. The expressio

  10. Gene profile identifies zinc transporters differentially expressed in normal human organs and human pancreatic cancer.

    Science.gov (United States)

    Yang, J; Zhang, Y; Cui, X; Yao, W; Yu, X; Cen, P; Hodges, S E; Fisher, W E; Brunicardi, F C; Chen, C; Yao, Q; Li, M

    2013-03-01

    Deregulated expression of zinc transporters was linked to several cancers. However, the detailed expression profile of all human zinc transporters in normal human organs and in human cancer, especially in pancreatic cancer is not available. The objectives of this study are to investigate the complete expression patterns of 14 ZIP and 10 ZnT transporters in a large number of normal human organs and in human pancreatic cancer tissues and cell lines. We examined the expression patterns of ZIP and ZnT transporters in 22 different human organs and tissues, 11 pairs of clinical human pancreatic cancer specimens and surrounding normal/benign tissues, as well as 10 established human pancreatic cancer cell lines plus normal human pancreatic ductal epithelium (HPDE) cells, using real time RT-PCR and immunohistochemistry. The results indicate that human zinc transporters have tissue specific expression patterns, and may play different roles in different organs or tissues. Almost all the ZIPs except for ZIP4, and most ZnTs were down-regulated in human pancreatic cancer tissues compared to the surrounding benign tissues. The expression patterns of individual ZIPs and ZnTs are similar among different pancreatic cancer lines. Those results and our previous studies suggest that ZIP4 is the only zinc transporter that is significantly up-regulated in human pancreatic cancer and might be the major zinc transporter that plays an important role in pancreatic cancer growth. ZIP4 might serve as a novel molecular target for pancreatic cancer diagnosis and therapy.

  11. Identifying Different Transportation Modes from Trajectory Data Using Tree-Based Ensemble Classifiers

    Directory of Open Access Journals (Sweden)

    Zhibin Xiao

    2017-02-01

    Full Text Available Recognition of transportation modes can be used in different applications including human behavior research, transport management and traffic control. Previous work on transportation mode recognition has often relied on using multiple sensors or matching Geographic Information System (GIS information, which is not possible in many cases. In this paper, an approach based on ensemble learning is proposed to infer hybrid transportation modes using only Global Position System (GPS data. First, in order to distinguish between different transportation modes, we used a statistical method to generate global features and extract several local features from sub-trajectories after trajectory segmentation, before these features were combined in the classification stage. Second, to obtain a better performance, we used tree-based ensemble models (Random Forest, Gradient Boosting Decision Tree, and XGBoost instead of traditional methods (K-Nearest Neighbor, Decision Tree, and Support Vector Machines to classify the different transportation modes. The experiment results on the later have shown the efficacy of our proposed approach. Among them, the XGBoost model produced the best performance with a classification accuracy of 90.77% obtained on the GEOLIFE dataset, and we used a tree-based ensemble method to ensure accurate feature selection to reduce the model complexity.

  12. Mapping the membrane proteome of anaerobic gut fungi identifies a wealth of carbohydrate binding proteins and transporters.

    Science.gov (United States)

    Seppälä, Susanna; Solomon, Kevin V; Gilmore, Sean P; Henske, John K; O'Malley, Michelle A

    2016-12-20

    Engineered cell factories that convert biomass into value-added compounds are emerging as a timely alternative to petroleum-based industries. Although often overlooked, integral membrane proteins such as solute transporters are pivotal for engineering efficient microbial chassis. Anaerobic gut fungi, adapted to degrade raw plant biomass in the intestines of herbivores, are a potential source of valuable transporters for biotechnology, yet very little is known about the membrane constituents of these non-conventional organisms. Here, we mined the transcriptome of three recently isolated strains of anaerobic fungi to identify membrane proteins responsible for sensing and transporting biomass hydrolysates within a competitive and rather extreme environment. Using sequence analyses and homology, we identified membrane protein-coding sequences from assembled transcriptomes from three strains of anaerobic gut fungi: Neocallimastix californiae, Anaeromyces robustus, and Piromyces finnis. We identified nearly 2000 transporter components: about half of these are involved in the general secretory pathway and intracellular sorting of proteins; the rest are predicted to be small-solute transporters. Unexpectedly, we found a number of putative sugar binding proteins that are associated with prokaryotic uptake systems; and approximately 100 class C G-protein coupled receptors (GPCRs) with non-canonical putative sugar binding domains. We report the first comprehensive characterization of the membrane protein machinery of biotechnologically relevant anaerobic gut fungi. Apart from identifying conserved machinery for protein sorting and secretion, we identify a large number of putative solute transporters that are of interest for biotechnological applications. Notably, our data suggests that the fungi display a plethora of carbohydrate binding domains at their surface, perhaps as a means to sense and sequester some of the sugars that their biomass degrading, extracellular enzymes

  13. Mapping the membrane proteome of anaerobic gut fungi identifies a wealth of carbohydrate binding proteins and transporters

    DEFF Research Database (Denmark)

    Seppälä, Susanna; Solomon, Kevin V; Gilmore, Sean P.;

    2016-01-01

    machinery of biotechnologically relevant anaerobic gut fungi. Apart from identifying conserved machinery for protein sorting and secretion, we identify a large number of putative solute transporters that are of interest for biotechnological applications. Notably, our data suggests that the fungi display...... a plethora of carbohydrate binding domains at their surface, perhaps as a means to sense and sequester some of the sugars that their biomass degrading, extracellular enzymes produce....

  14. Incorporating deep learning with convolutional neural networks and position specific scoring matrices for identifying electron transport proteins.

    Science.gov (United States)

    Le, Nguyen-Quoc-Khanh; Ho, Quang-Thai; Ou, Yu-Yen

    2017-09-05

    In several years, deep learning is a modern machine learning technique using in a variety of fields with state-of-the-art performance. Therefore, utilization of deep learning to enhance performance is also an important solution for current bioinformatics field. In this study, we try to use deep learning via convolutional neural networks and position specific scoring matrices to identify electron transport proteins, which is an important molecular function in transmembrane proteins. Our deep learning method can approach a precise model for identifying of electron transport proteins with achieved sensitivity of 80.3%, specificity of 94.4%, and accuracy of 92.3%, with MCC of 0.71 for independent dataset. The proposed technique can serve as a powerful tool for identifying electron transport proteins and can help biologists understand the function of the electron transport proteins. Moreover, this study provides a basis for further research that can enrich a field of applying deep learning in bioinformatics. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  15. Electronic and Quantum Transport Properties of Atomically Identified Si Point Defects in Graphene.

    Science.gov (United States)

    Lopez-Bezanilla, Alejandro; Zhou, Wu; Idrobo, Juan-Carlos

    2014-05-15

    We report high-resolution scanning transmission electron microscopy images displaying a range of inclusions of isolated silicon atoms at the edges and inner zones of graphene layers. Whereas the incorporation of Si atoms to a graphene armchair edge involves no reconstruction of the neighboring carbon atoms, the inclusion of a Si atom to a zigzag graphene edge entails the formation of five-membered carbon rings. In all the observed atomic edge terminations, a Si atom is found bridging two C atoms in a 2-fold coordinated configuration. The atomic-scale observations are underpinned by first-principles calculations of the electronic and quantum transport properties of the structural anomalies. Experimental estimations of Si-doped graphene band gaps realized by means of transport measurements may be affected by a low doping rate of 2-fold coordinated Si atoms at the graphene edges, and 4-fold coordinated at inner zones due to the apparition of mobility gaps.

  16. Spiroindolines Identify the Vesicular Acetylcholine Transporter as a Novel Target for Insecticide Action

    Science.gov (United States)

    Sluder, Ann; Shah, Sheetal; Cassayre, Jérôme; Clover, Ralph; Maienfisch, Peter; Molleyres, Louis-Pierre; Hirst, Elizabeth A.; Flemming, Anthony J.; Shi, Min; Cutler, Penny; Stanger, Carole; Roberts, Richard S.; Hughes, David J.; Flury, Thomas; Robinson, Michael P.; Hillesheim, Elke; Pitterna, Thomas; Cederbaum, Fredrik; Worthington, Paul A.; Crossthwaite, Andrew J.; Windass, John D.; Currie, Richard A.; Earley, Fergus G. P.

    2012-01-01

    The efficacy of all major insecticide classes continues to be eroded by the development of resistance mediated, in part, by selection of alleles encoding insecticide insensitive target proteins. The discovery of new insecticide classes acting at novel protein binding sites is therefore important for the continued protection of the food supply from insect predators, and of human and animal health from insect borne disease. Here we describe a novel class of insecticides (Spiroindolines) encompassing molecules that combine excellent activity against major agricultural pest species with low mammalian toxicity. We confidently assign the vesicular acetylcholine transporter as the molecular target of Spiroindolines through the combination of molecular genetics in model organisms with a pharmacological approach in insect tissues. The vesicular acetylcholine transporter can now be added to the list of validated insecticide targets in the acetylcholine signalling pathway and we anticipate that this will lead to the discovery of novel molecules useful in sustaining agriculture. In addition to their potential as insecticides and nematocides, Spiroindolines represent the only other class of chemical ligands for the vesicular acetylcholine transporter since those based on the discovery of vesamicol over 40 years ago, and as such, have potential to provide more selective tools for PET imaging in the diagnosis of neurodegenerative disease. They also provide novel biochemical tools for studies of the function of this protein family. PMID:22563457

  17. Application of Chebyshev Formalism to Identify Nonlinear Magnetic Field Components in Beam Transport Systems

    Energy Technology Data Exchange (ETDEWEB)

    Spata, Michael [Old Dominion Univ., Norfolk, VA (United States)

    2012-08-01

    An experiment was conducted at Jefferson Lab's Continuous Electron Beam Accelerator Facility to develop a beam-based technique for characterizing the extent of the nonlinearity of the magnetic fields of a beam transport system. Horizontally and vertically oriented pairs of air-core kicker magnets were simultaneously driven at two different frequencies to provide a time-dependent transverse modulation of the beam orbit relative to the unperturbed reference orbit. Fourier decomposition of the position data at eight different points along the beamline was then used to measure the amplitude of these frequencies. For a purely linear transport system one expects to find solely the frequencies that were applied to the kickers with amplitudes that depend on the phase advance of the lattice. In the presence of nonlinear fields one expects to also find harmonics of the driving frequencies that depend on the order of the nonlinearity. Chebyshev polynomials and their unique properties allow one to directly quantify the magnitude of the nonlinearity with the minimum error. A calibration standard was developed using one of the sextupole magnets in a CEBAF beamline. The technique was then applied to a pair of Arc 1 dipoles and then to the magnets in the Transport Recombiner beamline to measure their multipole content as a function of transverse position within the magnets.

  18. Hartnup disorder: polymorphisms identified in the neutral amino acid transporter SLC1A5.

    Science.gov (United States)

    Potter, S J; Lu, A; Wilcken, B; Green, K; Rasko, J E J

    2002-10-01

    Hartnup disorder is an inborn error of renal and gastrointestinal neutral amino acid transport. The cloning and functional characterization of the 'system B0' neutral amino acid transporter SLC1A5 led to it being proposed as a candidate gene for Hartnup disorder. Linkage analysis performed at 19q13.3, the chromosomal position of SLC1A5, was suggestive of an association with the Hartnup phenotype in some families. However, SLC1A5 was not linked to the Hartnup phenotype in other families. Linkage analysis also excluded an alternative candidate region at 11q13 implicated by a putative mouse model for Hartnup disorder. Sequencing of the coding region of SLC1A5 in Hartnup patients revealed two coding region polymorphisms. These mutations did not alter the predicted amino acid sequence of SLC1A5 and were considered unlikely to play a role in Hartnup disorder. There were no mutations in splice sites flanking each exon. Quantitative RT-PCR of SLC1A5 messenger RNA in affected and unaffected subjects did not support systemic differences in expression as an explanation for Hartnup disorder. In the six unrelated Hartnup pedigrees studied, examination of linkage at 19q13.3, polymorphisms in the coding sequence and quantitation of expression of SLC1A5 did not suffice to explain the defect in neutral amino acid transport.

  19. Spiroindolines identify the vesicular acetylcholine transporter as a novel target for insecticide action.

    Directory of Open Access Journals (Sweden)

    Ann Sluder

    Full Text Available The efficacy of all major insecticide classes continues to be eroded by the development of resistance mediated, in part, by selection of alleles encoding insecticide insensitive target proteins. The discovery of new insecticide classes acting at novel protein binding sites is therefore important for the continued protection of the food supply from insect predators, and of human and animal health from insect borne disease. Here we describe a novel class of insecticides (Spiroindolines encompassing molecules that combine excellent activity against major agricultural pest species with low mammalian toxicity. We confidently assign the vesicular acetylcholine transporter as the molecular target of Spiroindolines through the combination of molecular genetics in model organisms with a pharmacological approach in insect tissues. The vesicular acetylcholine transporter can now be added to the list of validated insecticide targets in the acetylcholine signalling pathway and we anticipate that this will lead to the discovery of novel molecules useful in sustaining agriculture. In addition to their potential as insecticides and nematocides, Spiroindolines represent the only other class of chemical ligands for the vesicular acetylcholine transporter since those based on the discovery of vesamicol over 40 years ago, and as such, have potential to provide more selective tools for PET imaging in the diagnosis of neurodegenerative disease. They also provide novel biochemical tools for studies of the function of this protein family.

  20. A small molecule screen identifies selective inhibitors of urea transporter UT-A.

    Science.gov (United States)

    Esteva-Font, Cristina; Phuan, Puay-Wah; Anderson, Marc O; Verkman, A S

    2013-10-24

    Urea transporter (UT) proteins, including UT-A in kidney tubule epithelia and UT-B in vasa recta microvessels, facilitate urinary concentrating function. A screen for UT-A inhibitors was developed in MDCK cells expressing UT-A1, water channel aquaporin-1, and YFP-H148Q/V163S. An inwardly directed urea gradient produces cell shrinking followed by UT-A1-dependent swelling, which was monitored by YFP-H148Q/V163S fluorescence. Screening of ~90,000 synthetic small molecules yielded four classes of UT-A1 inhibitors with low micromolar half-maximal inhibitory concentration that fully and reversibly inhibited urea transport by a noncompetitive mechanism. Structure-activity analysis of >400 analogs revealed UT-A1-selective and UT-A1/UT-B nonselective inhibitors. Docking computations based on homology models of UT-A1 suggested inhibitor binding sites. UT-A inhibitors may be useful as diuretics ("urearetics") with a mechanism of action that may be effective in fluid-retaining conditions in which conventional salt transport-blocking diuretics have limited efficacy.

  1. Tritium Suicide Selection Identifies Proteins Involved in the Uptake and Intracellular Transport of Sterols in Saccharomyces cerevisiae▿

    Science.gov (United States)

    Sullivan, David P.; Georgiev, Alexander; Menon, Anant K.

    2009-01-01

    Sterol transport between the plasma membrane (PM) and the endoplasmic reticulum (ER) occurs by a nonvesicular mechanism that is poorly understood. To identify proteins required for this process, we isolated Saccharomyces cerevisiae mutants with defects in sterol transport. We used Upc2-1 cells that have the ability to take up sterols under aerobic conditions and exploited the observation that intracellular accumulation of exogenously supplied [3H]cholesterol in the form of [3H]cholesteryl ester requires an intact PM-ER sterol transport pathway. Upc2-1 cells were mutagenized using a transposon library, incubated with [3H]cholesterol, and subjected to tritium suicide selection to isolate mutants with a decreased ability to accumulate [3H]cholesterol. Many of the mutants had defects in the expression and trafficking of Aus1 and Pdr11, PM-localized ABC transporters that are required for sterol uptake. Through characterization of one of the mutants, a new role was uncovered for the transcription factor Mot3 in controlling expression of Aus1 and Pdr11. A number of mutants had transposon insertions in the uncharacterized Ydr051c gene, which we now refer to as DET1 (decreased ergosterol transport). These mutants expressed Aus1 and Pdr11 normally but were severely defective in the ability to accumulate exogenously supplied cholesterol. The transport of newly synthesized sterols from the ER to the PM was also defective in det1Δ cells. These data indicate that the cytoplasmic protein encoded by DET1 is involved in intracellular sterol transport. PMID:19060182

  2. Identifying target groups for environmentally sustainable transport: assessment of different segmentation approaches

    DEFF Research Database (Denmark)

    Haustein, Sonja; Hunecke, Marcel

    2013-01-01

    Recently, the use of attitude-based market segmentation to promote environmentally sustainable transport has significantly increased. The segmentation of the population into meaningful groups sharing similar attitudes and preferences provides valuable information about how green measures should...... be designed and promoted in order to attract different user groups. This review highlights advances in the understanding of mode choice from a psychological perspective, taking into account behavioural theories of car use and car-use reduction. In this contribution, attitudinal, sociodemographic, geographical...... and behavioural segmentations are compared regarding marketing criteria. Although none of the different approaches can claim absolute superiority, attitudinal approaches show advantages in providing startingpoints for interventions to reduce car use....

  3. Identifying Methane Sources in Groundwater; Quantifying Changes in Compositional and Stable Isotope Values during Multiphase Transport

    Science.gov (United States)

    Larson, T.; Sathaye, K.

    2014-12-01

    A dramatic expansion of hydraulic fracturing and horizontal drilling for natural gas in unconventional reserves is underway. This expansion is fueling considerable public concern, however, that extracted natural gas, reservoir brines and associated fracking fluids may infiltrate to and contaminate shallower (development of a 'bank' of methane depleted in 13C relative to 12C at the front of a plume of fugitive natural gas. These results, therefore, suggest that transport of natural gas through water saturated geological media may complicate attribution methods needed to distinguish thermogenic and microbial methane.

  4. KLP6: a newly identified kinesin that regulates the morphology and transport of mitochondria in neuronal cells.

    Science.gov (United States)

    Tanaka, Kousuke; Sugiura, Yoshimi; Ichishita, Ryohei; Mihara, Katsuyoshi; Oka, Toshihiko

    2011-07-15

    Mitochondria utilize diverse cytoskeleton-based mechanisms to control their functions and morphology. Here, we report a role for kinesin-like protein KLP6, a newly identified member of the kinesin family, in mitochondrial morphology and dynamics. An RNA interference screen using Caenorhabditis elegans led us to identify a C. elegans KLP-6 involved in maintaining mitochondrial morphology. We cloned a cDNA coding for a rat homolog of C. elegans KLP-6, which is an uncharacterized kinesin in vertebrates. A rat KLP6 mutant protein lacking the motor domain induced changes in mitochondrial morphology and significantly decreased mitochondrial motility in HeLa cells, but did not affect the morphology of other organelles. In addition, the KLP6 mutant inhibited transport of mitochondria during anterograde movement in differentiated neuro 2a cells. To date, two kinesins, KIF1Bα and kinesin heavy chain (KHC; also known as KIF5) have been shown to be involved in the distribution of mitochondria in neurons. Expression of the kinesin heavy chain/KIF5 mutant prevented mitochondria from entering into neurites, whereas both the KLP6 and KIF1Bα mutants decreased mitochondrial transport in axonal neurites. Furthermore, both KLP6 and KIF1Bα bind to KBP, a KIF1-binding protein required for axonal outgrowth and mitochondrial distribution. Thus, KLP6 is a newly identified kinesin family member that regulates mitochondrial morphology and transport.

  5. Transport of NOx in East Asia identified by satellite and in situ measurements and Lagrangian particle dispersion model simulations

    Science.gov (United States)

    Lee, H.-J.; Kim, S.-W.; Brioude, J.; Cooper, O. R.; Frost, G. J.; Kim, C.-H.; Park, R. J.; Trainer, M.; Woo, J.-H.

    2014-03-01

    Nitrogen dioxide (NO2) columns observed from space have been useful in detecting the increase of nitrogen oxides (NOx) emissions in East Asia, particularly China, coinciding with rapid economic growth during the past several decades. NO2 columns retrieved above a particular location reflect a combination of local NOx emissions and transported NOx from upwind sources. In this study, we demonstrate the transport of NOx emitted in East Asia using satellite and surface in situ measurements and Lagrangian particle dispersion model simulations. Enhanced satellite NO2 columns in the Yellow Sea (between China and South Korea) and the East Sea (between South Korea and Japan), and different seasonal variations of NO2 in China, North and South Korea, and Japan, suggest the importance of NOx transport in understanding the local NOx budget. Lagrangian transport model simulations with tracers of different chemical lifetimes identify source-receptor relationships that explain high NO2 over the oceans and springtime peaks in Korea and Japan, with China being the most likely source region. Our results have important implications for studies using satellite NO2 retrievals to derive NOx emissions at local scales in regions adjacent to large sources, such as in East Asia, Europe, and the Eastern U.S.

  6. Desvenlafaxine succinate identifies novel antagonist binding determinants in the human norepinephrine transporter.

    Science.gov (United States)

    Mason, John N; Deecher, Darlene C; Richmond, Rhonda L; Stack, Gary; Mahaney, Paige E; Trybulski, Eugene; Winneker, Richard C; Blakely, Randy D

    2007-11-01

    Desvenlafaxine succinate (DVS) is a recently introduced antagonist of the human norepinephrine and serotonin transporters (hNET and hSERT, respectively), currently in clinical development for use in the treatment of major depressive disorder and vasomotor symptoms associated with menopause. Initial evaluation of the pharmacological properties of DVS (J Pharmacol Exp Ther 318:657-665, 2006) revealed significantly reduced potency for the hNET expressed in membranes compared with whole cells when competing for [(3)H]nisoxetine (NIS) binding. Using hNET in transfected human embryonic kidney-293 cells, this difference in potency for DVS at sites labeled by [(3)H]NIS was found to distinguish DVS, the DVS analog rac-(1-[1-(3-chloro-phenyl)-2-(4-methylpiperazin-1-yl)-ethyl]cyclohexanol (WY-46824), methylphenidate, and the cocaine analog 3beta-(4-iodophenyl)tropane-2beta-carboxylic acid methyl ester (RTI-55) from other hNET antagonists, such as NIS, mazindol, tricyclic antidepressants, and cocaine. These differences seem not to arise from preparation-specific perturbations of ligand intrinsic affinity or antagonist-specific surface trafficking but rather from protein conformational alterations that perturb the relationships between distinct hNET binding sites. In an initial search for molecular features that differentially define antagonist binding determinants, we document that Val148 in hNET transmembrane domain 3 selectively disrupts NIS binding but not that of DVS.

  7. Transcriptome Analysis to Identify the Putative Biosynthesis and Transport Genes Associated with the Medicinal Components of Achyranthes bidentata Bl.

    Directory of Open Access Journals (Sweden)

    Jinting Li

    2016-12-01

    Full Text Available Achyranthes bidentata is a popular perennial medicine herb used for thousands of years in China to treat various diseases. Although this herb has multiple pharmaceutical purposes in China, no transcriptomic information has been reported for this species. In addition, the understanding of several key pathways and enzymes involved in the biosynthesis of oleanolic acid and ecdysterone, two pharmacologically active classes of metabolites and major chemical constituents of A. bidentata root extracts, is limited. The aim of the present study was to characterize the transcriptome profile of the roots and leaves of A. bidentata to uncover the biosynthetic and transport mechanisms of the active components. In this study, we identified 100,987 transcripts, with an average length of 973.64 base pairs. A total of 31,634 (31.33% unigenes were annotated, and 12,762 unigenes were mapped to 303 pathways according to the Kyoto Encyclopedia of Genes and Genomes (KEGG pathway database. Moreover, we identified a total of 260 oleanolic acid and ecdysterone genes encoding biosynthetic enzymes. Furthermore, the key enzymes involved in the oleanolic acid and ecdysterone synthesis pathways were analyzed using quantitative real-time polymerase chain reaction (qRT-PCR, revealing that the roots expressed these enzymes to a greater extent than the leaves. In addition, we identified 85 ATP-binding cassette (ABC transporters, some of which might be involved in the translocation of secondary metabolites.

  8. Multicomponent statistical analysis to identify flow and transport processes in a highly-complex environment

    Science.gov (United States)

    Moeck, Christian; Radny, Dirk; Borer, Paul; Rothardt, Judith; Auckenthaler, Adrian; Berg, Michael; Schirmer, Mario

    2016-11-01

    A combined approach of multivariate statistical analysis, namely factor analysis (FA) and hierarchical cluster analysis (HCA), interpretation of geochemical processes, stable water isotope data and organic micropollutants enabling to assess spatial patterns of water types was performed for a study area in Switzerland, where drinking water production is close to different potential input pathways for contamination. To avoid drinking water contamination, artificial groundwater recharge with surface water into an aquifer is used to create a hydraulic barrier between potential intake pathways for contamination and drinking water extraction wells. Inter-aquifer mixing in the subsurface is identified, where a high amount of artificial infiltrated surface water is mixed with a lesser amount of water originating from the regional flow pathway in the vicinity of drinking water extraction wells. The spatial distribution of different water types can be estimated and a conceptual system understanding is developed. Results of the multivariate statistical analysis are comparable with gained information from isotopic data and organic micropollutants analyses. The integrated approach using different kinds of observations can be easily transferred to a variety of hydrological settings to synthesise and evaluate large hydrochemical datasets. The combination of additional data with different information content is conceivable and enabled effective interpretation of hydrological processes. Using the applied approach leads to more sound conceptual system understanding acting as the very basis to develop improved water resources management practices in a sustainable way.

  9. Yeast-based High-Throughput Screen Identifies Plasmodium falciparum Equilibrative Nucleoside Transporter 1 Inhibitors That Kill Malaria Parasites

    Science.gov (United States)

    Frame, I. J.; Deniskin, Roman; Rinderspacher, Alison; Katz, Francine; Deng, Shi-Xian; Moir, Robyn D.; Adjalley, Sophie H.; Coburn-Flynn, Olivia; Fidock, David A.; Willis, Ian M.; Landry, Donald W.; Akabas, Myles H.

    2015-01-01

    Equilibrative transporters are potential drug targets, however most functional assays involve radioactive substrate uptake that is unsuitable for high-throughput screens (HTS). We developed a robust yeast-based growth assay that is potentially applicable to many equilibrative transporters. As proof of principle, we applied our approach to Equilibrative Nucleoside Transporter 1 of the malarial parasite Plasmodium falciparum (PfENT1). PfENT1 inhibitors might serve as novel antimalarial drugs since PfENT1-mediated purine import is essential for parasite proliferation. To identify PfENT1 inhibitors, we screened 64,560 compounds and identified 171 by their ability to rescue the growth of PfENT1-expressing fui1Δ yeast in the presence of a cytotoxic PfENT1 substrate, 5-fluorouridine (5-FUrd). In secondary assays, nine of the highest activity compounds inhibited PfENT1-dependent growth of a purine auxotrophic yeast strain with adenosine as the sole purine source (IC50 0.2–2 µM). These nine compounds completely blocked [3H]adenosine uptake into PfENT1-expressing yeast and erythrocyte-free trophozoite-stage parasites (IC50 5–50 nM), and inhibited chloroquine-sensitive and -resistant parasite proliferation (IC50 5–50 µM). Wild-type (WT) parasite IC50 values were up to four-fold lower compared to PfENT1-knockout (pfent1Δ) parasites. pfent1Δ parasite killing showed a delayed-death phenotype not observed with WT. We infer that in parasites, the compounds inhibit both PfENT1 and a secondary target with similar efficacy. The secondary target identity is unknown, but its existence may reduce the likelihood of parasites developing resistance to PfENT1 inhibitors. Our data support the hypothesis that blocking purine transport through PfENT1 may be a novel and compelling approach for antimalarial drug development. PMID:25602169

  10. shRNA library screening identifies nucleocytoplasmic transport as a mediator of BCR-ABL1 kinase-independent resistance.

    Science.gov (United States)

    Khorashad, Jamshid S; Eiring, Anna M; Mason, Clinton C; Gantz, Kevin C; Bowler, Amber D; Redwine, Hannah M; Yu, Fan; Kraft, Ira L; Pomicter, Anthony D; Reynolds, Kimberly R; Iovino, Anthony J; Zabriskie, Matthew S; Heaton, William L; Tantravahi, Srinivas K; Kauffman, Michael; Shacham, Sharon; Chenchik, Alex; Bonneau, Kyle; Ullman, Katharine S; O'Hare, Thomas; Deininger, Michael W

    2015-03-12

    The mechanisms underlying tyrosine kinase inhibitor (TKI) resistance in chronic myeloid leukemia (CML) patients lacking explanatory BCR-ABL1 kinase domain mutations are incompletely understood. To identify mechanisms of TKI resistance that are independent of BCR-ABL1 kinase activity, we introduced a lentiviral short hairpin RNA (shRNA) library targeting ∼5000 cell signaling genes into K562(R), a CML cell line with BCR-ABL1 kinase-independent TKI resistance expressing exclusively native BCR-ABL1. A customized algorithm identified genes whose shRNA-mediated knockdown markedly impaired growth of K562(R) cells compared with TKI-sensitive controls. Among the top candidates were 2 components of the nucleocytoplasmic transport complex, RAN and XPO1 (CRM1). shRNA-mediated RAN inhibition or treatment of cells with the XPO1 inhibitor, KPT-330 (Selinexor), increased the imatinib sensitivity of CML cell lines with kinase-independent TKI resistance. Inhibition of either RAN or XPO1 impaired colony formation of CD34(+) cells from newly diagnosed and TKI-resistant CML patients in the presence of imatinib, without effects on CD34(+) cells from normal cord blood or from a patient harboring the BCR-ABL1(T315I) mutant. These data implicate RAN in BCR-ABL1 kinase-independent imatinib resistance and show that shRNA library screens are useful to identify alternative pathways critical to drug resistance in CML.

  11. Summary report on transportation of nuclear fuel materials in Japan : transportation infrastructure, threats identified in open literature, and physical protection regulations.

    Energy Technology Data Exchange (ETDEWEB)

    Cochran, John Russell; Ouchi, Yuichiro (Japan Atomic Energy Agency, Japan); Furaus, James Phillip; Marincel, Michelle K.

    2008-03-01

    This report summarizes the results of three detailed studies of the physical protection systems for the protection of nuclear materials transport in Japan, with an emphasis on the transportation of mixed oxide fuel materials1. The Japanese infrastructure for transporting nuclear fuel materials is addressed in the first section. The second section of this report presents a summary of baseline data from the open literature on the threats of sabotage and theft during the transport of nuclear fuel materials in Japan. The third section summarizes a review of current International Atomic Energy Agency, Japanese and United States guidelines and regulations concerning the physical protection for the transportation of nuclear fuel materials.

  12. Long-range transport of giant particles in Asian dust identified by physical, mineralogical, and meteorological analysis

    Directory of Open Access Journals (Sweden)

    G. Y. Jeong

    2013-08-01

    Full Text Available Giant particles transported over long distances are generally of limited concern in atmospheric studies due to their low number concentrations in mineral dust and possible local origin. However, they can play an important role in regional circulation of earth materials due to their enormous volume concentration. Asian dust laden with giant particles was observed in Korea on 31 March 2012, after a migration of about 2000 km across the Yellow Sea from the Gobi Desert. Scanning electron microscopy (SEM revealed that 20% of the particles exceeded 10 μm in equivalent sphere diameter, with a maximum of 60 μm. The median diameter from the number distribution was 5.7 μm, which was larger than the diameters recorded of 2.5 and 2.9 μm in Asian dust storms in 2010 and 2011, respectively, and was consistent with independent optical particle counter data. Giant particles (> 10 μm contributed about 89% of the volume of the dust in the 2012 storm. Illite-smectite series clay minerals were the major mineral group followed by quartz, plagioclase, K-feldspar, and calcite. The total phyllosilicate content was ~ 52%. The direct long-range transport of giant particles was confirmed by calcite nanofibers closely associated with clays in a submicron scale identified by high-resolution SEM and transmission electron microscopy. Since giant particles consisted of clay agglomerates and clay-coated quartz, feldspars, and micas, the mineral composition varied little throughout the fine ( 20 μm size bins. Analysis of the synoptic conditions of the 2012 dust event and its migration indicated that the mid-tropospheric strong wind belt directly stretching to Korea induced rapid transport of the dust, delivering giant particles. Giant dust particles with high settling velocity would be the major input into the terrestrial and marine sedimentary and ecological systems of East Asia and the western Pacific. Analysis of ancient aeolian deposits in Korea suggested the common

  13. Using background air pollutants levels correlation analysis to identify periods of long-range transport of anthropogenic pollution

    Science.gov (United States)

    Konkova, Elizaveta S.; Burtseva, Larisa V.; Gromov, Sergey A.; Gromov, Sergey S.

    2017-04-01

    Increasing trends of airborne lead and cadmium at background station within the central region of European Russia have been identified previously (e.g., Gromov & Konkova, 2016). In order to reveal the possible drivers of these trends, a deeper investigation of correlation among these heavy metals (HM) and other co-measured pollutants is done in this study. Based on the data for the 2001-2012 period, calculations have been carried out for the period from 2006 onwards, when the growth of HM concentrations is observed. Pairwise correlations of individual species abundances were derived for the entire time series and subsets for each calendar year, including warm (April to September) and cold seasons (October to March). The calculated values for the seasons and the whole years vary substantially, suggesting that that variable ratios of atmospheric HM emission sources could affect the final air concentrations at measurement site in these periods. To distinguish the events of predominant influence of natural and anthropogenic sources, we assume that correlation between lead and cadmium levels must be greater in the case of natural sources being in effect. High values of the correlation coefficient are expected in cases when HM air abundances are induced by the long-range transport from the regions of anthropogenic sources (co-emission of these metals results from a number of same sources, and both of them are also present on same matrix aerosols). The results demonstrate a substantial correlation between Pb and Cd, with higher values for individual seasons (70% of 0.5 and higher) than for whole years. Higher mass concentrations of airborne dust (TSP) in remote areas are to large extent promoted by large particles blown away from the surface at local surroundings. Captured better by filters, such events could be a particular indicator of local (mostly natural) sources. Low or insignificant correlation with HM indicates prevalence of long-range transport of them and could

  14. Fundamental Research in Engineering Education. Identifying and Repairing Student Misconceptions in Thermal and Transport Science: Concept Inventories and Schema Training Studies

    Science.gov (United States)

    Miller, Ronald L.; Streveler, Ruth A.; Yang, Dazhi; Roman, Aidsa I. Santiago

    2011-01-01

    This paper summarizes progress on two related lines of chemical engineering education research: 1) identifying persistent student misconceptions in thermal and transport science (fluid mechanics, heat transfer, and thermodynamics); and, 2) developing a method to help students repair these misconceptions. Progress on developing the Thermal and…

  15. Fundamental Research in Engineering Education. Identifying and Repairing Student Misconceptions in Thermal and Transport Science: Concept Inventories and Schema Training Studies

    Science.gov (United States)

    Miller, Ronald L.; Streveler, Ruth A.; Yang, Dazhi; Roman, Aidsa I. Santiago

    2011-01-01

    This paper summarizes progress on two related lines of chemical engineering education research: 1) identifying persistent student misconceptions in thermal and transport science (fluid mechanics, heat transfer, and thermodynamics); and, 2) developing a method to help students repair these misconceptions. Progress on developing the Thermal and…

  16. A Drosophila model to identify polyamine-drug conjugates that target the polyamine transporter in an intact epithelium.

    Science.gov (United States)

    Tsen, Chung; Iltis, Mark; Kaur, Navneet; Bayer, Cynthia; Delcros, Jean-Guy; von Kalm, Laurence; Phanstiel, Otto

    2008-01-24

    Polyamine transport is elevated in many tumor types, suggesting that toxic polyamine-drug conjugates could be targeted to cancer cells via the polyamine transporter (PAT). We have previously reported the use of Chinese hamster ovary (CHO) cells and its PAT-deficient mutant cell line, CHO-MG, to screen anthracene-polyamine conjugates for their PAT-selective targeting ability. We report here a novel Drosophila-based model for screening anthracene-polyamine conjugates in a developing and intact epithelium ( Drosophila imaginal discs), wherein cell-cell adhesion properties are maintained. Data from the Drosophila assay are consistent with previous results in CHO cells, indicating that the Drosophila epithelium has a PAT with vertebrate-like characteristics. This assay will be of use to medicinal chemists interested in screening drugs that use PAT for cellular entry, and it offers the possibility of genetic dissection of the polyamine transport process, including identification of a Drosophila PAT.

  17. Structure-Function Relationship of a Plant NCS1 Member – Homology Modeling and Mutagenesis Identified Residues Critical for Substrate Specificity of PLUTO, a Nucleobase Transporter from Arabidopsis

    Science.gov (United States)

    Witz, Sandra; Panwar, Pankaj; Schober, Markus; Deppe, Johannes; Pasha, Farhan Ahmad; Lemieux, M. Joanne; Möhlmann, Torsten

    2014-01-01

    Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members. PMID:24621654

  18. Structure-function relationship of a plant NCS1 member--homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from Arabidopsis.

    Science.gov (United States)

    Witz, Sandra; Panwar, Pankaj; Schober, Markus; Deppe, Johannes; Pasha, Farhan Ahmad; Lemieux, M Joanne; Möhlmann, Torsten

    2014-01-01

    Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members.

  19. Structure-function relationship of a plant NCS1 member--homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Sandra Witz

    Full Text Available Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members.

  20. Structure-function relationship of a plant NCS1 member - Homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from arabidopsis

    KAUST Repository

    Witz, Sandra

    2014-03-12

    Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members. 2014 Witz et al.

  1. The Malaria Parasite's Lactate Transporter PfFNT Is the Target of Antiplasmodial Compounds Identified in Whole Cell Phenotypic Screens

    Science.gov (United States)

    Hapuarachchi, Sanduni V.; McConville, Malcolm J.; Martin, Rowena E.; Lehane, Adele M.

    2017-01-01

    In this study the ‘Malaria Box’ chemical library comprising 400 compounds with antiplasmodial activity was screened for compounds that perturb the internal pH of the malaria parasite, Plasmodium falciparum. Fifteen compounds induced an acidification of the parasite cytosol. Two of these did so by inhibiting the parasite’s formate nitrite transporter (PfFNT), which mediates the H+-coupled efflux from the parasite of lactate generated by glycolysis. Both compounds were shown to inhibit lactate transport across the parasite plasma membrane, and the transport of lactate by PfFNT expressed in Xenopus laevis oocytes. PfFNT inhibition caused accumulation of lactate in parasitised erythrocytes, and swelling of both the parasite and parasitised erythrocyte. Long-term exposure of parasites to one of the inhibitors gave rise to resistant parasites with a mutant form of PfFNT that showed reduced inhibitor sensitivity. This study provides the first evidence that PfFNT is a druggable antimalarial target. PMID:28178359

  2. Genome-wide association study identifies ABCG2 (BCRP) as an allopurinol transporter and a determinant of drug response

    Science.gov (United States)

    Wen, CC; Yee, SW; Liang, X; Hoffmann, TJ; Kvale, MN; Banda, Y; Jorgenson, E; Schaefer, C; Risch, N; Giacomini, KM

    2015-01-01

    The first-line treatment of hyperuricemia, which causes gout, is allopurinol. The allopurinol response is highly variable, with many users failing to achieve target serum uric acid (SUA) levels. No genome-wide association study (GWAS) has examined the genetic factors affecting allopurinol effectiveness. Using 2,027 subjects in Kaiser Permanente’s Genetic Epidemiology Research on Adult Health and Aging (GERA) Cohort, we conducted a GWAS of allopurinol-related SUA reduction, first in the largest ethnic group, non-Hispanic white (NHW) subjects, and then in a stratified transethnic meta-analysis. ABCG2, encoding the efflux pump BCRP, was associated with SUA reduction in NHW subjects (P = 2 × 10−8), and a missense allele (rs2231142) was associated with a reduced response (P = 3 × 10−7) in the meta-analysis. Isotopic uptake studies in cells demonstrated that BCRP transports allopurinol and genetic variants in ABCG2 affect this transport. Collectively, this first GWAS of allopurinol response demonstrates that ABCG2 is a key determinant of response to the drug. PMID:25676789

  3. Hydrographic and Impairment Statistics Database: FOCA

    Data.gov (United States)

    National Park Service, Department of the Interior — Hydrographic and Impairment Statistics (HIS) is a National Park Service (NPS) Water Resources Division (WRD) project established to track certain goals created in...

  4. Integrated compound profiling screens identify the mitochondrial electron transport chain as the molecular target of the natural products manassantin, sesquicillin, and arctigenin.

    Science.gov (United States)

    Lai, Kevin; Selinger, Douglas W; Solomon, Jonathan M; Wu, Hua; Schmitt, Esther; Serluca, Fabrizio C; Curtis, Daniel; Benson, John D

    2013-01-18

    Phenotypic compound screens can be used to identify novel targets in signaling pathways and disease processes, but the usefulness of these screens depends on the ability to quickly determine the target and mechanism of action of the molecules identified as hits. One fast route to discovering the mechanism of action of a compound is to profile its properties and to match this profile with those of compounds of known mechanism of action. In this work, the Novartis collection of over 12,000 pure natural products was screened for effects on early zebrafish development. The largest phenotypic class of hits, which caused developmental arrest without necrosis, contained known electron transport chain inhibitors and many compounds of unknown mechanism of action. High-throughput transcriptional profiling revealed that these compounds are mechanistically related to one another. Metabolic and biochemical assays confirmed that all of the molecules that induced developmental arrest without necrosis inhibited the electron transport chain. These experiments demonstrate that the electron transport chain is the target of the natural products manassantin, sesquicillin, and arctigenin. The overlap between the zebrafish and transcriptional profiling screens was not perfect, indicating that multiple profiling screens are necessary to fully characterize molecules of unknown function. Together, zebrafish screening and transcriptional profiling represent sensitive and scalable approaches for identifying bioactive compounds and elucidating their mechanism of action.

  5. In-depth proteome mining of cultured Catharanthus roseus cells identifies candidate proteins involved in the synthesis and transport of secondary metabolites.

    Science.gov (United States)

    Champagne, Antoine; Rischer, Heiko; Oksman-Caldentey, Kirsi-Marja; Boutry, Marc

    2012-12-01

    Madagascar periwinkle (Catharanthus roseus) is the major source of terpenoid indole alkaloids, such as vinblastine or vincristine, used as natural drugs against various cancers. In this study, we have extensively analyzed the proteome of cultured C. roseus cells. Comparison of the proteomes of two independent cell lines with different terpenoid indole alkaloid metabolism by 2D-DIGE revealed 358 proteins that differed quantitatively by at least a twofold average ratio. Of these, 172 were identified by MS; most corresponded to housekeeping proteins. Less abundant proteins were identified by LC separation of tryptic peptides of proteins from one of the lines. We identified 1663 proteins, most of which are housekeeping proteins or involved in primary metabolism. However, 63 enzymes potentially involved in secondary metabolism were also identified, of which 22 are involved in terpenoid indole alkaloid biosynthesis and 16 are predicted transporters putatively involved in secondary metabolite transport. About 30% of the proteins identified have an unclear or unknown function, indicating important gaps in knowledge of plant metabolism. This study is an important step toward elucidating the proteome of C. roseus, which is critical for a better understanding of how this plant synthesizes terpenoid indole alkaloids.

  6. Conditional Deletion of Fgfr1 in the Proximal and Distal Tubule Identifies Distinct Roles in Phosphate and Calcium Transport.

    Directory of Open Access Journals (Sweden)

    Xiaobin Han

    Full Text Available A postnatal role of fibroblast growth factor receptor-1 (FGFR1 in the kidney is suggested by its binding to α-Klotho to form an obligate receptor for the hormone fibroblast growth factor-23 (FGF-23. FGFR1 is expressed in both the proximal and distal renal tubular segments, but its tubular specific functions are unclear. In this study, we crossed Fgfr1flox/flox mice with either gamma-glutamyltransferase-Cre (γGT-Cre or kidney specific-Cre (Ksp-Cre mice to selectively create proximal tubule (PT and distal tubule (DT Fgfr1 conditional knockout mice (designated Fgfr1PT-cKO and Fgfr1DT-cKO, respectively. Fgfr1PT-cKO mice exhibited an increase in sodium-dependent phosphate co-transporter expression, hyperphosphatemia, and refractoriness to the phosphaturic actions of FGF-23, consistent with a direct role of FGFR1 in mediating the proximal tubular phosphate responses to FGF-23. In contrast, Fgfr1DT-cKO mice unexpectedly developed hypercalciuria, secondary elevations of parathyroid hormone (PTH, hypophosphatemia and enhanced urinary phosphate excretion. Fgfr1PT-cKO mice also developed a curly tail/spina bifida-like skeletal phenotype, whereas Fgfr1DT-cKO mice developed renal tubular micro-calcifications and reductions in cortical bone thickness. Thus, FGFR1 has dual functions to directly regulate proximal and distal tubule phosphate and calcium reabsorption, indicating a physiological role of FGFR1 signaling in both phosphate and calcium homeostasis.

  7. Reactive transport modeling of chemical and isotope data to identify degradation processes of chlorinated ethenes in a diffusion-dominated media

    DEFF Research Database (Denmark)

    Chambon, Julie Claire Claudia; Damgaard, Ida; Jeannottat, Simon

    . Degradation and transport processes of chlorinated ethenes are not well understood in such geological settings, therefore risk assessment and remediation at these sites are particularly challenging. In this work, a combined approach of chemical and isotope analysis on core samples, and reactive transport...... modeling has been used to identify the degradation processes occurring at the core scale. The field data was from a site located at Vadsby, Denmark, where chlorinated solvents were spilled during the 1960-70’s, resulting in contamination of the clay till and the underlying sandy layer (15 meters below...... is an important finding, that is further supported by microbial and chemical data. Improved understanding of degradation processes in clay tills is useful for improving the reliability of risk assessment and the design of remediation schemes for chlorinated solvents....

  8. Use of car crashes resulting in fatal and serious injuries to analyze a safe road transport system model and to identify system weaknesses.

    Science.gov (United States)

    Stigson, Helena; Hill, Julian

    2009-10-01

    The objective of this study was to evaluate a model for a safe road transport system, based on some safety performance indicators regarding the road user, the vehicle, and the road, by using crashes with fatally and seriously injured car occupants. The study also aimed to evaluate whether the model could be used to identify system weaknesses and components (road user, vehicles, and road) where improvements would yield the highest potential for further reductions in serious injuries. Real-life car crashes with serious injury outcomes (Maximum Abbreviated Injury Scale 2+) were classified according to the vehicle's safety rating by Euro NCAP (European New Car Assessment Programme) and whether the vehicle was fitted with ESC (Electronic Stability Control). For each crash, the road was also classified according to EuroRAP (European Road Assessment Programme) criteria, and human behavior in terms of speeding, seat belt use, and driving under the influence of alcohol/drugs. Each crash was compared and classified according to the model criteria. Crashes where the safety criteria were not met in more than one of the 3 components were reclassified to identify whether all the components were correlated to the injury outcome. In-depth crash injury data collected by the UK On The Spot (OTS) accident investigation project was used in this study. All crashes in the OTS database occurring between 2000 and 2005 with a car occupant with injury rated MAIS2+ were included, for a total of 101 crashes with 120 occupants. It was possible to classify 90 percent of the crashes according to the model. Eighty-six percent of the occupants were injured when more than one of the 3 components were noncompliant with the safety criteria. These cases were reclassified to identify whether all of the components were correlated to the injury outcome. In 39 of the total 108 cases, at least two components were still seen to interact. The remaining cases were only related to one of the safety criteria

  9. Energy transport corridors: the potential role of Federal lands in states identified by the Energy Policy Act of 2005, section 368(b).

    Energy Technology Data Exchange (ETDEWEB)

    Krummel, J.; Hlohowskyj, I.; Kuiper, J.; Kolpa, R.; Moore, R.; May, J.; VanKuiken, J.C.; Kavicky, J.A.; McLamore, M.R.; Shamsuddin, S. (Decision and Information Sciences); ( EVS)

    2011-09-01

    106 of the National Historic Preservation Act (NHPA). Under Section 368, Congress divided the United States into two groups of states: the 11 contiguous western states and the remaining states. Direction for energy transportation corridor analysis and selection in the 11 western states was addressed in Section 368(a) of EPAct, while direction for energy transportation corridor analysis and selection in all other states was addressed under Section 368(b) of EPAct. It was clearly the priority of Congress to conduct corridor location studies and designation first on federal lands in the western states. Under Section 368(a), the Agencies produced a programmatic environmental impact statement (EIS), Designation of Energy Corridors on Federal Land in the 11 Western States (DOE and DOI 2008), that was used in part as the basis for designating more than 6,000 mi (9,656 km) of energy transportation corridors on federal land in 11 western states. Under Section 368(a) of EPAct, Congress clearly stated the Agencies needed to (1) designate energy transportation corridors on federal land, (2) conduct the necessary environmental review of the designated corridors, and (3) incorporate the designated corridors into the appropriate land use plans. Congressional direction under Section 368(b) of EPAct differs from that provided under Section 368(a). Specifically, Section 368(b) requires the secretaries of the Agencies, in consultation with the Federal Energy Regulatory Commission (FERC), affected utility industries, and other interested persons, to jointly: (1) Identify corridors for oil, gas, and hydrogen pipelines and electricity transmission and distribution facilities on federal land in states other than the 11 western states identified under Section 368(a) of EPAct, and (2) Schedule prompt action to identify, designate, and incorporate the corridors into the applicable land use plans. While Section 368(a) clearly directs designation as a necessary first step for energy

  10. Differential expression of vesicular glutamate transporters 1 and 2 may identify distinct modes of glutamatergic transmission in the macaque visual system.

    Science.gov (United States)

    Balaram, Pooja; Hackett, Troy A; Kaas, Jon H

    2013-05-01

    Glutamate is the primary neurotransmitter utilized by the mammalian visual system for excitatory neurotransmission. The sequestration of glutamate into synaptic vesicles, and the subsequent transport of filled vesicles to the presynaptic terminal membrane, is regulated by a family of proteins known as vesicular glutamate transporters (VGLUTs). Two VGLUT proteins, VGLUT1 and VGLUT2, characterize distinct sets of glutamatergic projections between visual structures in rodents and prosimian primates, yet little is known about their distributions in the visual system of anthropoid primates. We have examined the mRNA and protein expression patterns of VGLUT1 and VGLUT2 in the visual system of macaque monkeys, an Old World anthropoid primate, in order to determine their relative distributions in the superior colliculus, lateral geniculate nucleus, pulvinar complex, V1 and V2. Distinct expression patterns for both VGLUT1 and VGLUT2 identified architectonic boundaries in all structures, as well as anatomical subdivisions of the superior colliculus, pulvinar complex, and V1. These results suggest that VGLUT1 and VGLUT2 clearly identify regions of glutamatergic input in visual structures, and may identify common architectonic features of visual areas and nuclei across the primate radiation. Additionally, we find that VGLUT1 and VGLUT2 characterize distinct subsets of glutamatergic projections in the macaque visual system; VGLUT2 predominates in driving or feedforward projections from lower order to higher order visual structures while VGLUT1 predominates in modulatory or feedback projections from higher order to lower order visual structures. The distribution of these two proteins suggests that VGLUT1 and VGLUT2 may identify class 1 and class 2 type glutamatergic projections within the primate visual system (Sherman and Guillery, 2006).

  11. A haploid genetic screen identifies the major facilitator domain containing 2A (MFSD2A) transporter as a key mediator in the response to tunicamycin.

    Science.gov (United States)

    Reiling, Jan H; Clish, Clary B; Carette, Jan E; Varadarajan, Malini; Brummelkamp, Thijn R; Sabatini, David M

    2011-07-19

    Tunicamycin (TM) inhibits eukaryotic asparagine-linked glycosylation, protein palmitoylation, ganglioside production, proteoglycan synthesis, 3-hydroxy-3-methylglutaryl coenzyme-A reductase activity, and cell wall biosynthesis in bacteria. Treatment of cells with TM elicits endoplasmic reticulum stress and activates the unfolded protein response. Although widely used in laboratory settings for many years, it is unknown how TM enters cells. Here, we identify in an unbiased genetic screen a transporter of the major facilitator superfamily, major facilitator domain containing 2A (MFSD2A), as a critical mediator of TM toxicity. Cells without MFSD2A are TM-resistant, whereas MFSD2A-overexpressing cells are hypersensitive. Hypersensitivity is associated with increased cellular TM uptake concomitant with an enhanced endoplasmic reticulum stress response. Furthermore, MFSD2A mutant analysis reveals an important function of the C terminus for correct intracellular localization and protein stability, and it identifies transmembrane helical amino acid residues essential for mediating TM sensitivity. Overall, our data uncover a critical role for MFSD2A by acting as a putative TM transporter at the plasma membrane.

  12. Energy transport corridors: the potential role of Federal lands in states identified by the Energy Policy Act of 2005, section 368(b).

    Energy Technology Data Exchange (ETDEWEB)

    Krummel, J.; Hlohowskyj, I.; Kuiper, J.; Kolpa, R.; Moore, R.; May, J.; VanKuiken, J.C.; Kavicky, J.A.; McLamore, M.R.; Shamsuddin, S. (Decision and Information Sciences); ( EVS)

    2011-09-01

    106 of the National Historic Preservation Act (NHPA). Under Section 368, Congress divided the United States into two groups of states: the 11 contiguous western states and the remaining states. Direction for energy transportation corridor analysis and selection in the 11 western states was addressed in Section 368(a) of EPAct, while direction for energy transportation corridor analysis and selection in all other states was addressed under Section 368(b) of EPAct. It was clearly the priority of Congress to conduct corridor location studies and designation first on federal lands in the western states. Under Section 368(a), the Agencies produced a programmatic environmental impact statement (EIS), Designation of Energy Corridors on Federal Land in the 11 Western States (DOE and DOI 2008), that was used in part as the basis for designating more than 6,000 mi (9,656 km) of energy transportation corridors on federal land in 11 western states. Under Section 368(a) of EPAct, Congress clearly stated the Agencies needed to (1) designate energy transportation corridors on federal land, (2) conduct the necessary environmental review of the designated corridors, and (3) incorporate the designated corridors into the appropriate land use plans. Congressional direction under Section 368(b) of EPAct differs from that provided under Section 368(a). Specifically, Section 368(b) requires the secretaries of the Agencies, in consultation with the Federal Energy Regulatory Commission (FERC), affected utility industries, and other interested persons, to jointly: (1) Identify corridors for oil, gas, and hydrogen pipelines and electricity transmission and distribution facilities on federal land in states other than the 11 western states identified under Section 368(a) of EPAct, and (2) Schedule prompt action to identify, designate, and incorporate the corridors into the applicable land use plans. While Section 368(a) clearly directs designation as a necessary first step for energy

  13. Genome-Wide Association Analysis Identifies a Mutation in the Thiamine Transporter 2 (SLC19A3) Gene Associated with Alaskan Husky Encephalopathy

    Science.gov (United States)

    Vernau, Karen M.; Runstadler, Jonathan A.; Brown, Emily A.; Cameron, Jessie M.; Huson, Heather J.; Higgins, Robert J.; Ackerley, Cameron; Sturges, Beverly K.; Dickinson, Peter J.; Puschner, Birgit; Giulivi, Cecilia; Shelton, G. Diane; Robinson, Brian H.; DiMauro, Salvatore; Bollen, Andrew W.; Bannasch, Danika L.

    2013-01-01

    Alaskan Husky Encephalopathy (AHE) has been previously proposed as a mitochondrial encephalopathy based on neuropathological similarities with human Leigh Syndrome (LS). We studied 11 Alaskan Husky dogs with AHE, but found no abnormalities in respiratory chain enzyme activities in muscle and liver, or mutations in mitochondrial or nuclear genes that cause LS in people. A genome wide association study was performed using eight of the affected dogs and 20 related but unaffected control AHs using the Illumina canine HD array. SLC19A3 was identified as a positional candidate gene. This gene controls the uptake of thiamine in the CNS via expression of the thiamine transporter protein THTR2. Dogs have two copies of this gene located within the candidate interval (SLC19A3.2 – 43.36–43.38 Mb and SLC19A3.1 – 43.411–43.419 Mb) on chromosome 25. Expression analysis in a normal dog revealed that one of the paralogs, SLC19A3.1, was expressed in the brain and spinal cord while the other was not. Subsequent exon sequencing of SLC19A3.1 revealed a 4bp insertion and SNP in the second exon that is predicted to result in a functional protein truncation of 279 amino acids (c.624 insTTGC, c.625 C>A). All dogs with AHE were homozygous for this mutation, 15/41 healthy AH control dogs were heterozygous carriers while 26/41 normal healthy AH dogs were wild type. Furthermore, this mutation was not detected in another 187 dogs of different breeds. These results suggest that this mutation in SLC19A3.1, encoding a thiamine transporter protein, plays a critical role in the pathogenesis of AHE. PMID:23469184

  14. Genome-wide association analysis identifies a mutation in the thiamine transporter 2 (SLC19A3 gene associated with Alaskan Husky encephalopathy.

    Directory of Open Access Journals (Sweden)

    Karen M Vernau

    Full Text Available Alaskan Husky Encephalopathy (AHE has been previously proposed as a mitochondrial encephalopathy based on neuropathological similarities with human Leigh Syndrome (LS. We studied 11 Alaskan Husky dogs with AHE, but found no abnormalities in respiratory chain enzyme activities in muscle and liver, or mutations in mitochondrial or nuclear genes that cause LS in people. A genome wide association study was performed using eight of the affected dogs and 20 related but unaffected control AHs using the Illumina canine HD array. SLC19A3 was identified as a positional candidate gene. This gene controls the uptake of thiamine in the CNS via expression of the thiamine transporter protein THTR2. Dogs have two copies of this gene located within the candidate interval (SLC19A3.2 - 43.36-43.38 Mb and SLC19A3.1 - 43.411-43.419 Mb on chromosome 25. Expression analysis in a normal dog revealed that one of the paralogs, SLC19A3.1, was expressed in the brain and spinal cord while the other was not. Subsequent exon sequencing of SLC19A3.1 revealed a 4bp insertion and SNP in the second exon that is predicted to result in a functional protein truncation of 279 amino acids (c.624 insTTGC, c.625 C>A. All dogs with AHE were homozygous for this mutation, 15/41 healthy AH control dogs were heterozygous carriers while 26/41 normal healthy AH dogs were wild type. Furthermore, this mutation was not detected in another 187 dogs of different breeds. These results suggest that this mutation in SLC19A3.1, encoding a thiamine transporter protein, plays a critical role in the pathogenesis of AHE.

  15. Whole-Organism Developmental Expression Profiling Identifies RAB-28 as a Novel Ciliary GTPase Associated with the BBSome and Intraflagellar Transport.

    Directory of Open Access Journals (Sweden)

    Victor L Jensen

    2016-12-01

    Full Text Available Primary cilia are specialised sensory and developmental signalling devices extending from the surface of most eukaryotic cells. Defects in these organelles cause inherited human disorders (ciliopathies such as retinitis pigmentosa and Bardet-Biedl syndrome (BBS, frequently affecting many physiological and developmental processes across multiple organs. Cilium formation, maintenance and function depend on intracellular transport systems such as intraflagellar transport (IFT, which is driven by kinesin-2 and IFT-dynein motors and regulated by the Bardet-Biedl syndrome (BBS cargo-adaptor protein complex, or BBSome. To identify new cilium-associated genes, we employed the nematode C. elegans, where ciliogenesis occurs within a short timespan during late embryogenesis when most sensory neurons differentiate. Using whole-organism RNA-Seq libraries, we discovered a signature expression profile highly enriched for transcripts of known ciliary proteins, including FAM-161 (FAM161A orthologue, CCDC-104 (CCDC104, and RPI-1 (RP1/RP1L1, which we confirm are cilium-localised in worms. From a list of 185 candidate ciliary genes, we uncover orthologues of human MAP9, YAP, CCDC149, and RAB28 as conserved cilium-associated components. Further analyses of C. elegans RAB-28, recently associated with autosomal-recessive cone-rod dystrophy, reveal that this small GTPase is exclusively expressed in ciliated neurons where it dynamically associates with IFT trains. Whereas inactive GDP-bound RAB-28 displays no IFT movement and diffuse localisation, GTP-bound (activated RAB-28 concentrates at the periciliary membrane in a BBSome-dependent manner and undergoes bidirectional IFT. Functional analyses reveal that whilst cilium structure, sensory function and IFT are seemingly normal in a rab-28 null allele, overexpression of predicted GDP or GTP locked variants of RAB-28 perturbs cilium and sensory pore morphogenesis and function. Collectively, our findings present a new

  16. Whole-Organism Developmental Expression Profiling Identifies RAB-28 as a Novel Ciliary GTPase Associated with the BBSome and Intraflagellar Transport.

    Science.gov (United States)

    Jensen, Victor L; Carter, Stephen; Sanders, Anna A W M; Li, Chunmei; Kennedy, Julie; Timbers, Tiffany A; Cai, Jerry; Scheidel, Noemie; Kennedy, Breandán N; Morin, Ryan D; Leroux, Michel R; Blacque, Oliver E

    2016-12-01

    Primary cilia are specialised sensory and developmental signalling devices extending from the surface of most eukaryotic cells. Defects in these organelles cause inherited human disorders (ciliopathies) such as retinitis pigmentosa and Bardet-Biedl syndrome (BBS), frequently affecting many physiological and developmental processes across multiple organs. Cilium formation, maintenance and function depend on intracellular transport systems such as intraflagellar transport (IFT), which is driven by kinesin-2 and IFT-dynein motors and regulated by the Bardet-Biedl syndrome (BBS) cargo-adaptor protein complex, or BBSome. To identify new cilium-associated genes, we employed the nematode C. elegans, where ciliogenesis occurs within a short timespan during late embryogenesis when most sensory neurons differentiate. Using whole-organism RNA-Seq libraries, we discovered a signature expression profile highly enriched for transcripts of known ciliary proteins, including FAM-161 (FAM161A orthologue), CCDC-104 (CCDC104), and RPI-1 (RP1/RP1L1), which we confirm are cilium-localised in worms. From a list of 185 candidate ciliary genes, we uncover orthologues of human MAP9, YAP, CCDC149, and RAB28 as conserved cilium-associated components. Further analyses of C. elegans RAB-28, recently associated with autosomal-recessive cone-rod dystrophy, reveal that this small GTPase is exclusively expressed in ciliated neurons where it dynamically associates with IFT trains. Whereas inactive GDP-bound RAB-28 displays no IFT movement and diffuse localisation, GTP-bound (activated) RAB-28 concentrates at the periciliary membrane in a BBSome-dependent manner and undergoes bidirectional IFT. Functional analyses reveal that whilst cilium structure, sensory function and IFT are seemingly normal in a rab-28 null allele, overexpression of predicted GDP or GTP locked variants of RAB-28 perturbs cilium and sensory pore morphogenesis and function. Collectively, our findings present a new approach for

  17. Research Advances: Less Expensive and More Convenient Gaucher's Disease Treatment; Structural Loop Regions: Key to Multidrug-Resistance Transporters?; New Method Identifies Proteins in Old Artwork

    Science.gov (United States)

    King, Angela G.

    2006-01-01

    The X-ray structure of EmrD, a multidrug transporter protein from Escherichia coli, common bacteria known to cause several food-borne illnesses was determined by scientists at The Scripps Research Institute. The hydrophobic residues in the EmrD internal cavity are likely to contribute to the general mechanism transporting various compounds through…

  18. Traffic Analysis Zones, This Layer was created by ARC's Transportation Planning Division to identify Traffic Analysis Zones (TAZs) in the 20-county Atlanta Region. These TAZs represent the geography used in the ongoing transportation modeling for the Envision 6 forecast series (, Published in 2006, 1:100000 (1in=8333ft) scale, Atlanta Regional Commission.

    Data.gov (United States)

    NSGIC Regional | GIS Inventory — Traffic Analysis Zones dataset current as of 2006. This Layer was created by ARC's Transportation Planning Division to identify Traffic Analysis Zones (TAZs) in the...

  19. Structure-function relationship of a plant NCS1 member--homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from Arabidopsis

    National Research Council Canada - National Science Library

    Witz, Sandra; Panwar, Pankaj; Schober, Markus; Deppe, Johannes; Pasha, Farhan Ahmad; Lemieux, M Joanne; Möhlmann, Torsten

    2014-01-01

    .... We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens...

  20. A mutagenic study identifying critical residues for the structure and function of rice manganese transporter OsMTP8.1

    Science.gov (United States)

    Chen, Xi; Li, Jiyu; Wang, Lihua; Ma, Gang; Zhang, Wei

    2016-01-01

    Rice (Oryza sativa) MTP8.1 (OsMTP8.1) is a tonoplast-localized manganese transporter of the cation diffusion facilitator family. Here we present a structure-function analysis of OsMTP8.1 based on the site-directed and random mutagenesis and complementation assays in manganese hypersensitive yeast, in combination with three-dimensional (3D) structure modeling based on the crystal structure of the Escherichia coli CDF family member, EcYiiP. Two metal-binding sites are conserved in OsMTP8.1 with EcYiiP, one is between transmembrane helices TM2 and TM5, the other is the cytoplasmic C-terminus. In addition to these two metal-binding sites, there may exist other Mn-binding sites such as that at the very end of the CTD. Two residues (R167 and L296) may play an important role for the hinge-like movement of CTDs. Several mutations such as E357A and V374D may affect dimer formation, and S132A may induce a conformational change, resulting in a loss of transport function or modification in metal selectivity. The N-terminus of OsMTP8.1 was not functional for Mn transport activity, and the real function of NTD remains to be investigated in the future. The findings of the present study illustrate the structure-function relationship of OsMTP8.1 in Mn transport activity, which may also be applied to other plant Mn-CDF proteins. PMID:27555514

  1. Reactive transport modeling of chemical and isotope data to identify degradation processes of chlorinated ethenes in a diffusion-dominated media

    DEFF Research Database (Denmark)

    Chambon, Julie Claire Claudia; Damgaard, Ida; Jeannottat, Simon;

    zones in the low-permeability media. Previous studies have shown that degradation might be limited to high permeability zones in clay tills, thus limiting the applicability of remediation strategies based on enhanced biodegradation. Therefore the occurrence of degradation inside the clay matrix......Chlorinated ethenes are among the most widespread contaminants in the subsurface and a major threat to groundwater quality at numerous contaminated sites. Many of these contaminated sites are found in low-permeability media, such as clay tills, where contaminant transport is controlled by diffusion...

  2. Atomic modelling and systematic mutagenesis identify residues in multiple drug binding sites that are essential for drug resistance in the major Candida transporter Cdr1.

    Science.gov (United States)

    Nim, Shweta; Lobato, Lucia Gonzalez; Moreno, Alexis; Chaptal, Vincent; Rawal, Manpreet Kaur; Falson, Pierre; Prasad, Rajendra

    2016-11-01

    The ABC (ATP-Binding Cassette) transporter Cdr1 (Candida drug resistance 1) protein (Cdr1p) of Candida albicans, shows promiscuity towards the substrate it exports and plays a major role in antifungal resistance. It has two transmembrane domains (TMDs) comprising of six transmembrane helices (TMH) that envisage and confer the substrate specificity and two nucleotide binding domains (NBDs), interconnected by extracellular loops (ECLs) and intracellular loops (ICLs) Cdr1p. This study explores the diverse substrate specificity spectrum to get a deeper insight into the structural and functional features of Cdr1p. By screening with the variety of compounds towards an in-house TMH 252 mutant library of Cdr1p, we establish new substrates of Cdr1p. The localization of substrate-susceptible mutants in an ABCG5/G8 homology model highlights the common and specific binding pockets inside the membrane domain, where rhodamines and tetrazoliums mainly engage the N-moiety of Cdr1p, binding between TMH 2, 11 and surrounded by TMH 1, 5. Whereas, tin chlorides involve both N and C moieties located at the interface of TMH 2, 11, 1 and 5. Further, screening of the in house TMH mutant library of Cdr1p displays the TMH12 interaction with tetrazolium chloride, trimethyltin chloride and a Ca(2+) ionophore, A23187. In silico localization reveals a binding site at the TMH 12, 9 and 10 interface, which is widely exposed to the lipid interface. Together, for the first time, our study shows the molecular localization of Cdr1p substrates-binding sites and demonstrates the participation of TMH12 in a peripheral drug binding site.

  3. High-resolution array CGH profiling identifies Na/K transporting ATPase interacting 2 (NKAIN2 as a predisposing candidate gene in neuroblastoma.

    Directory of Open Access Journals (Sweden)

    Paolo Romania

    Full Text Available Neuroblastoma (NB, the most common solid cancer in early childhood, usually occurs sporadically but also its familial occurance is known in 1-2% of NB patients. Germline mutations in the ALK and PHOX2B genes have been found in a subset of familial NBs. However, because some individuals harbouring mutations in these genes do not develop this tumor, additional genetic alterations appear to be required for NB pathogenesis. Herein, we studied an Italian family with three NB patients, two siblings and a first cousin, carrying an ALK germline-activating mutation R1192P, that was inherited from their unaffected mothers and with no mutations in the PHOX2B gene. A comparison between somatic and germline DNA copy number changes in the two affected siblings by a high resolution array-based Comparative Genomic Hybridization (CGH analysis revealed a germline gain at NKAIN2 (Na/K transporting ATPase interacting 2 locus in one of the sibling, that was inherited from the parent who does not carry the ALK mutation. Surprisingly, NKAIN2 was expressed at high levels also in the affected sibling that lacks the genomic gain at this locus, clearly suggesting the existance of other regulatory mechanisms. High levels of NKAIN2 were detected in the MYCN-amplified NB cell lines and in the most aggressive NB lesions as well as in the peripheral blood of a large cohort of NB patients. Consistent with a role of NKAIN2 in NB development, NKAIN2 was down-regulated during all-trans retinoic acid differentiation in two NB cell lines. Taken together, these data indicate a potential role of NKAIN2 gene in NB growth and differentiation.

  4. A PTS EII mutant library in Group A Streptococcus identifies a promiscuous man-family PTS transporter influencing SLS-mediated hemolysis.

    Science.gov (United States)

    Sundar, Ganesh S; Islam, Emrul; Gera, Kanika; Le Breton, Yoann; McIver, Kevin S

    2017-02-01

    The Group A Streptococcus (GAS, Streptococcus pyogenes) is a Gram-positive human pathogen that must adapt to unique host environments in order to survive. Links between sugar metabolism and virulence have been demonstrated in GAS, where mutants in the phosphoenolpyruvate-dependent phosphotransferase system (PTS) exhibited Streptolysin S (SLS)-mediated hemolysis during exponential growth. This early onset hemolysis correlated with an increased lesion size and severity in a murine soft tissue infection model when compared with parental M1T1 MGAS5005. To identify the PTS components responsible for this phenotype, we insertionally inactivated the 14 annotated PTS EIIC-encoding genes in the GAS MGAS5005 genome and subjected this library to metabolic and hemolysis assays to functionally characterize each EIIC. It was found that a few EIIs had a very limited influence on PTS sugar metabolism, whereas others were fairly promiscuous. The mannose-specific EII locus, encoded by manLMN, was expressed as a mannose-inducible operon that exhibited the most influence on PTS sugar metabolism, including mannose. Importantly, components of the mannose-specific EII also acted to prevent the early onset of SLS-mediated hemolysis. Interestingly, these roles were not identical in two different M1T1 GAS strains, highlighting the possible versatility of the PTS to adapt to strain-specific needs.

  5. Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis halleri roots identifies nicotianamine synthase, a ZIP transporter and other genes as potential metal hyperaccumulation factors.

    Science.gov (United States)

    Weber, Michael; Harada, Emiko; Vess, Christoph; Roepenack-Lahaye, Edda v; Clemens, Stephan

    2004-01-01

    The hyperaccumulation of zinc (Zn) and cadmium (Cd) is a constitutive property of the metallophyte Arabidopsis halleri. We therefore used Arabidopsis GeneChips to identify genes more active in roots of A. halleri as compared to A. thaliana under control conditions. The two genes showing highest expression in A. halleri roots relative to A. thaliana roots out of more than 8000 genes present on the chip encode a nicotianamine (NA) synthase and a putative Zn2+ uptake system. The significantly higher activity of these and other genes involved in metal homeostasis under various growth conditions was confirmed by Northern and RT-PCR analyses. A. halleri roots also show higher NA synthase protein levels. Furthermore, we developed a capillary liquid chromatography electrospray ionization quadrupole time-of-flight mass spectrometry (CapLC-ESI-QTOF-MS)-based NA analysis procedure and consistently found higher NA levels in roots of A. halleri. Expression of a NA synthase in Zn2+-hypersensitive Schizosaccharomyces pombe cells demonstrated that formation of NA can confer Zn2+ tolerance. Taken together, these observations implicate NA in plant Zn homeostasis and NA synthase in the hyperaccumulation of Zn by A. halleri. Furthermore, the results show that comparative microarray analysis of closely related species can be a valuable tool for the elucidation of phenotypic differences between such species.

  6. Studies of the biogenic amine transporters. VI. Characterization of a novel cocaine binding site, identified with [125I]RTI-55, in membranes prepared from whole rat brain minus caudate.

    Science.gov (United States)

    Rothman, R B; Silverthorn, M L; Baumann, M H; Goodman, C B; Cadet, J L; Matecka, D; Rice, K C; Carroll, F I; Wang, J B; Uhl, G R

    1995-07-01

    Previous studies showed that the cocaine analog [125I]RTI-55 labels dopamine and serotonergic (5-HT) biogenic amine transporters (BATs) with high affinity. Here we characterized [125I]RTI-55 binding to membranes prepared from whole rat brain minus the caudate nuclei. Paroxetine (50 nM) was used to block [125I]RTI-55 binding to 5-HT transporter sites. Initial experiments identified drugs that displaced [125I]RTI-55 binding with moderately low slope factors. Binding surface analysis of the interaction of 3 beta-(4-chlorophenyl)tropan-2 beta-carboxylic acid phenyl ester hydrochloride (RTI-113) and 3 beta-(4-iodophenyl)tropan-2 beta-carboxylic acid phenyl ester hydrochloride (RTI-122) with [125I]RTI-55 binding sites readily resolved two binding sites for [125I]RTI-55 with Kd values of 0.44 nM and 17 nM and Bmax values of 31 and 245 fmol/mg protein. Potent 5-HT and noradrenergic uptake inhibitors had low affinity for both sites. Whereas cocaine, CFT and WIN35,065-2 were 6.0-, 25- and 14-fold selective for the first site, benztropine, PCP and the novel pyrrole, (+-)-(2RS,3aSR,8bRS)-1,2,3,3a,4,8b-hexahydro- 2-benzyl-1-methylindeno-[1,2-b]pyrrole resorcylate [(+-)-HBMP, formerly called (+-)-RTI-4793-14], were moderately selective for the second site. A single binding site with the characteristics of site 1 was resolved using COS cells transiently expressing the cloned rat dopamine transporter. Lesion studies with 6-hydroxydopamine and 5,7-dihydroxytryptamine were conducted to test the hypothesis that site 1 and site 2 are physically distinct. The data showed that these neurotoxins differentially decreased [125I]RTI-55 binding to sites 1 and 2. The differential distribution of sites 1 and 2 in rat brain provides further support for this hypothesis. Viewed collectively, these data show that [125I]RTI-55 labels a novel binding site in rat brain membranes, termed DATsite2, which is not associated with the classic dopamine, serotonin or norepinephrine transporters.

  7. Effects of long- or short-term exposure to a calf identified as persistently infected with bovine viral diarrhea virus on feedlot performance of freshly weaned, transport-stressed beef heifers.

    Science.gov (United States)

    Elam, N A; Thomson, D U; Gleghorn, J F

    2008-08-01

    A single experiment with a completely randomized design was conducted to evaluate the effects of long- or short-term exposure to a calf identified as persistently infected with bovine viral diarrhea virus (PI-BVD) on feedlot performance and carcass characteristics of freshly weaned, transport-stressed beef heifers. Two hundred eighty-eight heifers that had been vaccinated for BVD before weaning and transport were processed and given a metaphylactic antibiotic treatment at arrival and were fed common receiving, growing, and finishing diets for a 215-d period. Treatments were designed to directly or adjacently expose the cattle to a PI-BVD heifer. Directly exposed treatments were 1) negative control with no PI-BVD calf exposure (control), 2) PI-BVD calf commingled in the pen for 60 h and then removed (short-term exposure), and 3) PI-BVD calf commingled in the pen for the duration of the study (long-term exposure); and spatially exposed treatments were 1) negative control with no PI-BVD calf exposure (adjacent pen control), 2) PI-BVD calf commingled in the adjacent pen for 60 h and then removed (adjacent pen short-term exposure), and 3) PI-BVD calf commingled in the adjacent pen for the duration of the study (adjacent pen long-term exposure). Exposure to a PI calf transiently (60 h) or for the duration of the feeding period (215 d) did not affect (P > or = 0.25) final BW compared with heifers that were not exposed. Neither period nor overall DMI was affected (P > or = 0.37) by PI-BVD calf exposure, and no differences (P > or = 0.44) were observed between short- and long-term exposed heifers in the direct or spatially exposed groups. Likewise, total trial ADG was not affected (P > or = 0.36) and overall efficiency of gain (P > or = 0.19) was unaffected by PI-BVD calf exposure in the direct or spatially exposed groups. The results from this study suggest that exposing previously vaccinated, freshly weaned, transport- stressed beef calves to a calf that is persistently

  8. Identificación y caracterización de mudas de transporte, procesos, movimientos y tiempos de espera en nueve pymes manufactureras incorporando la perspectiva del nivel operativo Identifying and characterizing of wastes (Muda in transportation, processes, movements, and waiting time, in nine manufacturing SMEs incorporating the perspective of the operational level

    Directory of Open Access Journals (Sweden)

    Jorge Pérez Rave

    2011-12-01

    Full Text Available Se identifica y se caracteriza en términos de: cantidad, tipo, localización y manifestación, los transportes, tiempos de espera, movimientos y procesos innecesarios en nueve pymes manufactureras de la ciudad de Medellín. El procedimiento constó de las etapas: selección de procesos a estudiar (uno por empresa, capacitación al personal operativo (7 mudas, 5S y gerencia visual, sesión en profundidad con administración de formulario de identificación del muda, verificación en el gemba, y resultados y análisis. Consolidando los hallazgos para las nueve empresas, 151 trabajadores fueron capacitados, los cuales contribuyeron a identificar 1.085 actividades que no aportan valor al cliente, con un promedio de 121 por proceso-empresa, la mayoría fueron transportes (31% y movimientos innecesarios (29%. Se brindan elementos metodológicos que facilitan la comunicación entre el nivel operativo y los demás, así como la capacitación y la participación activa del mismo, posibilitando identificar oportunidades de mejora para las empresas. Se ofrece información de interés para la academia, el gobierno, los centros de desarrollo tecnológico y el sector productivo.Is identified and characterized in terms of: quantity, type, location and expression, transportation, waiting times, movements, and unnecessary processes, in nine manufacturing SMEs in the city of Medellin. The procedure consisted of the stages: selection of processes to be studied (one per company, operating personnel training (7 Wastes (Muda, 5S and visual management, deep session with management of the Muda identification form, verifying in the shop floor (Gemba, results and analysis. Consolidating the findings for the nine companies, 151 workers were trained, which helped to identify 1.085 activities that do not add value to the customer, with an average of 121 per process-company, most were transportation (31% and unnecessary movements (29%. Methodological elements are provided

  9. Identifying Activity

    CERN Document Server

    Lewis, Adrian S

    2009-01-01

    Identification of active constraints in constrained optimization is of interest from both practical and theoretical viewpoints, as it holds the promise of reducing an inequality-constrained problem to an equality-constrained problem, in a neighborhood of a solution. We study this issue in the more general setting of composite nonsmooth minimization, in which the objective is a composition of a smooth vector function c with a lower semicontinuous function h, typically nonsmooth but structured. In this setting, the graph of the generalized gradient of h can often be decomposed into a union (nondisjoint) of simpler subsets. "Identification" amounts to deciding which subsets of the graph are "active" in the criticality conditions at a given solution. We give conditions under which any convergent sequence of approximate critical points finitely identifies the activity. Prominent among these properties is a condition akin to the Mangasarian-Fromovitz constraint qualification, which ensures boundedness of the set of...

  10. Structure-Function Relationship of a Plant NCS1 Member - Homology Modeling and Mutagenesis Identified Residues Critical for Substrate Specificity of PLUTO, a Nucleobase Transporter from Arabidopsis: e91343

    National Research Council Canada - National Science Library

    Sandra Witz; Pankaj Panwar; Markus Schober; Johannes Deppe; Farhan Ahmad Pasha; M Joanne Lemieux; Torsten Möhlmann

    2014-01-01

    .... We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens...

  11. Studies of the biogenic amine transporters. VII. Characterization of a novel cocaine binding site identified with [125I]RTI-55 in membranes prepared from human, monkey and guinea pig caudate.

    Science.gov (United States)

    Rothman, R B; Silverthorn, M L; Glowa, J R; Matecka, D; Rice, K C; Carroll, F I; Partilla, J S; Uhl, G R; Vandenbergh, D J; Dersch, C M

    1998-04-01

    [125I]RTI-55 is a cocaine analog with high affinity for dopamine (DA) and serotonin (5-HT) transporters. Quantitative ligand binding studies revealed a novel high affinity [125I]RTI-55 binding site assayed under 5-HT transporter (SERT) conditions which has low affinity for almost all classic biogenic amine transporter ligands, including high affinity 5-HT transporter inhibitors such as paroxetine, but which retains high affinity for cocaine analogs. This site, termed SERT(site2) for its detection under 5-HT transporter conditions (not for an association with the SERT) occurs in monkey caudate, human caudate, and guinea pig caudate membranes, but not in rat caudate membranes. SERT(site2) is distinguished from the DA transporter (DAT) and SERT by several criteria, including a distinct ligand-selectivity profile, the inability to detect SERT(site2) in cells stably expressing the cloned human DAT, and insensitivity to irreversible ligands which inhibit [125I]RTI-55 binding to the DAT and SERT. Perhaps the most striking finding about SERT(site2) is that a wide range of representative antidepressant agents have very low affinity for SERT(site2). The affinity of cocaine for this site is not very different from the concentration cocaine achieves in the brain at pharmacological doses. Viewed collectively with the observation that ligands with high affinity for SERT(site2) are mostly cocaine analogs, these data lead us to speculate that actions of cocaine which differ from those of classic biogenic amine uptake inhibitors may be mediated in part via SERT(site2).

  12. Radiation Transport

    Energy Technology Data Exchange (ETDEWEB)

    Urbatsch, Todd James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-06-15

    We present an overview of radiation transport, covering terminology, blackbody raditation, opacities, Boltzmann transport theory, approximations to the transport equation. Next we introduce several transport methods. We present a section on Caseology, observing transport boundary layers. We briefly broach topics of software development, including verification and validation, and we close with a section on high energy-density experiments that highlight and support radiation transport.

  13. Study for Air Vehicles at High Speeds, Identifying the Potential Benefits to Transport Aircraft of a Continuously Variable Geometry Trailing-Edge Structure that can be Utilized for Aircraft Control, Trim, Load-Alleviation, and High Lift

    Science.gov (United States)

    2011-08-01

    Fig. 1.1.29 NOTIONAL NEXT GENERATION MOBILTY & TRANSPORTS & CIVIL AIRCRAFT ESTOL CONCEPTS NASA ...This subject is in revival currently. Early proving work has been conducted by NASA on FA- 18 formations. In the time-scale to 2012, Ref.15 mentions...flight research ( NASA & AFRL) into Adaptive Compliant Trailing Edge (ACTE) on a Gulfstream-III, Fig.1.1.23. The conventional TE flaps (19 ft span x

  14. Chamber transport

    Energy Technology Data Exchange (ETDEWEB)

    OLSON,CRAIG L.

    2000-05-17

    Heavy ion beam transport through the containment chamber plays a crucial role in all heavy ion fusion (HIF) scenarios. Here, several parameters are used to characterize the operating space for HIF beams; transport modes are assessed in relation to evolving target/accelerator requirements; results of recent relevant experiments and simulations of HIF transport are summarized; and relevant instabilities are reviewed. All transport options still exist, including (1) vacuum ballistic transport, (2) neutralized ballistic transport, and (3) channel-like transport. Presently, the European HIF program favors vacuum ballistic transport, while the US HIF program favors neutralized ballistic transport with channel-like transport as an alternate approach. Further transport research is needed to clearly guide selection of the most attractive, integrated HIF system.

  15. Liver iron transport

    Institute of Scientific and Technical Information of China (English)

    Ross M Graham; Anita CG Chua; Carly E Herbison; John K Olynyk; Debbie Trinder

    2007-01-01

    The liver plays a central role in iron metabolism. It is the major storage site for iron and also expresses a complex range of molecules which are involved in iron transport and regulation of iron homeostasis. An increasing number of genes associated with hepatic iron transport or regulation have been identified. These include transferrin receptors (TFR1 and 2), a ferrireductase (STEAP3), the transporters divalent metal transporter-1 (DMT1) and ferroportin (FPN) as well as the haemochromatosis protein, HFE and haemojuvelin (HJV),which are signalling molecules. Many of these genes also participate in iron regulatory pathways which focus on the hepatic peptide hepcidin. However, we are still only beginning to understand the complex interactions between liver iron transport and iron homeostasis. This review outlines our current knowledge of molecules of iron metabolism and their roles in iron transport and regulation of iron homeostasis.

  16. Prioritized Contact Transport Stream

    Science.gov (United States)

    Hunt, Walter Lee, Jr. (Inventor)

    2015-01-01

    A detection process, contact recognition process, classification process, and identification process are applied to raw sensor data to produce an identified contact record set containing one or more identified contact records. A prioritization process is applied to the identified contact record set to assign a contact priority to each contact record in the identified contact record set. Data are removed from the contact records in the identified contact record set based on the contact priorities assigned to those contact records. A first contact stream is produced from the resulting contact records. The first contact stream is streamed in a contact transport stream. The contact transport stream may include and stream additional contact streams. The contact transport stream may be varied dynamically over time based on parameters such as available bandwidth, contact priority, presence/absence of contacts, system state, and configuration parameters.

  17. Intelligence in DSM-IV combined type attention-deficit/hyperactivity disorder is not predicted by either dopamine receptor/transporter genes or other previously identified risk alleles for attention-deficit/hyperactivity disorder

    NARCIS (Netherlands)

    Sonuga-Barke, E.; Brookes, K.J.; Buitelaar, J.K.; Anney, R.; Bitsakou, P.; Baeyens, D.; Buschgens, C.; Chen, W.; Christiansen, H.; Eisenberg, J.; Kuntsi, J.; Manor, I.; Melia, A.; Mulligan, A.; Lambregts-Rommelse, N.N.J.; Muller, U.C.; Uebel, H.; Banaschewski, T.; Ebstein, R.; Franke, B.; Gill, M.; Miranda, A.; Oades, R.D.; Roeyers, H.; Rothenberger, A.; Sergeant, J.A.; Steinhausen, H.C.; Thompson, M.; Taylor, E.; Asherson, P.; Faraone, S.V.

    2008-01-01

    A major goal of genetic studies of attention deficit hyperactivity disorder (ADHD) is to identify individual characteristics that might help segregate the disorder's inherent heterogeneity. [Mill et al. (2006); Arch Ger Psychiatry 63:462-469] recently reported a potentially important association bet

  18. Neurotransmitter transporters

    DEFF Research Database (Denmark)

    Gether, Ulrik; Andersen, Peter H; Larsson, Orla M

    2006-01-01

    The concentration of neurotransmitters in the extracellular space is tightly controlled by distinct classes of membrane transport proteins. This review focuses on the molecular function of two major classes of neurotransmitter transporter that are present in the cell membrane of neurons and....../or glial cells: the solute carrier (SLC)1 transporter family, which includes the transporters that mediate the Na(+)-dependent uptake of glutamate, and the SLC6 transporter family, which includes the transporters that mediate the Na(+)-dependent uptake of dopamine, 5-HT, norepinephrine, glycine and GABA....... Recent research has provided substantial insight into the structure and function of these transporters. In particular, the recent crystallizations of bacterial homologs are of the utmost importance, enabling the first reliable structural models of the mammalian neurotransmitter transporters...

  19. WASTE PACKAGE TRANSPORTER DESIGN

    Energy Technology Data Exchange (ETDEWEB)

    D.C. Weddle; R. Novotny; J. Cron

    1998-09-23

    The purpose of this Design Analysis is to develop preliminary design of the waste package transporter used for waste package (WP) transport and related functions in the subsurface repository. This analysis refines the conceptual design that was started in Phase I of the Viability Assessment. This analysis supports the development of a reliable emplacement concept and a retrieval concept for license application design. The scope of this analysis includes the following activities: (1) Assess features of the transporter design and evaluate alternative design solutions for mechanical components. (2) Develop mechanical equipment details for the transporter. (3) Prepare a preliminary structural evaluation for the transporter. (4) Identify and recommend the equipment design for waste package transport and related functions. (5) Investigate transport equipment interface tolerances. This analysis supports the development of the waste package transporter for the transport, emplacement, and retrieval of packaged radioactive waste forms in the subsurface repository. Once the waste containers are closed and accepted, the packaged radioactive waste forms are termed waste packages (WP). This terminology was finalized as this analysis neared completion; therefore, the term disposal container is used in several references (i.e., the System Description Document (SDD)) (Ref. 5.6). In this analysis and the applicable reference documents, the term ''disposal container'' is synonymous with ''waste package''.

  20. School Transportation.

    Science.gov (United States)

    Executive Educator, 1990

    1990-01-01

    This special section on student transportation offers a case study of a school system that recycles buses for safety drills; articles on fuel-saving strategies, the pros and cons of contracting for transportation services or operating a publicly owned bus fleet, and advice on full cost accounting for transportation costs; and a transportation…

  1. EBS Radionuclide Transport Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    J. Prouty

    2006-07-14

    The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment (TSPA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport model considers advective transport and diffusive transport

  2. Sustainable Transportation

    DEFF Research Database (Denmark)

    Hall, Ralph P.; Gudmundsson, Henrik; Marsden, Greg

    2014-01-01

    The transportation system is the backbone of economic and social progress and the means by which humans access goods and services and connect with one another. Yet, as the scale of transportation activities has grown worldwide, so too have the negative environmental, social, and economic impacts...... that relate to the construction and maintenance of transportation infrastructure and the operation or use of the different transportation modes. The concept of sustainable transportation emerged in response to these concerns as part of the broader notion of sustainable development. Given the transportation...... sector’s significant contribution to global challenges such as climate change, it is often said that sustainable development cannot be achieved without sustainable transportation....

  3. Evaluating the function of putative hormone transporters.

    Science.gov (United States)

    Frommer, Wolf B; Schulz, Burkhard; Murphy, Angus S

    2009-02-01

    Hormones typically serve as long distance signaling molecules. To reach their site of action, hormones need to be transported from the sites of synthesis. Many plant hormones are mobile, thus requiring specific transport systems for the export from their source cells as well as subsequent import into target cells. Hormone transport in general is still poorly understood. Auxin is probably the most intensively studied plant hormone concerning transport in the moment. To advance our understanding of hormone transport we need two principal data sets: information on the properties of the transport systems including substrate specificity and kinetics, and we need to identify candidate genes for the respective transporters. Physiological transport data can provide an important basis for identifying and characterizing candidate transporters and to define their in vivo role. A recent publication in Plant Physiology highlights how kinetic and specificity studies may help to identify cytokinin transporters.

  4. Sustainable Transportation

    DEFF Research Database (Denmark)

    Hall, Ralph P.; Gudmundsson, Henrik; Marsden, Greg

    2014-01-01

    The transportation system is the backbone of economic and social progress and the means by which humans access goods and services and connect with one another. Yet, as the scale of transportation activities has grown worldwide, so too have the negative environmental, social, and economic impacts ...... sector’s significant contribution to global challenges such as climate change, it is often said that sustainable development cannot be achieved without sustainable transportation....

  5. Transport Phenomena.

    Science.gov (United States)

    McCready, Mark J.; Leighton, David T.

    1987-01-01

    Discusses the problems created in graduate chemical engineering programs when students enter with a wide diversity of understandings of transport phenomena. Describes a two-semester graduate transport course sequence at the University of Notre Dame which focuses on fluid mechanics and heat and mass transfer. (TW)

  6. In vivo gene expression analysis identifies genes required for enhanced colonization of the mouse urinary tract by uropathogenic Escherichia coli strain CFT073 dsdA.

    Science.gov (United States)

    Haugen, Brian J; Pellett, Shahaireen; Redford, Peter; Hamilton, Holly L; Roesch, Paula L; Welch, Rodney A

    2007-01-01

    Deletional inactivation of the gene encoding d-serine deaminase, dsdA, in uropathogenic Escherichia coli strain CFT073 results in a hypermotile strain with a hypercolonization phenotype in the bladder and kidneys of mice in a model of urinary tract infection (UTI). The in vivo gene expression profiles of CFT073 and CFT073 dsdA were compared by isolating RNA directly from the urine of mice challenged with each strain individually. Hybridization of cDNAs derived from these samples to CFT073-specific microarrays allowed identification of genes that were up- or down-regulated in the dsdA deletion strain during UTI. Up-regulated genes included the known d-serine-responsive gene dsdX, suggesting in vivo intracellular accumulation of d-serine by CFT073 dsdA. Genes encoding F1C fimbriae, both copies of P fimbriae, hemolysin, OmpF, a dipeptide transporter DppA, a heat shock chaperone IbpB, and clusters of open reading frames with unknown functions were also up-regulated. To determine the role of these genes as well as motility in the hypercolonization phenotype, mutants were constructed in the CFT073 dsdA background and tested in competition against the wild type in the murine model of UTI. Strains with deletions of one or both of the two P fimbrial operons, hlyA, fliC, ibpB, c0468, locus c3566 to c3568, or c2485 to c2490 colonized mouse bladders and kidneys at levels indistinguishable from wild type. CFT073 dsdA c2398 and CFT073 dsdA focA maintained a hypercolonization phenotype. A CFT073 dsdA dppA mutant was attenuated 10- to 50-fold in its colonization ability compared to CFT073. Our results support a role for d-serine catabolism and signaling in global virulence gene regulation of uropathogenic E. coli.

  7. Animal Transports

    Directory of Open Access Journals (Sweden)

    Diana Ludrovcová

    2016-08-01

    Full Text Available Purpose and Originality: The research is aimed to the animal transports issue, from two points of view – first is the animal cruelty and second is the policy and economic consideration. The goal is to acquaint the readers with the transports risks and its cruelty and evaluation of the economic, political aspects for he involved countries. The study is oriented on more points of view, what is rare in works with a similar theme. Method: This paper examines many issues and examinations from different authors and subsequently summarized the findings with authors own knowledge to one expanded unit. Results: Results proves, that livestock transports have negative impact on animal´s health, environment. Number of transported animals is rising every year. Society: Research familiarize the society with the animal transports, cruelty against animals during them, and influence of transports on some countries, their economy, policy. People get better informed and can form their own opinion on this topic. They may start acting, undertaking some steps to improve the present situation, what could help a lot to animals and environment. Limitations / further research: Future research could show progress and improvement of transports, quality of food supply and economics.

  8. SUSTAINABLE TRANSPORTATION

    Directory of Open Access Journals (Sweden)

    Linda STEG

    2007-01-01

    Full Text Available This paper discusses possible contributions of psychologists to sustainable transportation. It is argued that in order to reach sustainable transportation, among others, behaviour changes of individual car users are needed. As transport policies will be more effective if they target important antecedents of travel behaviour, first, factors influencing such behaviour are discussed. It is argued that car use is very attractive and sometimes even necessary for many different reasons. This implies that a combination of policies is called for, each targeting different factors that support car use and hinder the use of more sustainable modes of transport. Next, the paper elaborates on policy strategies that may be employed to achieve sustainable transportation by changing car use. Increasing the attractiveness of sustainable transport modes by means of pull measures seems not sufficient to reduce the level of car use. Besides, car use should be made less attractive by means of push measures to force drivers to reconsider their travel behaviour. The acceptability of such policies may be increased by clearly communicating the aim of these policies, and the expected positive consequences (e.g., less congestion, improved environmental quality. Moreover, possible negative effects for individual freedom may be compensated by implementing additional policies aimed at facilitating the use of sustainable transport modes.

  9. Identification and Characterization of Glucosinolate Transporters

    DEFF Research Database (Denmark)

    Jørgensen, Morten Egevang

    of plant defence, and the distribution pattern reflects the individual contributions from biosynthesis, transport and turnover. However, little is known about how and to what extent transport processes contribute to establishing these distribution patterns. With the recent identification of AtGTR1 and At......GTR2, two high-affinity glucosinolate transporters, a new molecular tool was provided to study glucosinlate transport in A. thaliana. This thesis contains 6 papers where transporter proteins are identified and characterized biochemically and genetically....

  10. Sediment Transport

    DEFF Research Database (Denmark)

    Liu, Zhou

    Flow and sediment transport are important in relation to several engineering topics, e.g. erosion around structures, backfilling of dredged channels and nearshore morphological change. The purpose of the present book is to describe both the basic hydrodynamics and the basic sediment transport...... mechanics. Chapter 1 deals with fundamentals in fluid mechanics with emphasis on bed shear stress by currents, while chapter 3 discusses wave boundary layer theory. They are both written with a view to sediment transport. Sediment transport in rivers, cross-shore and longshore are dealt with in chapters 2......, 4 and 5, respectively. It is not the intention of the book to give a broad review of the literature on this very wide topic. The book tries to pick up information which is of engineering importance. An obstacle to the study of sedimentation is the scale effect in model tests. Whenever small...

  11. Transport Phenomena.

    Science.gov (United States)

    Shah, D. B.

    1984-01-01

    Describes a course designed to achieve a balance between exposing students to (1) advanced topics in transport phenomena, pointing out similarities and differences between three transfer processes and (2) common methods of solving differential equations. (JN)

  12. Nicaragua - Transportation

    Data.gov (United States)

    Millennium Challenge Corporation — The evaluation examines impacts of the Transportation Project in three ways. First, we calculate economic rates of return associated with reduced user costs for each...

  13. Transport service

    CERN Document Server

    C. Cerruti / FI

    2006-01-01

    A large number of pallet-crates (panières grillagées), which are used for transporting equipment and for removals, have been dispatched to various locations around the CERN site. We kindly request all users who may have such crates in their possession and no longer need them to make the necessary arrangements (EDH request to the Transport Group) to return them to Building 133, as we currently have no more in stock. Claude CERRUTI / FI-PI

  14. Nitrate transport and signalling.

    Science.gov (United States)

    Miller, Anthony J; Fan, Xiaorong; Orsel, Mathilde; Smith, Susan J; Wells, Darren M

    2007-01-01

    Physiological measurements of nitrate (NO(3)(-)) uptake by roots have defined two systems of high and low affinity uptake. In Arabidopsis, genes encoding both of these two uptake systems have been identified. Most is known about the high affinity transport system (HATS) and its regulation and yet measurements of soil NO(3)(-) show that it is more often available in the low affinity range above 1 mM concentration. Several different regulatory mechanisms have been identified for AtNRT2.1, one of the membrane transporters encoding HATS; these include feedback regulation of expression, a second component protein requirement for membrane targeting and phosphorylation, possibly leading to degradation of the protein. These various changes in the protein may be important for a second function in sensing NO(3)(-) availability at the surface of the root. Another transporter protein, AtNRT1.1 also has a role in NO(3)(-) sensing that, like AtNRT2.1, is independent of their transport function. From the range of concentrations present in the soil it is proposed that the NO(3)(-)-inducible part of HATS functions chiefly as a sensor for root NO(3)(-) availability. Two other key NO(3)(-) transport steps for efficient nitrogen use by crops, efflux across membranes and vacuolar storage and remobilization, are discussed. Genes encoding vacuolar transporters have been isolated and these are important for manipulating storage pools in crops, but the efflux system is yet to be identified. Consideration is given to how well our molecular and physiological knowledge can be integrated as well to some key questions and opportunities for the future.

  15. [Recommendations for neonatal transport].

    Science.gov (United States)

    Moreno Hernando, J; Thió Lluch, M; Salguero García, E; Rite Gracia, S; Fernández Lorenzo, J R; Echaniz Urcelay, I; Botet Mussons, F; Herranz Carrillo, G; Sánchez Luna, M

    2013-08-01

    During pregnancy, it is not always possible to identify maternal or foetal risk factors. Infants requiring specialised medical care are not always born in centres providing intensive care and will need to be transferred to a referral centre where intensive care can be provided. Therefore Neonatal Transport needs to be considered as part of the organisation of perinatal health care. The aim of Neonatal Transport is to transfer a newborn infant requiring intensive care to a centre where specialised resources and experience can be provided for the appropriate assessment and continuing treatment of a sick newborn infant. Intrauterine transfer is the ideal mode of transport when the birth of an infant with risk factors is diagnosed. Unfortunately, not all problems can be detected in advance with enough time to safely transfer a pregnant woman. Around 30- 50% of risk factors will be diagnosed during labour or soon after birth. Therefore, it is important to have the knowledge and resources to resuscitate and stabilise a newborn infant, as well as a specialised neonatal transport system. With this specialised transport it is possible to transfer newly born infants with the same level of care that they would receive if they had been born in a referral hospital, without increasing their risks or affecting the wellbeing of the newborn. The Standards Committee of the Spanish Society of Neonatology reviewed and updated recommendations for intrauterine transport and indications for neonatal transfer. They also reviewed organisational and logistic factors involved with performing neonatal transport. The Committee review included the type of personnel who should be involved; communication between referral and receiving hospitals; documentation; mode of transport; equipment to stabilise newly born infants; management during transfer, and admission at the referral hospital.

  16. Technology Roadmaps: Biofuels for Transport

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    Biofuels could provide up to 27% of total transport fuel worldwide by 2050. The use of transport fuels from biomass, when produced sustainably, can help cut petroleum use and reduce CO2 emissions in the transport sector, especially in heavy transport. Sustainable biofuel technologies, in particular advanced biofuels, will play an important role in achieving this roadmap vision. The roadmap describes the steps necessary to realise this ambitious biofuels target; identifies key actions by different stakeholders, and the role for government policy to adopt measures needed to ensure the sustainable expansion of both conventional and advanced biofuel production.

  17. Charge transport in polymeric transistors

    Directory of Open Access Journals (Sweden)

    Alberto Salleo

    2007-03-01

    Full Text Available Polymeric semiconductors have attracted much attention because of their possible use as active materials in printed electronics. Thin-film transistors (TFTs are a convenient tool for studying charge-transport physics in conjugated polymers. Two families of materials are reviewed here: fluorene copolymers and polythiophenes. Because charge transport is highly anisotropic in molecular conductors, the electrical properties of conjugated polymers are strongly dependent on microstructure. Molecular weight, polydispersity, and regioregularity all affect morphology and charge-transport in these materials. Charge transport models based on microstructure are instrumental in identifying the electrical bottlenecks in these materials.

  18. TRANSPORT OUTSOURCING AND TRANSPORT COLLABORATION RELATIONSHIP - THE RISK HEDGING PERSPECTIVE

    Directory of Open Access Journals (Sweden)

    Đurđica M. Stojanović

    2015-04-01

    Full Text Available Although transport outsourcing decision-making and collaborative transport management (CTM have been “hot topics” for years, their links are still not thoroughly explored. The purpose of this paper is to contribute to a better understanding of the relationship between them. In particular, we focus on the conflicting and complementary features of these concepts with regard to their capability to hedge against transport outsourcing-related risks. Transport outsourcing is often a tool for transferring part of the demand risks from the primary parties in supply chains to transport service providers. However, new relationships introduce some new risks - outsourcing contract risks. It is important to identify, estimate and compare such kinds of risks. Transport collaboration may decrease both the demand risks and the outsourcing contract risks, although the relationship with the latter is more complex. It is used an exploratory research based on a combination of a literature review and empirical examples.

  19. EBS Radionuclide Transport Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    J.D. Schreiber

    2005-08-25

    The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in ''Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration'' (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment for the license application (TSPA-LA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA-LA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport

  20. Analysing Java Identifier Names

    OpenAIRE

    Butler, Simon

    2016-01-01

    Identifier names are the principal means of recording and communicating ideas in source code and are a significant source of information for software developers and maintainers, and the tools that support their work. This research aims to increase understanding of identifier name content types - words, abbreviations, etc. - and phrasal structures - noun phrases, verb phrases, etc. - by improving techniques for the analysis of identifier names. The techniques and knowledge acquired can be appl...

  1. Identifiability in stochastic models

    CERN Document Server

    1992-01-01

    The problem of identifiability is basic to all statistical methods and data analysis, occurring in such diverse areas as Reliability Theory, Survival Analysis, and Econometrics, where stochastic modeling is widely used. Mathematics dealing with identifiability per se is closely related to the so-called branch of ""characterization problems"" in Probability Theory. This book brings together relevant material on identifiability as it occurs in these diverse fields.

  2. Confined wetting of FoCa clay powder/pellet mixtures: Experimentation and numerical modeling

    Science.gov (United States)

    Maugis, Pascal; Imbert, Christophe

    Potential geological nuclear waste disposals must be properly sealed to prevent contamination of the biosphere by radionuclides. In the framework of the RESEAL project, the performance of a bentonite shaft seal is currently studied at Mol (Belgium). This paper focuses on the hydro-mechanical physical behavior of centimetric, unsaturated samples of the backfilling material - a mixture of FoCa-clay powder and pellets - during oedometer tests. The hydro-mechanical response of the samples is observed experimentally, and then compared to numerical simulations performed by our Cast3M Finite Element code. The generalized Darcy’s law and the Barcelona Basic Model mechanical model formed the physical basis of the numerical model and the interpretation. They are widely used in engineered barriers modeling. Vertical swelling pressure and water intake were measured throughout the test. Although water income presents a monotonous increase, the swelling pressure evolution is marked by a peak, and then a local minimum before increasing again to an asymptotic value. This unexpected behavior is explained by yielding rather than by heterogeneity. It is satisfactorily reproduced by the model after parameter calibration. Several samples with different heights ranging from 5 to 12 cm show the same hydro-mechanical response, apart from a dilatation of the time scale. The interest of the characterization of centimetric samples to predicting the efficiency of a metric sealing is discussed.

  3. Travel and transport

    DEFF Research Database (Denmark)

    Bill, Jan; Roesdahl, Else

    2007-01-01

    On the interrelationship between travel, transport and society; on land transport, sea and river transport, and on winter transport;  on the related technologies and their developments......On the interrelationship between travel, transport and society; on land transport, sea and river transport, and on winter transport;  on the related technologies and their developments...

  4. Optimal transport

    CERN Document Server

    Eckmann, B

    2008-01-01

    At the close of the 1980s, the independent contributions of Yann Brenier, Mike Cullen and John Mather launched a revolution in the venerable field of optimal transport founded by G Monge in the 18th century, which has made breathtaking forays into various other domains of mathematics ever since. The author presents a broad overview of this area.

  5. Transport modeling

    Institute of Scientific and Technical Information of China (English)

    R.E. Waltz

    2007-01-01

    @@ There has been remarkable progress during the past decade in understanding and modeling turbulent transport in tokamaks. With some exceptions the progress is derived from the huge increases in computational power and the ability to simulate tokamak turbulence with ever more fundamental and physically realistic dynamical equations, e.g.

  6. Transport fuel

    DEFF Research Database (Denmark)

    Ronsse, Frederik; Jørgensen, Henning; Schüßler, Ingmar

    2014-01-01

    Worldwide, the use of transport fuel derived from biomass increased four-fold between 2003 and 2012. Mainly based on food resources, these conventional biofuels did not achieve the expected emission savings and contributed to higher prices for food commod - ities, especially maize and oilseeds...

  7. Anomalous transport

    Science.gov (United States)

    Cheverry, Christophe

    2017-02-01

    This article is concerned with the relativistic Vlasov equation, for collisionless axisymmetric plasmas immersed in a strong magnetic field, like in tokamaks. It provides a consistent kinetic treatment of the microscopic particle phase-space dynamics. It shows that the turbulent transport can be completely described through WKB expansions.

  8. Transport system

    NARCIS (Netherlands)

    Drenth, K.F.

    1999-01-01

    The transport system comprises at least one road surface (2) and at least one vehicle (4) on wheels (6). The road surface (2) has a substantially bowl-shaped cross section and the vehicle (4) is designed so that the wheels (6) run directly on the road surface (2) while the road surface (2) acts as a

  9. Perturbative Transport Studies in Fusion Plasmas

    NARCIS (Netherlands)

    Cardozo, N. J. L.

    1995-01-01

    Studies of transport in fusion plasmas using perturbations of an equilibrium state reviewed. Essential differences between steady-state and perturbative transport studies are pointed out. Important transport issues that can be addressed with perturbative experiments are identified as: (i) Are the tr

  10. spatially identifying vulnerable areas

    African Journals Online (AJOL)

    System (SMDSS) to identify factors that make forest and game reserves vulnerable .... involve the creation of a Digital Elevation Model (DEM), Slope Settlement and ... Feature). Spatial. Analyst Tool. (Slope). Buffer Tool. Buffer Tool. Buffer Tool.

  11. Transport processes of the legume symbiosome membrane

    Directory of Open Access Journals (Sweden)

    Victoria C Clarke

    2014-12-01

    Full Text Available The symbiosome membrane (SM is a physical barrier between the host plant and nitrogen-fixing bacteria in the legume-rhizobium symbiosis, and represents a regulated interface for the movement of solutes between the symbionts that is under plant control. The primary nutrient exchange across the SM is the transport of a carbon energy source from plant to bacteroid in exchange for fixed nitrogen. At a biochemical level two channels have been implicated in movement of fixed nitrogen across the SM and a uniporter that transports monovalent dicarboxylate ions has been characterized that would transport fixed carbon. The aquaporin NOD26 may provide a channel for ammonia, but the genes encoding the other transporters have not been identified. Transport of several other solutes, including calcium and potassium, have been demonstrated in isolated symbiosomes, and genes encoding transport systems for the movement of iron, nitrate, sulfate and zinc in nodules have been identified. However, definitively matching transport activities with these genes has proved difficult and many further transport processes are expected on the SM to facilitate the movement of nutrients between the symbionts. Recently, work detailing the SM proteome in soybean has been completed, contributing significantly to the database of known SM proteins. This represents a valuable resource for the identification of transporter protein candidates, some of which may correspond to transport processes previously described, or to novel transport systems in the symbiosis. Putative transporters identified from the proteome include homologues of transporters of sulfate, calcium, peptides and various metal ions. Here we review current knowledge of transport processes of the SM and discuss the requirements for additional transport routes of other nutrients exchanged in the symbiosis, with a focus on transport systems identified through the soybean SM proteome.

  12. Copper transport.

    Science.gov (United States)

    Linder, M C; Wooten, L; Cerveza, P; Cotton, S; Shulze, R; Lomeli, N

    1998-05-01

    In adult humans, the net absorption of dietary copper is approximately 1 mg/d. Dietary copper joins some 4-5 mg of endogenous copper flowing into the gastrointestinal tract through various digestive juices. Most of this copper returns to the circulation and to the tissues (including liver) that formed them. Much lower amounts of copper flow into and out of other major parts of the body (including heart, skeletal muscle, and brain). Newly absorbed copper is transported to body tissues in two phases, borne primarily by plasma protein carriers (albumin, transcuprein, and ceruloplasmin). In the first phase, copper goes from the intestine to the liver and kidney; in the second phase, copper usually goes from the liver (and perhaps also the kidney) to other organs. Ceruloplasmin plays a role in this second phase. Alternatively, liver copper can also exit via the bile, and in a form that is less easily reabsorbed. Copper is also present in and transported by other body fluids, including those bathing the brain and central nervous system and surrounding the fetus in the amniotic sac. Ceruloplasmin is present in these fluids and may also be involved in copper transport there. The concentrations of copper and ceruloplasmin in milk vary with lactational stage. Parallel changes occur in ceruloplasmin messenger RNA expression in the mammary gland (as determined in pigs). Copper in milk ceruloplasmin appears to be particularly available for absorption, at least in rats.

  13. Visually Exploring Transportation Schedules.

    Science.gov (United States)

    Palomo, Cesar; Guo, Zhan; Silva, Cláudio T; Freire, Juliana

    2016-01-01

    Public transportation schedules are designed by agencies to optimize service quality under multiple constraints. However, real service usually deviates from the plan. Therefore, transportation analysts need to identify, compare and explain both eventual and systemic performance issues that must be addressed so that better timetables can be created. The purely statistical tools commonly used by analysts pose many difficulties due to the large number of attributes at trip- and station-level for planned and real service. Also challenging is the need for models at multiple scales to search for patterns at different times and stations, since analysts do not know exactly where or when relevant patterns might emerge and need to compute statistical summaries for multiple attributes at different granularities. To aid in this analysis, we worked in close collaboration with a transportation expert to design TR-EX, a visual exploration tool developed to identify, inspect and compare spatio-temporal patterns for planned and real transportation service. TR-EX combines two new visual encodings inspired by Marey's Train Schedule: Trips Explorer for trip-level analysis of frequency, deviation and speed; and Stops Explorer for station-level study of delay, wait time, reliability and performance deficiencies such as bunching. To tackle overplotting and to provide a robust representation for a large numbers of trips and stops at multiple scales, the system supports variable kernel bandwidths to achieve the level of detail required by users for different tasks. We justify our design decisions based on specific analysis needs of transportation analysts. We provide anecdotal evidence of the efficacy of TR-EX through a series of case studies that explore NYC subway service, which illustrate how TR-EX can be used to confirm hypotheses and derive new insights through visual exploration.

  14. Identifying Knowledge and Communication

    Directory of Open Access Journals (Sweden)

    Eduardo Coutinho Lourenço de Lima

    2006-12-01

    Full Text Available In this paper, I discuss how the principle of identifying knowledge which Strawson advances in ‘Singular Terms and Predication’ (1961, and in ‘Identifying Reference and Truth-Values’ (1964 turns out to constrain communication. The principle states that a speaker’s use of a referring expression should invoke identifying knowledge on the part of the hearer, if the hearer is to understand what the speaker is saying, and also that, in so referring, speakers are attentive to hearers’ epistemic states. In contrasting it with Russell’s Principle (Evans 1982, as well as with the principle of identifying descriptions (Donnellan 1970, I try to show that the principle of identifying knowledge, ultimately a condition for understanding, makes sense only in a situation of conversation. This allows me to conclude that the cooperative feature of communication (Grice 1975 and reference (Clark andWilkes-Gibbs 1986 holds also at the understanding level. Finally, I discuss where Strawson’s views seem to be unsatisfactory, and suggest how they might be improved.

  15. Urban freight transportation : Challenges, failure, and successes

    NARCIS (Netherlands)

    Kant, Goos; Quak, H.; Peeters, Rene; Woensel van, T.; Zijm, H.; Klumpp, M.; Clausen, U.; Ten Hompel, M.

    2016-01-01

    In this paper, we present the challenges, failures and successes on urban freight transportation. We first identify the various involved stakeholders with their interests. Then we evaluate a large number of urban freight transport initiatives and identify lessons learned, which are distinguished in

  16. Urban freight transportation: challenges, failures and successes

    NARCIS (Netherlands)

    Kant, G.; Quak, H.J.; Peeters, R.; Woensel, T. van

    2015-01-01

    In this paper, we present the challenges, failures and successes on urban freight transportation. We first identify the various involved stakeholders with their interests. Then we evaluate a large number of urban freight transport initiatives and identify lessons learned, which are distinguished in

  17. Global Microbial Identifier

    DEFF Research Database (Denmark)

    Wielinga, Peter; Hendriksen, Rene S.; Aarestrup, Frank Møller

    2017-01-01

    microbial identifier (GMI) initiative, aims to build a database of whole microbial genome sequencing data linked to relevant metadata, which can be used to identify microorganisms, their communities and the diseases they cause. It would be a platform for storing whole genome sequencing (WGS) data......) will likely also enable a much better understanding of the pathogenesis of the infection and the molecular basis of the host response to infection. But the full potential of these advances will only transpire if the data in this area become transferable and thereby comparable, preferably in open......-source systems. There is therefore an obvious need to develop a global system of whole microbial genome databases to aggregate, share, mine and use microbiological genomic data, to address global public health and clinical challenges, and most importantly to identify and diagnose infectious diseases. The global...

  18. Identifying learning styles.

    Science.gov (United States)

    Hughes, Grace

    2016-12-14

    What was the nature of the CPD activity, practice-related feedback and/or event and/or experience in your practice? The article explored different learning styles and outlined some of the models that can be used to identify them. It discussed the limitations of these models, indicating that although they can be helpful in identifying a student's preferred learning style, this is not 'fixed' and might change over time. Learning is also influenced by other factors, such as culture and age.

  19. Gas transport in porous media

    CERN Document Server

    Ho, Clifford K

    2006-01-01

    This book presents a compilation of state-of-the art studies on gas and vapor transport processes in porous and fractured media. A broad set of models and processes are presented, including advection/diffusion, the Dusty Gas Model, enhanced vapor diffusion, phase change, coupled processes, solid/vapor sorption, and vapor-pressure lowering. Numerous applications are also presented that illustrate these processes and models in current problems facing the scientific community. This book fills a gap in the general area of transport in porous and fractured media; an area that has historically been dominated by studies of liquid-phase flow and transport. This book identifies gas and vapor transport processes that may be important or dominant in various applications, and it exploits recent advances in computational modeling and experimental methods to present studies that distinguish the relative importance of various mechanisms of transport in complex media.

  20. Benchmarking and Sustainable Transport Policy

    DEFF Research Database (Denmark)

    Gudmundsson, Henrik; Wyatt, Andrew; Gordon, Lucy

    2004-01-01

    is generally not advised. Several other ways in which benchmarking and policy can support one another are identified in the analysis. This leads to a range of recommended initiatives to exploit the benefits of benchmarking in transport while avoiding some of the lurking pitfalls and dead ends......Order to learn from the best. In 2000 the European Commission initiated research to explore benchmarking as a tool to promote policies for ‘sustainable transport’. This paper reports findings and recommendations on how to address this challenge. The findings suggest that benchmarking is a valuable...... tool that may indeed help to move forward the transport policy agenda. However, there are major conditions and limitations. First of all it is not always so straightforward to delimit, measure and compare transport services in order to establish a clear benchmark. Secondly ‘sustainable transport...

  1. Transporter Classification Database (TCDB)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Transporter Classification Database details a comprehensive classification system for membrane transport proteins known as the Transporter Classification (TC)...

  2. Identifying and Managing Risk.

    Science.gov (United States)

    Abraham, Janice M.

    1999-01-01

    The role of the college or university chief financial officer in institutional risk management is (1) to identify risk (physical, casualty, fiscal, business, reputational, workplace safety, legal liability, employment practices, general liability), (2) to develop a campus plan to reduce and control risk, (3) to transfer risk, and (4) to track and…

  3. Identifying Nursing's Future Leaders.

    Science.gov (United States)

    Gunning, Carolyn S.; Hawken, Patty L.

    1990-01-01

    A study determined that encouraging and supporting students in professional activities while they were still in school would lead those students to participate in professional nursing organizations after they graduated. Organized nursing needs to identify the factors that influence nurses to join organizations and concentrate on these factors to…

  4. Draft Transportation Institutional Plan

    Energy Technology Data Exchange (ETDEWEB)

    1985-09-01

    The Department of Energy recognizes that the success of its program to develop and implement a national system for nuclear waste management and disposal depends on broad-based public understanding and acceptance. While each program element has its particular sensitivity, the transportation of the waste may potentially affect the greatest number of people, and accordingly is highly visible and potentially issue-laden. Therefore, the Office of Civilian Radioactive Waste Management has developed this Transportation Institutional Plan to lay the foundation for interaction among all interested parties for the purpose of identifying and resolving issues of concern. The Plan is divided into four chapters. Chapter 1 provides bachground information and discusses the purpose of the Plan and the policy guidance for establishing the transportation system. Chapter 2 introduces the major participants who must interact to build both the system itself and the consensus philosophy that is essential for effective operations. Chapter 3 suggests mechanisms for interaction that will ensure wide participation in program planning and implementation. And, finally, Chapter 4 suggests a framework for managing and resolving the issues related to development and operation of the transportation system. A list of acronyms and a glossary are included for the reader's convenience. The Plan's appendices provide supporting material to assist the reader in understanding the roles of the involved institutions. 4 figs., 1 tab.

  5. Panel 4 - applications to transportation

    Energy Technology Data Exchange (ETDEWEB)

    Nichols, F. [Argonne National Lab., IL (United States); Au, J. [Sundstrand Aerospace, Rockford, IL (United States); Bhattacharya, R. [Universal Energy Systems, Inc., Dayton, OH (United States); Bhushan, B. [Ohio State Univ., Columbus (United States); Blunier, D. [Caterpillar, Inc., Peoria, IL (United States); Boardman, B. [Deere & Co., Moline, IL (United States); Brombolich, L. [Compu-Tec Engineering, Chesterfield, MO (United States); Davidson, J. [Vanderbilt Univ., Nashville, TN (United States); Graham, M. [Northwestern Univ., Evanston, IL (United States); Hakim, N. [Detroit Diesel Corp., MI (United States); Harris, K. [Dubbeldee Harris Diamond Corp., Mt. Arlington, NJ (United States); Hay, R. [Norton Diamond Film, Northboro, MA (United States); Herk, L. [Southwest Research Inst., Southfield, MI (United States); Hojnacki, H.; Rourk, D. [Intelligent Structures Incorporated, Canton, MI (United States); Kamo, R. [Adiabatics, Inc., Columbus, IN (United States); Nieman, B. [Allied-Signal Inc., Des Plaines, IL (United States); O`Neill, D. [3M, St. Paul, MN (United States); Peterson, M.B. [Wear Sciences, Arnold, MD (United States); Pfaffenberger, G. [Allison Gas Turbine, Indianapolis, IN (United States); Pryor, R.W. [Wayne State Univ., Detroit, MI (United States); Russell, J. [Superconductivity Publications, Inc., Somerset, NJ (United States); Syniuta, W. [Advanced Mechanical Technology, Inc., Newton, MA (United States); Tamor, M. [Ford Motor Co., Dearborn, MI (United States); Vojnovich, T. [Dept. of Energy, Washington, DC (United States); Yarbrough, W. [Pennsylvania State Univ., University Park (United States); Yust, C.S. [Oak Ridge National Lab., TN (United States)

    1993-01-01

    The aim of this group was to compile a listing of current and anticipated future problem areas in the transportation industry where the properties of diamond and DLC films make them especially attractive and where the panel could strongly endorse the establishment of DOE/Transportation Industry cooperative research efforts. This section identifies the problem areas for possible applications of diamond/DLC technology and presents indications of current approaches to these problems.

  6. 49 CFR 192.905 - How does an operator identify a high consequence area?

    Science.gov (United States)

    2010-10-01

    ... SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Gas... 49 Transportation 3 2010-10-01 2010-10-01 false How does an operator identify a high consequence area? 192.905 Section 192.905 Transportation Other Regulations Relating to Transportation (Continued...

  7. Mobile Transporter

    Science.gov (United States)

    2001-01-01

    The Space Shuttle Atlantis, STS-110 mission, deployed this railcar, called the Mobile Transporter, and an initial 43-foot section of track, the S0 (S-zero) truss, preparing the International Space Station (ISS) for future spacewalks. The first railroad in space, the Mobile Transporter will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The 27,000-pound S0 truss is the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002. STS-110's Extravehicular Activity (EVA) marked the first use of the Station's robotic arm to maneuver spacewalkers around the Station.

  8. Cycling in multimodal transport behaviours: Exploring modality styles in the Danish population

    DEFF Research Database (Denmark)

    Olafsson, Anton Stahl; Nielsen, Thomas Alexander Sick; Carstensen, Trine Agervig

    2016-01-01

    or 'modality styles' are identified: 'education transport'; 'public-based transport'; 'limited transport'; 'bicycle-based transport'; and 'car-based transport'. Travel behaviour is predominantly multimodal with few unimodal car-drivers being identified. Substantial cycling takes place in all modality styles...

  9. Identifying national freshwater ecosystem priority areas

    CSIR Research Space (South Africa)

    Nel, JL

    2012-10-01

    Full Text Available guided selection of wetland clusters where choices existed. 4. Representation free- flowing rivers Conserves representative coarse-scale processes such as natural flow regimes, erosion and sediment transport. There are very few free-flowing rivers...: jnel@csir.co.za ? www.csir.co.za INTRODUCTION ? In this project, we identified which rivers and wetlands in South Africa are most important to be maintained in, or restored to, a good ecological condition. ? The resulting maps feed seamlessly...

  10. Ballistic Energy Transport in Oligomers.

    Science.gov (United States)

    Rubtsova, Natalia I; Qasim, Layla N; Kurnosov, Arkady A; Burin, Alexander L; Rubtsov, Igor V

    2015-09-15

    . Interestingly, the transport speeds via these chains were different. Moreover, the transport speed was found to be dependent on the vibrational mode initiating the transport. For the difference in the transport speeds to be explained, the chain bands involved in the wavepacket formation were analyzed, and specific optical bands of the chain were identified as the energy transporters. For example, the transport initiated in alkanes by the stretching mode of the azido end group (2100 cm(-1)) occurs predominantly via the CH2 twisting and wagging chain bands, but the transport initiated by the C=O stretching modes of the carboxylic acid or succinimide ester end groups occurs via C-C stretching and CH2 rocking bands of the alkane chain. Direct formation of the wavepacket within the CH2 twisting and wagging chain bands occurs when the transport is initiated by the N═N stretching mode (1270 cm-1) of the azido end-group. The transport via optical chain bands in oligomers involves rather large vibrational quanta (700-1400 cm(-1)), resulting in efficient energy delivery to substantial distances. Achieved quantitative description of various energy transport steps in oligomers, including the specific contributions of different chain bands, can result in a better understanding of the transport steps in nanocomposite materials, including SAM junctions, and lead towards designing systems for molecular electronics with a controllable energy transport speed.

  11. Random Cell Identifiers Assignment

    Directory of Open Access Journals (Sweden)

    Robert Bestak

    2012-01-01

    Full Text Available Despite integration of advanced functions that enable Femto Access Points (FAPs to be deployed in a plug-and-play manner, the femtocell concept still cause several opened issues to be resolved. One of them represents an assignment of Physical Cell Identifiers (PCIs to FAPs. This paper analyses a random based assignment algorithm in LTE systems operating in diverse femtocell scenarios. The performance of the algorithm is evaluated by comparing the number of confusions for various femtocell densities, PCI ranges and knowledge of vicinity. Simulation results show that better knowledge of vicinity can significantly reduce the number of confusions events.

  12. Functional Analysis of Arabidopsis Sucrose Transporters

    Energy Technology Data Exchange (ETDEWEB)

    John M. Ward

    2009-03-31

    Sucrose is the main photosynthetic product that is transported in the vasculature of plants. The long-distance transport of carbohydrates is required to support the growth and development of net-importing (sink) tissues such as fruit, seeds and roots. This project is focused on understanding the transport mechanism sucrose transporters (SUTs). These are proton-coupled sucrose uptake transporters (membrane proteins) that are required for transport of sucrose in the vasculature and uptake into sink tissues. The accomplishments of this project included: 1) the first analysis of substrate specificity for any SUT. This was accomplished using electrophysiology to analyze AtSUC2, a sucrose transporter from companion cells in Arabidopsis. 2) the first analysis of the transport activity for a monocot SUT. The transport kinetics and substrate specificity of HvSUT1 from barley were studied. 3) the first analysis of a sucrose transporter from sugarcane. and 4) the first analysis of transport activity of a sugar alcohol transporter homolog from plants, AtPLT5. During this period four primary research papers, funded directly by the project, were published in refereed journals. The characterization of several sucrose transporters was essential for the current effort in the analysis of structure/function for this gene family. In particular, the demonstration of strong differences in substrate specificity between type I and II SUTs was important to identify targets for site-directed mutagenesis.

  13. Robotic transportation.

    Science.gov (United States)

    Lob, W S

    1990-09-01

    Mobile robots perform fetch-and-carry tasks autonomously. An intelligent, sensor-equipped mobile robot does not require dedicated pathways or extensive facility modification. In the hospital, mobile robots can be used to carry specimens, pharmaceuticals, meals, etc. between supply centers, patient areas, and laboratories. The HelpMate (Transitions Research Corp.) mobile robot was developed specifically for hospital environments. To reach a desired destination, Help-Mate navigates with an on-board computer that continuously polls a suite of sensors, matches the sensor data against a pre-programmed map of the environment, and issues drive commands and path corrections. A sender operates the robot with a user-friendly menu that prompts for payload insertion and desired destination(s). Upon arrival at its selected destination, the robot prompts the recipient for a security code or physical key and awaits acknowledgement of payload removal. In the future, the integration of HelpMate with robot manipulators, test equipment, and central institutional information systems will open new applications in more localized areas and should help overcome difficulties in filling transport staff positions.

  14. Chemical transport reactions

    CERN Document Server

    Schäfer, Harald

    2013-01-01

    Chemical Transport Reactions focuses on the processes and reactions involved in the transport of solid or liquid substances to form vapor phase reaction products. The publication first offers information on experimental and theoretical principles and the transport of solid substances and its special applications. Discussions focus on calculation of the transport effect of heterogeneous equilibria for a gas motion between equilibrium spaces; transport effect and the thermodynamic quantities of the transport reaction; separation and purification of substances by means of material transport; and

  15. Surety applications in transportation

    Energy Technology Data Exchange (ETDEWEB)

    Matalucci, R.V.; Miyoshi, D.S.

    1998-01-01

    Infrastructure surety can make a valuable contribution to the transportation engineering industry. The lessons learned at Sandia National Laboratories in developing surety principles and technologies for the nuclear weapons complex and the nuclear power industry hold direct applications to the safety, security, and reliability of the critical infrastructure. This presentation introduces the concepts of infrastructure surety, including identification of the normal, abnormal, and malevolent threats to the transportation infrastructure. National problems are identified and examples of failures and successes in response to environmental loads and other structural and systemic vulnerabilities are presented. The infrastructure surety principles developed at Sandia National Laboratories are described. Currently available technologies including (a) three-dimensional computer-assisted drawing packages interactively combined with virtual reality systems, (b) the complex calculational and computational modeling and code-coupling capabilities associated with the new generation of supercomputers, and (c) risk-management methodologies with application to solving the national problems associated with threats to the critical transportation infrastructure are discussed.

  16. EBS Radionuclide Transport Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    R. Schreiner

    2001-06-27

    The purpose of this work is to develop the Engineered Barrier System (EBS) radionuclide transport abstraction model, as directed by a written development plan (CRWMS M&O 1999a). This abstraction is the conceptual model that will be used to determine the rate of release of radionuclides from the EBS to the unsaturated zone (UZ) in the total system performance assessment-license application (TSPA-LA). In particular, this model will be used to quantify the time-dependent radionuclide releases from a failed waste package (WP) and their subsequent transport through the EBS to the emplacement drift wall/UZ interface. The development of this conceptual model will allow Performance Assessment Operations (PAO) and its Engineered Barrier Performance Department to provide a more detailed and complete EBS flow and transport abstraction. The results from this conceptual model will allow PA0 to address portions of the key technical issues (KTIs) presented in three NRC Issue Resolution Status Reports (IRSRs): (1) the Evolution of the Near-Field Environment (ENFE), Revision 2 (NRC 1999a), (2) the Container Life and Source Term (CLST), Revision 2 (NRC 1999b), and (3) the Thermal Effects on Flow (TEF), Revision 1 (NRC 1998). The conceptual model for flow and transport in the EBS will be referred to as the ''EBS RT Abstraction'' in this analysis/modeling report (AMR). The scope of this abstraction and report is limited to flow and transport processes. More specifically, this AMR does not discuss elements of the TSPA-SR and TSPA-LA that relate to the EBS but are discussed in other AMRs. These elements include corrosion processes, radionuclide solubility limits, waste form dissolution rates and concentrations of colloidal particles that are generally represented as boundary conditions or input parameters for the EBS RT Abstraction. In effect, this AMR provides the algorithms for transporting radionuclides using the flow geometry and radionuclide concentrations

  17. Transporting particulate material

    Science.gov (United States)

    Aldred, Derek Leslie [North Hollywood, CA; Rader, Jeffrey A [North Hollywood, CA; Saunders, Timothy W [North Hollywood, CA

    2011-08-30

    A material transporting system comprises a material transporting apparatus (100) including a material transporting apparatus hopper structure (200, 202), which comprises at least one rotary transporting apparatus; a stationary hub structure (900) constraining and assisting the at least one rotary transporting apparatus; an outlet duct configuration (700) configured to permit material to exit therefrom and comprising at least one diverging portion (702, 702'); an outlet abutment configuration (800) configured to direct material to the outlet duct configuration; an outlet valve assembly from the material transporting system venting the material transporting system; and a moving wall configuration in the material transporting apparatus capable of assisting the material transporting apparatus in transporting material in the material transporting system. Material can be moved from the material transporting apparatus hopper structure to the outlet duct configuration through the at least one rotary transporting apparatus, the outlet abutment configuration, and the outlet valve assembly.

  18. experimental investigation of sand minimum transport velocity in ...

    African Journals Online (AJOL)

    user

    minimum transport velocity models in pipelines, the analytical and empirical methods. Because of the ... identified two niche areas of research such as sand transport in .... operational conditions the limit deposit velocity passes through a ...

  19. Plant Transporter Identification

    DEFF Research Database (Denmark)

    Larsen, Bo

    Membrane transport proteins (transporters) play a critical role for numerous biological processes, by controlling the movements of ions and molecules in and out of cells. In plants, transporters thus function as gatekeepers between the plant and its surrounding environment and between organs......, tissues, cells and intracellular compartments. Since plants are highly compartmentalized organisms with complex transportation infrastructures, they consequently have many transporters. However, the vast majority of predicted transporters have not yet been experimentally verified to have transport...... activity. This project contains a review of the implemented methods, which have led to plant transporter identification, and present our progress on creating a high-throughput functional genomics transporter identification platform....

  20. Plant Transporter Identification

    DEFF Research Database (Denmark)

    Larsen, Bo

    Membrane transport proteins (transporters) play a critical role for numerous biological processes, by controlling the movements of ions and molecules in and out of cells. In plants, transporters thus function as gatekeepers between the plant and its surrounding environment and between organs......, tissues, cells and intracellular compartments. Since plants are highly compartmentalized organisms with complex transportation infrastructures, they consequently have many transporters. However, the vast majority of predicted transporters have not yet been experimentally verified to have transport...... activity. This project contains a review of the implemented methods, which have led to plant transporter identification, and present our progress on creating a high-throughput functional genomics transporter identification platform....

  1. Transport in three-dimensional topological insulators: Theory and experiment

    Science.gov (United States)

    Culcer, Dimitrie

    2012-02-01

    This paper reviews recent theoretical and experimental work on transport due to the surface states of three-dimensional topological insulators. The theoretical focus is on longitudinal transport in the presence of an electric field, including Boltzmann transport, quantum corrections and weak localization, as well as longitudinal and Hall transport in the presence of both electric and magnetic fields and/or magnetizations. Special attention is paid to transport at finite doping, and to the π-Berry phase, which leads to the absence of backscattering, Klein tunneling and half-quantized Hall response. Signatures of surface states in ordinary transport and magnetotransport are identified. The review also covers transport experiments of the past years, tracing its evolution from the initial obscuring of surface transport by bulk transport to the increasing success of experimental work in identifying transport due to the surface states. Current and likely future experimental challenges are given prominence and the present status of the field is assessed.

  2. Thermal transport in fractal systems

    DEFF Research Database (Denmark)

    Kjems, Jørgen

    1992-01-01

    Recent experiments on the thermal transport in systems with partial fractal geometry, silica aerogels, are reviewed. The individual contributions from phonons, fractons and particle modes, respectively, have been identified and can be described by quantitative models consistent with heat capacity...... data. The interpretation in the particle mode regime sheds light on the mechanisms for thermal conductivity in normal vitreous silica....

  3. Transportation and the environment.

    NARCIS (Netherlands)

    Banister, D.; Anderton, K.; Bonilla, D.; Givoni, M.; Schwanen, T.

    2011-01-01

    The growth of CO2-intensive transport, mobility and the impact of transport on the environment are reviewed. The recent global exponential growth in transport is unsustainable and must end unless the transport sector can decarbonize. The paper examines solutions for low-carbon transport systems; the

  4. OTIMIZAÇÃO DE CUSTOS DO TRANSPORTE PÚBLICO URBANO: COMPRAR OU VENDER UM ÔNIBUS USADO?

    Directory of Open Access Journals (Sweden)

    Ana Paula Rodrigues da Costa

    2014-08-01

    Full Text Available Embora a discussão sobre a mobilidade urbana envolva as modalidades de transporte de massa, a maioria das cidades ainda se valem das frotas de ônibus. Esta pesquisa objetiva apresentar um modelo que propõe identificar o momento que poderá ser exercida a opção de vender ou comprar um veículo usado da frota de ônibus do sistema de transporte público urbano, por meio da aplicação da Teoria de Opções Reais (TOR. Pesquisas apontam que quando o veículo é novo os custos de manutenção são baixos, cobrindo basicamente as revisões de rotina e a substituição de componentes, porém depois de certa idade, esses custos vão aumentando. Neste sentido uma dúvida que sempre surge é decidir o momento adequado para adquirir ou se desfazer de um veículo usado. A teoria utilizada neste estudo, a TOR, foca no Modelo Binomial em Tempo Discreto. Metodologicamente, o estudo foi desenvolvido com dados reais de um caso específico de frota de ônibus que serviu de suporte para a construção e teste do modelo proposto e apoiou-se em dados de uma empresa de ônibus tradicional do Espírito Santo. O modelo proposto é validado por meio de exemplo numérico que identifica o momento para a tomada de decisão. No caso em estudo o modelo apresentou o momento da opção a partir do final do segundo ano de uso do ônibus. A metodologia aplicada e os resultados encontrados despertam para a necessidade dos gestores terem informações decorrentes dos dados das frotas e poderem tomar decisões mais seguras, especialmente o momento “ideal” para substituição da frota. Para o poder público, estudos dessa natureza podem gerar subsídios à elaboração de normativos pelas agências reguladoras com vistas ao atendimento pelas concessionárias e de parcerias público-privado.

  5. Activity assay of membrane transport proteins

    Institute of Scientific and Technical Information of China (English)

    Hao Xie

    2008-01-01

    Membrane transport proteins are integral membrane proteins and considered as potential drug targets. Activity assay of transport proteins is essential for developing drugs to target these proteins. Major issues related to activity assessment of transport proteins include availability of transporters,transport activity of transporters, and interactions between ligands and transporters. Researchers need to consider the physiological status of proteins (bound in lipid membranes or purified), availability and specificity of substrates, and the purpose of the activity assay (screening, identifying, or comparing substrates and inhibitors) before choosing appropriate assay strategies and techniques. Transport proteins bound in vesicular membranes can be assayed for transporting substrate across membranes by means of uptake assay or entrance counterflow assay. Alternatively, transport proteins can be assayed for interactions with ligands by using techniques such as isothermal titration calorimetry, nuclear magnetic resonance spectroscopy, or surface plasmon resonance. Other methods and techniques such as fluorometry, scintillation proximity assay, electrophysiological assay, or stopped-flow assay could also be used for activity assay of transport proteins. In this paper the major strategies and techniques for activity assessment of membrane transport proteins are reviewed.

  6. In Vivo Gene Expression Analysis Identifies Genes Required for Enhanced Colonization of the Mouse Urinary Tract by Uropathogenic Escherichia coli Strain CFT073 dsdA▿ †

    Science.gov (United States)

    Haugen, Brian J.; Pellett, Shahaireen; Redford, Peter; Hamilton, Holly L.; Roesch, Paula L.; Welch, Rodney A.

    2007-01-01

    Deletional inactivation of the gene encoding d-serine deaminase, dsdA, in uropathogenic Escherichia coli strain CFT073 results in a hypermotile strain with a hypercolonization phenotype in the bladder and kidneys of mice in a model of urinary tract infection (UTI). The in vivo gene expression profiles of CFT073 and CFT073 dsdA were compared by isolating RNA directly from the urine of mice challenged with each strain individually. Hybridization of cDNAs derived from these samples to CFT073-specific microarrays allowed identification of genes that were up- or down-regulated in the dsdA deletion strain during UTI. Up-regulated genes included the known d-serine-responsive gene dsdX, suggesting in vivo intracellular accumulation of d-serine by CFT073 dsdA. Genes encoding F1C fimbriae, both copies of P fimbriae, hemolysin, OmpF, a dipeptide transporter DppA, a heat shock chaperone IbpB, and clusters of open reading frames with unknown functions were also up-regulated. To determine the role of these genes as well as motility in the hypercolonization phenotype, mutants were constructed in the CFT073 dsdA background and tested in competition against the wild type in the murine model of UTI. Strains with deletions of one or both of the two P fimbrial operons, hlyA, fliC, ibpB, c0468, locus c3566 to c3568, or c2485 to c2490 colonized mouse bladders and kidneys at levels indistinguishable from wild type. CFT073 dsdA c2398 and CFT073 dsdA focA maintained a hypercolonization phenotype. A CFT073 dsdA dppA mutant was attenuated 10- to 50-fold in its colonization ability compared to CFT073. Our results support a role for d-serine catabolism and signaling in global virulence gene regulation of uropathogenic E. coli. PMID:17074858

  7. Urban Transportation: Issue and Solution

    Directory of Open Access Journals (Sweden)

    Haryati Shafii

    2011-10-01

    Full Text Available Generally, quality of life of urban population is heavily dependent on social facilities provided within the environment. One of the most important facilities is transportations. Study on transportation mode in an urban area is especially very important because for almost every individual living in a large and densely populated area, mobility is one of the most crucial issues in everyday life. Enhance mobility, faster journey to work and less pollution from petrol-propelled vehicles can increase the quality of life, which in turn lead to a sustainable urban living. The study present transportation mode usage issues faced by community related to quality of life in an urban area. This study identifies several issues of transportation mode in urban areas and its impact on the quality of life. The study areas are Putrajaya, Kuala Lumpur and Bandar Kajang, Selangor. The methodology used in this research is secondary and primary data. The questionnaires for the survey were distributed from May 2008 to Jun 2008. These researches were conducted on 144 respondents for to evaluate their perception of transportation mode correlated to the quality of life. The collected data were then analyzed using “Statistical Packages for the Social Science” (SPSS. The respondents comprise of 61 males and 84 females from the age group of 18 to 57 years. This study identifies the percentage of public transportation mode usage in urban area, such as buses (16.7%, train (ERL, monorail and commuter-6.4%; which is very low compared to owning personal car (45.8% and motorcycle (25.4%.The result shows owning personal car is the highest (45.8% in three study areas and monorail and taxi are the lowest (1.4%. The Chi Square Test shows that among the mode transportation with traffic jam is quite difference in Kuala Lumpur, Putrajaya and Kajang. Analysis of the Chi Square Test shows the result is 0.000 (two sides to respondent answering “yes” and analysis of Spearman

  8. Road Transport Entrepreneurs and Road Transportation Revolution ...

    African Journals Online (AJOL)

    Toshiba

    An International Multidisciplinary Journal, Ethiopia. Vol. 7 (4), Serial No. ... Nnewi Igbo emerged as pioneer road transport entrepreneurs and charted this novel ..... the cardinal motives for venturing into the transport industry. (Maduewesi ...

  9. Sediment transport along the Goa-north Karnataka Coast, western India

    Digital Repository Service at National Institute of Oceanography (India)

    Kunte, P.D.

    of sediment transport. Although sediment-transport direction is bi-directional, net major sediment transport is southward. The geomorphic study identified possible sediment sources and sinks. Contributions of sources and losses due to sinks are assessed...

  10. Saxton Transportation Operations Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Saxton Transportation Operations Laboratory (Saxton Laboratory) is a state-of-the-art facility for conducting transportation operations research. The laboratory...

  11. Smart Growth and Transportation

    Science.gov (United States)

    Describes the relationship between smart growth and transportation, focusing smart and sustainable street design, transit-oriented development, parking management, sustainable transportation planning, and related resources.

  12. Environmental Development Plan for Transportation Energy Conservation. FY 79 update

    Energy Technology Data Exchange (ETDEWEB)

    Singh, M. K.; Bernard, III, M. J.

    1978-12-15

    This is the first annual update of the Environment Development Plan (EDP) for the DOE Division of Transportation Energy Conservation program. It identifies the ecosystem, resource, physical environment, health, safety, and socioeconomic concerns associated with the division's transportation programs. These programs include the research, development, demonstration and assessment (RDD and A) of seventeen transportation technologies and several strategy and policy development and implementation projects. The transportation technologies projects deal with highway transport including electric vehicles, marine transport and pipeline transport. This EDP presents a research and assessment plan for resolving any potentially adverse environmental concerns stemming from these programs.

  13. Radiation Transport in Dynamic Spacetimes

    Science.gov (United States)

    Schnittman, Jeremy; Baker, John G.; Etienne, Zachariah; Giacomazzo, Bruno; Kelly, Bernard J.

    2017-08-01

    We present early results from a new radiation transport calculation of gas accretion onto merging binary black holes. We use the Monte Carlo radiation transport code Pandurata, now generalized for application to dynamic spacetimes. The time variability of the metric requires careful numerical techniques for solving the geodesic equation, particularly with tabulated spacetime data from numerical relativity codes. Using a new series of general relativistic magneto-hydrodynamical simulations of magnetized flow onto binary black holes, we investigate the possibility for detecting and identifying unique electromagnetic counterparts to gravitational wave events.

  14. Some issues of passenger choice of suburban transport mode

    Directory of Open Access Journals (Sweden)

    Тetyana М. Grigorova

    2015-06-01

    Full Text Available In this article the passenger choice of transport mode for moving to suburban is discussed. The analysis of methods of Transport Management in suburban transportation showed that they did not fully take into account the effect of the transport process parameters on the passenger choice of transport mode for travel. The aim of research is to determine the value of the factors that influence passenger choice of suburban transport. The study was conducted on the basis of passenger survey on the factors affecting the choice of transport mode, and the importance of these factors. Kendall's coefficient of concordance its statistical significance were used to evaluate the consistency of expert opinion. The main factors for choosing the mode of suburban transport are identified. The identified factors can then be used in determining selection patterns of suburban transport mode.

  15. Human organic anion transporter 2 is an entecavir, but not tenofovir, transporter.

    Science.gov (United States)

    Furihata, Tomomi; Morio, Hanae; Zhu, Meiyan; Suzuki, Yuki; Ide, Hideyuki; Tsubota, Akihito; Fu, Zhongguo; Anzai, Naohiko; Chiba, Kan

    2017-02-01

    Entecavir (ETV) and tenofovir (TFV) are essential nucleoside analogues in current hepatitis B virus (HBV) treatments. Since these drugs target the HBV polymerase that is localized within human hepatocytes, determining of their cellular uptake process is an important step in fully understanding their pharmacological actions. However, the human hepatic transporters responsible for their uptake have remained unidentified. Therefore, this study aimed at identifying the primary ETV and TFV uptake transporter(s) in human hepatocytes. In transport assays, temperature-sensitive ETV and TFV uptake by human hepatocytes were observed, and their uptake were strongly inhibited by bromosulfophthalein, which is an inhibitor of organic anion transporters/organic anion transporting polypeptides (OATs/OATPs). Given these results, ETV and TFV uptake activities in several human OAT/OATP expression systems were examined. The results showed that, among the transporters tested, only OAT2 possessed ETV transport activity. On the other hand, none of the transporters showed any TFV uptake activity. To summarize, our results identify that human OAT2 is an ETV transporter, thereby suggesting that it plays an important part in the mechanisms underlying ETV antiviral activity. Furthermore, although the hepatic TFV transporters remain unknown, our results have, at least, clarified that these two anti-HBV drugs have different hepatocyte entry routes. Copyright © 2016 The Japanese Society for the Study of Xenobiotics. Published by Elsevier Ltd. All rights reserved.

  16. Cytoplasmic permeation pathway of neurotransmitter transporters.

    Science.gov (United States)

    Rudnick, Gary

    2011-09-06

    Ion-coupled solute transporters are responsible for transporting nutrients, ions, and signaling molecules across a variety of biological membranes. Recent high-resolution crystal structures of several transporters from protein families that were previously thought to be unrelated show common structural features indicating a large structural family representing transporters from all kingdoms of life. This review describes studies that led to an understanding of the conformational changes required for solute transport in this family. The first structure in this family showed the bacterial amino acid transporter LeuT, which is homologous to neurotransmitter transporters, in an extracellularly oriented conformation with a molecule of leucine occluded at the substrate site. Studies with the mammalian serotonin transporter identified positions, buried in the LeuT structure, that defined a potential pathway leading from the cytoplasm to the substrate binding site. Modeling studies utilized an inverted structural repeat within the LeuT crystal structure to predict the conformation of LeuT in which the cytoplasmic permeation pathway, consisting of positions identified in SERT, was open for diffusion of the substrate to the cytoplasm. From the difference between the model and the crystal structures, a simple "rocking bundle" mechanism was proposed, in which a four-helix bundle changed its orientation with respect to the rest of the protein to close the extracellular pathway and open the cytoplasmic one. Subsequent crystal structures from structurally related proteins provide evidence supporting this model for transport.

  17. Assessment of synfuel transportation to year 2000

    Energy Technology Data Exchange (ETDEWEB)

    Wakamiya, W.; Sebelien, K.B.; Parkhurst, M.A.

    1979-03-01

    This report identifies and discusses potential problems in the transportation of synthetic fuels (synfuels) which if allowed to persist unresolved will hamper the development of these energy materials between now and the year 2000. The emergence of transportation-related problems in shale oil and coal synfuel development will be highly dependent upon their chemical similitude with analagous fossil fuels. Hence, definitive resolution of the question of whether new transportation problems exist is dependent upon clear characterization of the synfuels chemical composition. Hydrogen and methanol represent unique cases since these materials are already in commercial production. The major transportation problem identified with fuel economics based on these materials is related to bulk use. To date, shipment volumes have been relatively small and, in the case of hydrogen, can be accommodated with costly, more specialized packaging. Scale-up for major energy use may introduce a new set of transportation problems.

  18. Emerging insights into florigen transport.

    Science.gov (United States)

    Liu, Lu; Zhu, Yang; Shen, Lisha; Yu, Hao

    2013-10-01

    The photoperiodic control of flowering in plants begins with the perception of seasonal changes in day length and consequential induction of a mobile floral stimulus in leaves. This stimulus called florigen is transported from leaves to the shoot apical meristem to provoke the initiation of floral meristems. Decades of efforts have identified that the proteins encoded by FLOWERING LOCUS T (FT) in Arabidopsis and its orthologs in other plant species are part of the long-sought florigen. Emerging evidence suggests that long-distance transport of FT towards the shoot apical meristem occurs through the phloem in a regulated manner. This review summarizes the recent advances in understanding florigen transport and discusses the proven and potential regulators required for this process.

  19. Water-transporting proteins

    DEFF Research Database (Denmark)

    Zeuthen, Thomas

    2010-01-01

    Transport through lipids and aquaporins is osmotic and entirely driven by the difference in osmotic pressure. Water transport in cotransporters and uniporters is different: Water can be cotransported, energized by coupling to the substrate flux by a mechanism closely associated with protein...... transport. Epithelial water transport is energized by the movements of ions, but how the coupling takes place is uncertain. All epithelia can transport water uphill against an osmotic gradient, which is hard to explain by simple osmosis. Furthermore, genetic removal of aquaporins has not given support...... to osmosis as the exclusive mode of transport. Water cotransport can explain the coupling between ion and water transport, a major fraction of transepithelial water transport and uphill water transport. Aquaporins enhance water transport by utilizing osmotic gradients and cause the osmolarity...

  20. Skyrmions and Hall Transport

    Science.gov (United States)

    Kim, Bom Soo; Shapere, Alfred D.

    2016-09-01

    We derive a generalized set of Ward identities that captures the effects of topological charge on Hall transport. The Ward identities follow from the (2 +1 )-dimensional momentum algebra, which includes a central extension proportional to the topological charge density. In the presence of topological objects like Skyrmions, we observe that the central term leads to a direct relation between the thermal Hall conductivity and the topological charge density. We extend this relation to incorporate the effects of a magnetic field and an electric current. The topological charge density produces a distinct signature in the electric Hall conductivity, which is identified in existing experimental data and yields further novel predictions. For insulating materials with translation invariance, the Hall viscosity can be directly determined from the Skyrmion density and the thermal Hall conductivity to be measured as a function of momentum.

  1. Quantitative Efficiency Evaluation Method for Transportation Networks

    Directory of Open Access Journals (Sweden)

    Jin Qin

    2014-11-01

    Full Text Available An effective evaluation of transportation network efficiency/performance is essential to the establishment of sustainable development in any transportation system. Based on a redefinition of transportation network efficiency, a quantitative efficiency evaluation method for transportation network is proposed, which could reflect the effects of network structure, traffic demands, travel choice, and travel costs on network efficiency. Furthermore, the efficiency-oriented importance measure for network components is presented, which can be used to help engineers identify the critical nodes and links in the network. The numerical examples show that, compared with existing efficiency evaluation methods, the network efficiency value calculated by the method proposed in this paper can portray the real operation situation of the transportation network as well as the effects of main factors on network efficiency. We also find that the network efficiency and the importance values of the network components both are functions of demands and network structure in the transportation network.

  2. Digital Identifier Systems: Comparative Evaluation

    Directory of Open Access Journals (Sweden)

    Hamid Reza Khedmatgozar

    2015-02-01

    Full Text Available Identifier is one of the main elements in identifying an object in digital environment. Digital identifier systems were developed followed by a lot of problems such as violation of persistency and uniqueness of physical identifiers and URL in digital environment. These identifiers try to guarantee uniqueness and persistency of hostnames by using indirect names for Domain Name System (DNS. The main objective of this research is to identify qualified digital identifier system among other systems. To achieve the research objective, researchers have considered two major steps: first, identifying main criteria for distinguishing digital identifier based on literature review and focus group interview; and second, performing a comparative evaluation on common identifier systems in the world. Findings of first step demonstrated seven main criteria in three domains for distinguishing digital identifier systems: identifier uniqueness and persistency in the identifier features domain, digital identification, digital uniqueness, digital persistency and digital actionability in the digital coverage domain, and globality in the comprehensiveness of scope domain. In the second step, results of the comparative evaluation on common identifier systems indicated that six identifier systems, included, DOI, Handle, UCI, URN, ARK and PURL, are appropriate choices for using as a digital identifier system. Also, according to these results, three identification systems Including NBN, MARIAM and ISNI were identified as suitable choices for digital identification in certain specialized fields. According to many benefits of using these identifiers in important applied fields, such as, digital content chains and networks integration, digital right management, cross referencing, digital libraries and citation analysis, results of this study can help digital environment experts to diagnose digital identifier and their effective use in applied fields.

  3. Recent advances in understanding hepatic drug transport

    Science.gov (United States)

    Stieger, Bruno; Hagenbuch, Bruno

    2016-01-01

    Cells need to strictly control their internal milieu, a function which is performed by the plasma membrane. Selective passage of molecules across the plasma membrane is controlled by transport proteins. As the liver is the central organ for drug metabolism, hepatocytes are equipped with numerous drug transporters expressed at the plasma membrane. Drug disposition includes absorption, distribution, metabolism, and elimination of a drug and hence multiple passages of drugs and their metabolites across membranes. Consequently, understanding the exact mechanisms of drug transporters is essential both in drug development and in drug therapy. While many drug transporters are expressed in hepatocytes, and some of them are well characterized, several transporters have only recently been identified as new drug transporters. Novel powerful tools to deorphanize (drug) transporters are being applied and show promising results. Although a large set of tools are available for studying transport in vitro and in isolated cells, tools for studying transport in living organisms, including humans, are evolving now and rely predominantly on imaging techniques, e.g. positron emission tomography. Imaging is an area which, certainly in the near future, will provide important insights into "transporters at work" in vivo. PMID:27781095

  4. Effect of Transportation Policies on Modal Shift from Private Car to Public Transport in Malaysia

    Science.gov (United States)

    Nurdden, Abdullah; Rahmat, Riza Atiq O. K.; Ismail, Amiruddin

    The car is the second (40%) most common mode of transportation in Malaysia. The rapid increase in the use of personal transportation has its roots in the weak Malaysian public transport system. As a result, traffic congestion, accidents, air pollution and need for parking space among other evils, have escalated. In this study, policies aimed at discouraging the use of private transportation were studied. In addition, this study sought to identify factors that prevent personal transport users from utilizing public transport so that rational policies could be formulated to encourage greater utilization of public transport. A survey was carried out on users of private and public (both bus and urban train transport) (n = 1200). A binary logit model was developed for the three alternative modes, Car, Bus and Train. This study found that age, gender, car ownership, travel time, travel cost, household size and income are significant factors in influencing the individual`s choice of transportation. The most important variables found likely to encourage the use of public transport were reduced travel time, reduce the distance from home to public transportation stations and subsidized fares. In conclusion, for the commuter to switch to public transport, proper incentives need to be provided for a successful implementation.

  5. Space Transportation and Destination Facilities

    Science.gov (United States)

    Smitherman, David; McClure, Wallace

    1999-01-01

    The Space Transportation and Destination Facilities section focused on space transportation vehicles-from use of existing vehicles to development of specialized transports-and on space stations, space business parks, space hotels, and other facilities in space of the kind that eventually would provide services for general public space travel (PST) and tourism. For both transportation and destination facilities, the emphasis was on the identification of various strategies to enable a realistic incremental progression in the development and acquisition of such facilities, and the identification of issues that need resolution to enable formation of viable businesses. The approach was to determine the best: (1) Strategies for general PST and tourism development through the description and analysis of a wide range of possible future scenarios. With these scenarios in mind the section then identified. (2) Key issues to be explored. (3) opportunities to eliminate barriers. (4) Recommendations for future actions. (5) Top-level requirements and characteristics for general PST and tourism systems and services that would guide the development of transportation and destination facilities.

  6. Expression of Thyroid Hormone Transporters in the Human Hypothalamus

    NARCIS (Netherlands)

    A. Alkemade; E.C.H. Friesema; A. Kalsbeek; D.F. Swaab; T.J. Visser; E. Fliers

    2011-01-01

    Context: Transport of thyroid hormone across the plasma membrane is required for proper thyroid hormone action and metabolism. Several specific thyroid hormone transporters have been identified capable of facilitating uptake and/or efflux of thyroid hormones. Monocarboxylate transporter (MCT)-8, MCT

  7. A Novel Class of Modular Transporters for Vitamins in Prokaryotes

    NARCIS (Netherlands)

    Rodionov, Dmitry A.; Hebbeln, Peter; Eudes, Aymerick; ter Beek, Josy; Rodionova, Irina A.; Erkens, Guus B.; Slotboom, Dirk J.; Gelfand, Mikhail S.; Osterman, Andrei L.; Hanson, Andrew D.; Eitinger, Thomas

    2009-01-01

    The specific and tightly controlled transport of numerous nutrients and metabolites across cellular membranes is crucial to all forms of life. However, many of the transporter proteins involved have yet to be identified, including the vitamin transporters in various human pathogens, whose growth dep

  8. Water-transporting proteins.

    Science.gov (United States)

    Zeuthen, Thomas

    2010-04-01

    Transport through lipids and aquaporins is osmotic and entirely driven by the difference in osmotic pressure. Water transport in cotransporters and uniporters is different: Water can be cotransported, energized by coupling to the substrate flux by a mechanism closely associated with protein. In the K(+)/Cl(-) and the Na(+)/K(+)/2Cl(-) cotransporters, water is entirely cotransported, while water transport in glucose uniporters and Na(+)-coupled transporters of nutrients and neurotransmitters takes place by both osmosis and cotransport. The molecular mechanism behind cotransport of water is not clear. It is associated with the substrate movements in aqueous pathways within the protein; a conventional unstirred layer mechanism can be ruled out, due to high rates of diffusion in the cytoplasm. The physiological roles of the various modes of water transport are reviewed in relation to epithelial transport. Epithelial water transport is energized by the movements of ions, but how the coupling takes place is uncertain. All epithelia can transport water uphill against an osmotic gradient, which is hard to explain by simple osmosis. Furthermore, genetic removal of aquaporins has not given support to osmosis as the exclusive mode of transport. Water cotransport can explain the coupling between ion and water transport, a major fraction of transepithelial water transport and uphill water transport. Aquaporins enhance water transport by utilizing osmotic gradients and cause the osmolarity of the transportate to approach isotonicity.

  9. Transportation Technology: Rail Transport and Logistics

    Science.gov (United States)

    Lang, Aaron B.

    2011-01-01

    Transportation can simply be defined as the movement of goods, services, and people from one location to another. Without an efficient means to transport goods from place to place, the economy would be nothing like it is today. Throughout the history of the United States, American railroads have paved the way toward creating a nation of great…

  10. INTERMODAL TRANSPORT IN EUROPE - OPPORTUNITIES THROUGH INNOVATION

    Directory of Open Access Journals (Sweden)

    Norbert Wagener

    2014-12-01

    Full Text Available Background: Freight transport volume in ton-km in OECD countries will grow considerably up to 150 to 230 % in 2050 compared to 2010. Although the EU policy aims to shift 30% of road freight over 300 km to other modes such as rail or waterborne transport by 2030 the recent trends show a stable modal split of road at approx. 75%. Conventional intermodal transport on the major European routes has shown a steady but only limited organic growth through recent years. Therefore, new innovative concepts for intermodal transport and for the shift from road to rail are needed. Methods: Definitions of intermodal transport have been clarified and the development of combined transport in Europe and in Germany and Poland in particular has been analyzed on the basis of available data sources. New innovative concepts for intermodal transport have been identified on the basis of desk research, recent relevant projects (RETRACK, SCANDRIA, Rail Baltica and market intelligence. Results: The analysis leads to the conclusion that new innovative concepts in intermodal transport comprise new forms of organization as well as new technologies and new routes. The following three innovations to facilitate the shift from road to rail by intermodal transport are being introduced and discussed: multimodal operation of ocean carriers in maritime hinterland transportation, innovative handling technologies for non-crane able trainers and freight corridors for long distance intermodal transport within the TEN-T network and on the Europe-Asia corridor. Conclusions: Further accelerated growth in the shift from road to rail through intermodal transport requires new innovative concepts beyond the traditional combined transport in Western Europe. Three promising innovative concepts have been introduced. Further research is needed and should be focused on financial and economic appraisal as well as on the effectiveness of state intervention policies. 

  11. Ligands targeting the excitatory amino acid transporters (EAATs).

    Science.gov (United States)

    Dunlop, John; Butera, John A

    2006-01-01

    This review provides an overview of ligands for the excitatory amino acid transporters (EAATs), a family of high-affinity glutamate transporters localized to the plasma membrane of neurons and astroglial cells. Ligand development from the perspective of identifying novel and more selective tools for elucidating transporter subtype function, and the potential of transporter ligands in a therapeutic setting are discussed. Acute pharmacological modulation of EAAT activity in the form of linear and conformationally restricted glutamate and aspartate analogs is presented, in addition to recent strategies aimed more toward modulating transporter expression levels, the latter of particular significance to the development of transporter based therapeutics.

  12. Transperitoneal transport of sodium during hypertonic peritoneal dialysis

    DEFF Research Database (Denmark)

    Graff, J; Fugleberg, S; Brahm, J

    1996-01-01

    The mechanisms of transperitoneal sodium transport during hypertonic peritoneal dialysis were evaluated by kinetic modelling. A total of six nested mathematical models were designed to elucidate the presence or absence of diffusive, non-lymphatic convective and lymphatic convective solute transport....... Experimental results were obtained from 26 non-diabetic patients undergoing peritoneal dialysis. The model validation procedure demonstrated that only diffusive and non-lymphatic convective transport mechanisms were identifiable in the transperitoneal transport of sodium. Non-lymphatic convective sodium...

  13. Oxygen transport membrane

    DEFF Research Database (Denmark)

    2015-01-01

    The present invention relates to a novel composite oxygen transport membrane as well as its preparation and uses thereof.......The present invention relates to a novel composite oxygen transport membrane as well as its preparation and uses thereof....

  14. Transport research: Quo Vadis?

    CSIR Research Space (South Africa)

    Rust, FC

    2008-07-01

    Full Text Available It is well-recognised internationally that transport and transport infrastructure play a major role both in the stimulation of economic growth, creation of job opportunities and in poverty alleviation. This is of particular importance in South...

  15. Speeding up Transportation

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ 2007 was an excellent year for the transportation industry, marked by high speed railway transportation, development of the national expressway network and launch of the Chang'e lunar probe satellite.

  16. FREIGHT TRANSPORT IN EUROPE

    Directory of Open Access Journals (Sweden)

    A. REGGIANI

    2000-01-01

    Full Text Available This paper presents an overview of European policy on the interconnected cross-border transport networks as well as severe problems in estimating empirically the avalanche of goods movements in the European Union (EU. In particular, it deals with the Transalpine freight transport case, which represents one of the most challenging operational and policy issues of the present and future – both international (EU and national (the Alpine countries – freight transport development. The paper is organised to briefly describe the main objectives of EU transport policy, to generally introduce the concept of intermodal transport with particular emphasis on intermodal freight transport and to describe past, present and future development of Trans-Alpine intermodal transport. The scenarios of future development of Trans-Alpine intermodal transport have been particularly analysed.

  17. Transportation Management Workshop: Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    1993-10-01

    This report is a compilation of discussions presented at the Transportation Management Workshop held in Gaithersburg, Maryland. Topics include waste packaging, personnel training, robotics, transportation routing, certification, containers, and waste classification.

  18. Small Satellite Transporter Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The primary objective is to determine whether this small satellite transporter is capable of transporting at least four 6U CubeSats is possible for a given set of...

  19. Band-selective ballistic energy transport in alkane oligomers: toward controlling the transport speed.

    Science.gov (United States)

    Yue, Yuankai; Qasim, Layla N; Kurnosov, Arkady A; Rubtsova, Natalia I; Mackin, Robert T; Zhang, Hong; Zhang, Boyu; Zhou, Xiao; Jayawickramarajah, Janarthanan; Burin, Alexander L; Rubtsov, Igor V

    2015-05-28

    Intramolecular transport of vibrational energy in two series of oligomers featuring alkane chains of various length was studied by relaxation-assisted two-dimensional infrared spectroscopy. The transport was initiated by exciting various end-group modes (tags) such as different modes of the azido (ν(N≡N) and ν(N═N)), carboxylic acid (ν(C═O)), and succinimide ester (νas(C═O)) with short mid-IR laser pulses. It is shown that the transport via alkane chains is ballistic and the transport speed is dependent on the type of the tag mode that initiates the transport. The transport speed of 8.0 Å/ps was observed when initiated by either ν(C═O) or νas(C═O). When initiated by ν(N≡N) and ν(N═N), the transport speed of 14.4 ± 2 and 11 ± 4 Å/ps was observed. Analysis of the vibrational relaxation channels of different tags, combined with the results for the group velocity evaluation, permits identification of the chain bands predominantly contributing to the transport for different cases of the transport initiation. For the transport initiated by ν(N≡N) the CH2 twisting and wagging chain bands were identified as the major energy transport channels. For the transport initiated by ν(C═O), the C-C stretching and CH2 rocking chain bands served as major energy transporters. The transport initiated by ν(N═N) results in direct formation of the wave packet within the CH2 twisting and wagging chain bands. These developments can aid in designing molecular systems featuring faster and more controllable energy transport in molecules.

  20. Membrane transporters and new drug development

    Institute of Scientific and Technical Information of China (English)

    EndoH

    2002-01-01

    Molecular biology has made it possible to identify membrane transporter molecules that transport hydrophilic endogenous and exogenous compounds across cellular membranes.Ther are two possibilities on transporters relevant to new drug development,drug targets and pharmacokinetics.Human genome database predicts that more than 10% of common diseases may be tightly related with membrane transporter dysfunction.Thus,membrane transporters would be possible molecular targets for new drug development.As an example,I will talk on our discovery of L-type amino acid transporter 1(LAT1) being oncofetal and upregulated in cancers for their rapid growth and metastasis.We provide evidence that inhibition of LAT1 functions may become novel types of anticancer tools.As another example in human pharmacokinetics,application of stable expressing cell lines of human drug transporters will be proposed including organic anion and cation transporters which are distributed in various organs including the liver and kidney.These transporters are multispecific in their substrate recognition,and better molecules to anticipate drug-drug interactions in human bodies before new drug candidates are given in clinical trials.This in vitro technique may contribute to decide suitable compounds in particular by high throughout screening strategy.

  1. Reverse cholesterol transport revisited

    Institute of Scientific and Technical Information of China (English)

    Astrid; E; van; der; Velde

    2010-01-01

    Reverse cholesterol transport was originally described as the high-density lipoprotein-mediated cholesterol flux from the periphery via the hepatobiliary tract to the intestinal lumen, leading to fecal excretion. Since the introduction of reverse cholesterol transport in the 1970s, this pathway has been intensively investigated. In this topic highlight, the classical reverse cholesterol transport concepts are discussed and the subject reverse cholesterol transport is revisited.

  2. Education and training in transport of radioactive material; Educacao e treinamento em transporte de material radioativo

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Bruno Natanael; Pastura, Valeria da Fonseca e Silva; Mattar, Patricia; Dias, Carlos R. [Comissao Nacional de Energia Nuclear (CNEN), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This paper presents the approach adopted by the Department of Transportation of the Brazilian National Nuclear Energy Commission - CNEN, in the creation of the course of education and training distance for transport companies, as well as for national institutions directly involved with the theme transportation of radioactive materials. The course will consist of 20 modules containing exercises and further assessment of learning, and enable participants to understand the regulatory terminology, assimilating the philosophy of nuclear and radiation safety, prepare the shipment and identify and fill the complete documents required in an operation transport.

  3. Transportation in African Development.

    Science.gov (United States)

    Altschul, Robert D.

    1980-01-01

    Examines the structure, role, and needs of Africa's national and intracontinental transportation system. Characteristics of rail, water, road, and air transportation are examined. The conclusion is that high investment in transportation systems is essential to the development process. (Author/KC)

  4. Transport statistics 1995

    CSIR Research Space (South Africa)

    De Haan, ML

    1996-04-01

    Full Text Available This publication contains information on all major modes of transport in South Africa. The transport sector is placed in perspective relative to the macro economy and a number of important transport indicators are given. The document also contains...

  5. Assessing Sensitiveness to Transport

    DEFF Research Database (Denmark)

    Lieb, Christoph; Suter, Stefan; Sánchez, Alfredo

    Summary The EU-project ASSET (ASessing SEnsitiveness to Transport) aims at developing and implementing a concise concept to assess transport sensitive areas (TSA) in a European context, i.e. areas in which transport leads to more serious impacts than in other areas. The aim of work package 2 (WP2...

  6. How stressful is transportation?

    Science.gov (United States)

    It is common for cattle to be transported multiple times during their production life cycle. Transportation events may include calves shipped to backgrounding facilities and feed yards, as well as pregnant cows that may be transported to sale barns or relocated due to drought to access a pasture or ...

  7. METHODS OF INTEGRATED OPTIMIZATION MAGLEV TRANSPORT SYSTEMS

    Directory of Open Access Journals (Sweden)

    A. Lasher

    2013-09-01

    Full Text Available Purpose. To demonstrate feasibility of the proposed integrated optimization of various MTS parameters to reduce capital investments as well as decrease any operational and maintenance expense. This will make use of MTS reasonable. At present, the Maglev Transport Systems (MTS for High-Speed Ground Transportation (HSGT almost do not apply. Significant capital investments, high operational and maintenance costs are the main reasons why Maglev Transport Systems (MTS are hardly currently used for the High-Speed Ground Transportation (HSGT. Therefore, this article justifies use of Theory of Complex Optimization of Transport (TCOT, developed by one of the co-authors, to reduce MTS costs. Methodology. According to TCOT, authors developed an abstract model of the generalized transport system (AMSTG. This model mathematically determines the optimal balance between all components of the system and thus provides the ultimate adaptation of any transport systems to the conditions of its application. To identify areas for effective use of MTS, by TCOT, the authors developed a dynamic model of distribution and expansion of spheres of effective use of transport systems (DMRRSEPTS. Based on this model, the most efficient transport system was selected for each individual track. The main estimated criterion at determination of efficiency of application of MTS is the size of the specific transportation tariff received from calculation of payback of total given expenses to a standard payback period or term of granting the credit. Findings. The completed multiple calculations of four types of MTS: TRANSRAPID, MLX01, TRANSMAG and TRANSPROGRESS demonstrated efficiency of the integrated optimization of the parameters of such systems. This research made possible expending the scope of effective usage of MTS in about 2 times. The achieved results were presented at many international conferences in Germany, Switzerland, United States, China, Ukraine, etc. Using MTS as an

  8. Identification of four nuclear transport signal-binding proteins that interact with diverse transport signals.

    Science.gov (United States)

    Yamasaki, L; Kanda, P; Lanford, R E

    1989-07-01

    The transport of proteins into the nucleus requires not only the presence of a nuclear transport signal on the targeted protein but also the signal recognition proteins and the nuclear pore translocation apparatus. Complicating the search for the signal recognition proteins is the fact that the nuclear transport signals identified share little obvious homology. In this study, synthetic peptides homologous to the nuclear transport signals from the simian virus 40 large T antigen, Xenopus oocyte nucleoplasmin, adenovirus E1A, and Saccharomyces cerevisiae MAT alpha 2 proteins were coupled to a UV-photoactivable cross-linker and iodinated for use in an in vitro cross-linking reaction with cellular lysates. Four proteins, p140, p100, p70, and p55, which specifically interacted with the nuclear transport signal peptides were identified. Unique patterns of reactivity were observed with closely related pairs of nuclear transport signal peptides. Competition experiments with labeled and unlabeled peptides demonstrated that heterologous signals were able to bind the same protein and suggested that diverse signals use a common transport pathway. The subcellular distribution of the four nuclear transport signal-binding proteins suggested that nuclear transport involves both cytoplasmic and nuclear receptors. The four proteins were not bound by wheat germ agglutinin and were not associated tightly with the nuclear pore complex.

  9. New criteria to identify spectrum

    DEFF Research Database (Denmark)

    Jensen, Arne; Krishna, M.

    2005-01-01

    In this paper we give some new criteria for identifying the components of a probability measure, in its Lebesgue decomposition. This enables us to give new criteria to identify spectral types of self-adjoint operators on Hilbert spaces, especially those of interest....

  10. New Criteria to Identify Spectrum

    Indian Academy of Sciences (India)

    A Jensen; M Krishna

    2005-05-01

    In this paper we give some new criteria for identifying the components of a probability measure, in its Lebesgue decomposition. This enables us to give new criteria to identify spectral types of self-adjoint operators on Hilbert spaces, especially those of interest.

  11. Anomalous transport at weak coupling

    CERN Document Server

    Chowdhury, Subham Dutta

    2015-01-01

    We evaluate the contribution of chiral fermions in $d=2, 4, 6$, chiral bosons, a chiral gravitino like theory in $d=2$ and chiral gravitinos in $d=6$ to all the leading parity odd transport coefficients at one loop. This is done by using finite temperature field theory to evaluate the relevant Kubo formulae. For chiral fermions and chiral bosons the relation between the parity odd transport coefficient and the microscopic anomalies including gravitational anomalies agree with that found by using the general methods of hydrodynamics and the argument involving the consistency of the Euclidean vacuum. For the gravitino like theory in $d=2$ and chiral gravitinos in $d=6$, we show that relation between the pure gravitational anomaly and parity odd transport breaks down. From the perturbative calculation we clearly identify the terms that contribute to the anomaly polynomial, but not to the transport coefficient for gravitinos. We also develop a simple method for evaluating the angular integrals in the one loop dia...

  12. A perchlorate sensitive iodide transporter in frogs

    OpenAIRE

    Carr, Deborah L.; James A. Carr; Ray E. Willis; Pressley, Thomas A.

    2008-01-01

    Nucleotide sequence comparisons have identified a gene product in the genome database of African clawed frogs (Xenopus laevis) as a probable member of the solute carrier family of membrane transporters. To confirm its identity as a putative iodide transporter, we examined the function of this sequence after heterologous expression in mammalian cells. A green monkey kidney cell line transfected with the Xenopus nucleotide sequence had significantly greater 125I uptake than sham-transfected con...

  13. Strategic Orientation of Transportation in Slovenia

    Directory of Open Access Journals (Sweden)

    Igor Trupac

    2012-10-01

    Full Text Available The paper deals with strategic goals and decisions to betaken for the integration of Slovenia into the European Union.One of the most important factors of this integration is transportation.This process should not be chaotic or driven by blindforces but carefully and strategically orientated in the macroand the micro field.The paper also suggests general strategy of transportation,defines goals, measures to be taken and identifies authorities.

  14. Hydrogen transport and storage in engineered microspheres

    Energy Technology Data Exchange (ETDEWEB)

    Rambach, G. [Lawrence Livermore National Lab., CA (United States); Hendricks, C. [W.J. Schafer Associates, Livermore, CA (United States)

    1996-10-01

    This project is a collaboration between Lawrence Livermore National Laboratory (LLNL) and W.J. Schafer Associates (WJSA). The authors plan to experimentally verify the performance characteristics of engineered glass microspheres that are relevant to the storage and transport of hydrogen for energy applications. They will identify the specific advantages of hydrogen transport by microspheres, analyze the infrastructure implications and requirements, and experimentally measure their performance characteristics in realistic, bulk storage situations.

  15. Hazardous Material Packaging and Transportation

    Energy Technology Data Exchange (ETDEWEB)

    Hypes, Philip A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-02-04

    This is a student training course. Some course objectives are to: recognize and use standard international and US customary units to describe activities and exposure rates associated with radioactive material; determine whether a quantity of a single radionuclide meets the definition of a class 7 (radioactive) material; determine, for a given single radionuclide, the shipping quantity activity limits per 49 Code of Federal Regulations (CFR) 173.435; determine the appropriate radioactive material hazard class proper shipping name for a given material; determine when a single radionuclide meets the DOT definition of a hazardous substance; determine the appropriate packaging required for a given radioactive material; identify the markings to be placed on a package of radioactive material; determine the label(s) to apply to a given radioactive material package; identify the entry requirements for radioactive material labels; determine the proper placement for radioactive material label(s); identify the shipping paper entry requirements for radioactive material; select the appropriate placards for a given radioactive material shipment or vehicle load; and identify allowable transport limits and unacceptable transport conditions for radioactive material.

  16. Transportation System Requirements Document

    Energy Technology Data Exchange (ETDEWEB)

    1993-09-01

    This Transportation System Requirements Document (Trans-SRD) describes the functions to be performed by and the technical requirements for the Transportation System to transport spent nuclear fuel (SNF) and high-level radioactive waste (HLW) from Purchaser and Producer sites to a Civilian Radioactive Waste Management System (CRWMS) site, and between CRWMS sites. The purpose of this document is to define the system-level requirements for Transportation consistent with the CRWMS Requirement Document (CRD). These requirements include design and operations requirements to the extent they impact on the development of the physical segments of Transportation. The document also presents an overall description of Transportation, its functions, its segments, and the requirements allocated to the segments and the system-level interfaces with Transportation. The interface identification and description are published in the CRWMS Interface Specification.

  17. Intelligent Freigth Transport Systems

    DEFF Research Database (Denmark)

    Overø, Helene Martine; Larsen, Allan; Røpke, Stefan

    2009-01-01

    The Danish innovation project entitled “Intelligent Freight Transport Systems” aims at developing prototype systems integrating public intelligent transport systems (ITS) with the technology in vehicles and equipment as well as the IT-systems at various transport companies. The objective is to en......The Danish innovation project entitled “Intelligent Freight Transport Systems” aims at developing prototype systems integrating public intelligent transport systems (ITS) with the technology in vehicles and equipment as well as the IT-systems at various transport companies. The objective...... is to enhance the efficiency and lower the environmental impact in freight transport. In this paper, a pilot project involving real-time waste collection at a Danish waste collection company is described, and a solution approach is proposed. The problem corresponds to the dynamic version of the waste collection...... problem which can be formulated as a dynamic version of the vehicle routing problem with time windows (VRPTW)....

  18. [Fructose transporter in yeasts].

    Science.gov (United States)

    Lazar, Zbigniew; Dobrowolski, Adam; Robak, Małgorzata

    2014-01-01

    Study of hexoses transporter started with discovery of galactose permease in Saccharomyces cerevisiae. Glucose, fructose and mannose assimilation is assumed by numerous proteins encoded by different genes. To date over 20 hexoses transporters, belonging to Sugar Porter family and to Major Facilitator Superfamily, were known. Genome sequence analysis of Candida glabrata, Kluyveromyces lactis, Yarrowia lipolytica, S. cerevisaie and Debaryomyces hansenii reveled potential presence of 17-48 sugar porter proteins. Glucose transporters in S. cerevisiae have been already characterized. In this paper, hexoses transporters, responsible for assimilation of fructose by cells, are presented and compared. Fructose specific transporter are described for yeasts: Zygosaccharomyces rouxii, Zygosaccharomyces bailli, K. lactis, Saccharomyces pastorianus, S. cerevisiae winemaking strain and for fungus Botritys cinerea and human (Glut5p). Among six yeasts transporters, five are fructose specific, acting by facilitated diffusion or proton symport. Yeasts monosaccharides transporter studies allow understanding of sugars uptake and metabolism important aspects, even in higher eukaryotes cells.

  19. TRANSPORT/HANDLING REQUESTS

    CERN Multimedia

    Groupe ST/HM

    2002-01-01

    A new EDH document entitled 'Transport/Handling Request' will be in operation as of Monday, 11th February 2002, when the corresponding icon will be accessible from the EDH desktop, together with the application instructions. This EDH form will replace the paper-format transport/handling request form for all activities involving the transport of equipment and materials. However, the paper form will still be used for all vehicle-hire requests. The introduction of the EDH transport/handling request form is accompanied by the establishment of the following time limits for the various services concerned: 24 hours for the removal of office items, 48 hours for the transport of heavy items (of up to 6 metric tons and of standard road width), 5 working days for a crane operation, extra-heavy transport operation or complete removal, 5 working days for all transport operations relating to LHC installation. ST/HM Group, Logistics Section Tel: 72672 - 72202

  20. Transportation safety training

    Energy Technology Data Exchange (ETDEWEB)

    Jones, E.

    1990-01-01

    Over the past 25 years extensive federal legislation involving the handling and transport of hazardous materials/waste has been passed that has resulted in numerous overlapping regulations administered and enforced by different federal agencies. The handling and transport of hazardous materials/waste involves a significant number of workers who are subject to a varying degree of risk should an accident occur during handling or transport. Effective transportation training can help workers address these risks and mitigate them, and at the same time enable ORNL to comply with the federal regulations concerning the transport of hazardous materials/waste. This presentation will outline how the Environmental and Health Protection Division's Technical Resources and Training Section at the Oak Ridge National Laboratory, working with transportation and waste disposal personnel, have developed and implemented a comprehensive transportation safety training program to meet the needs of our workers while satisfying appropriate federal regulations. 8 refs., 3 tabs.

  1. SLC27 fatty acid transport proteins.

    Science.gov (United States)

    Anderson, Courtney M; Stahl, Andreas

    2013-01-01

    The uptake and metabolism of long chain fatty acids (LCFA) are critical to many physiological and cellular processes. Aberrant accumulation or depletion of LCFA underlie the pathology of numerous metabolic diseases. Protein-mediated transport of LCFA has been proposed as the major mode of LCFA uptake and activation. Several proteins have been identified to be involved in LCFA uptake. This review focuses on the SLC27 family of fatty acid transport proteins, also known as FATPs, with an emphasis on the gain- and loss-of-function animal models that elucidate the functions of FATPs in vivo and how these transport proteins play a role in physiological and pathological situations.

  2. Transport of radioactive substances; Der Transport radioaktiver Stoffe

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2014-12-15

    The report on the transport of radioactive substances covers the following topics: facts on radioactive materials transport, safety of the transport of radioactive substances, legal regulations and guidelines: a multiform but consistent system, transport of nuclear fuels, safety during the transport of nuclear fuel, future transport of spent fuel elements and high-level radioactive wastes in Germany.

  3. Author Identifiers in Scholarly Repositories

    CERN Document Server

    Warner, Simeon

    2010-01-01

    Bibliometric and usage-based analyses and tools highlight the value of information about scholarship contained within the network of authors, articles and usage data. Less progress has been made on populating and using the author side of this network than the article side, in part because of the difficulty of unambiguously identifying authors. I briefly review a sample of author identifier schemes, and consider use in scholarly repositories. I then describe preliminary work at arXiv to implement public author identifiers, services based on them, and plans to make this information useful beyond the boundaries of arXiv.

  4. Real time model for public transportation management

    Directory of Open Access Journals (Sweden)

    Ireneusz Celiński

    2014-03-01

    Full Text Available Background: The article outlines managing a public transportation fleet in the dynamic aspect. There are currently many technical possibilities of identifying demand in the transportation network. It is also possible to indicate legitimate basis of estimating and steering demand. The article describes a general public transportation fleet management concept based on balancing demand and supply. Material and methods: The presented method utilizes a matrix description of demand for transportation based on telemetric and telecommunication data. Emphasis was placed mainly on a general concept and not the manner in which data was collected by other researchers.  Results: The above model gave results in the form of a system for managing a fleet in real-time. The objective of the system is also to optimally utilize means of transportation at the disposal of service providers. Conclusions: The presented concept enables a new perspective on managing public transportation fleets. In case of implementation, the project would facilitate, among others, designing dynamic timetables, updated based on observed demand, and even designing dynamic points of access to public transportation lines. Further research should encompass so-called rerouting based on dynamic measurements of the characteristics of the transportation system.

  5. Interaction between Monk Seals, Monachus monachus (Hermann, 1779), and artisanal fisheries in the Foca Pilot Monk Seal conservation area, Turkey

    NARCIS (Netherlands)

    Guclusoy, H.

    2008-01-01

    The present study examines some aspects of the interaction between critically endangered Monk Seals Monachus monachus and artisanal fisheries in the Foc¿a Pilot Monk Seal Conservation Area, Turkey, between 1994 and 2002. One to four permanent researchers collected the data on this interaction during

  6. Transport, energy and environment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    Transportation demands a large and increasing share of total energy consumption in Europe. At the same time many European countries are facing difficult decisions in achieving their long term environmental goals. Therefore energy policy, environmental policy and transport policy should be seen and discussed in a common perspective. In particular the relative contribution from the transport sector and the energy sector involves a number of important and difficult issues. The aim of the conference was to bring together economists, scientists, manufactures, energy planners, transport planners, and decision makers in order to discuss the importance of the transport sector in relation to energy demand and long term environmental goals. General conference sessions covered. Trends in Transport Energy Demand and Environmental constraints, Technological Development and New Transport Systems, Lifestyle Changes and the Transport Sector, Megacities: Solutions to the Transport and Air Pollution Problems, Effectiveness of Public Policies, Transport and Energy sector, and Methods, Models and Data. The conference took place at Hotel Marienlyst, Elsinore, Denmark and attracted wide interest. The participants represented 14 different countries covering international organisations, ministries, universities, research centres, consulting firms, industry etc. (EG)

  7. Energy and transport.

    Science.gov (United States)

    Woodcock, James; Banister, David; Edwards, Phil; Prentice, Andrew M; Roberts, Ian

    2007-09-22

    We examine the links between fossil-fuel-based transportation, greenhouse-gas emissions, and health. Transport-related carbon emissions are rising and there is increasing consensus that the growth in motorised land vehicles and aviation is incompatible with averting serious climate change. The energy intensity of land transport correlates with its adverse health effects. Adverse health effects occur through climate change, road-traffic injuries, physical inactivity, urban air pollution, energy-related conflict, and environmental degradation. For the world's poor people, walking is the main mode of transport, but such populations often experience the most from the harms of energy-intensive transport. New energy sources and improvements in vehicle design and in information technology are necessary but not sufficient to reduce transport-related carbon emissions without accompanying behavioural change. By contrast, active transport has the potential to improve health and equity, and reduce emissions. Cities require safe and pleasant environments for active transport with destinations in easy reach and, for longer journeys, public transport that is powered by renewable energy, thus providing high levels of accessibility without car use. Much investment in major road projects does not meet the transport needs of poor people, especially women whose trips are primarily local and off road. Sustainable development is better promoted through improving walking and cycling infrastructures, increasing access to cycles, and investment in transport services for essential needs. Our model of London shows how increased active transport could help achieve substantial reductions in emissions by 2030 while improving population health. There exists the potential for a global contraction and convergence in use of fossil-fuel energy for transport to benefit health and achieve sustainability.

  8. SUBSURFACE EMPLACEMENT TRANSPORTATION SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    T. Wilson; R. Novotny

    1999-11-22

    The objective of this analysis is to identify issues and criteria that apply to the design of the Subsurface Emplacement Transportation System (SET). The SET consists of the track used by the waste package handling equipment, the conductors and related equipment used to supply electrical power to that equipment, and the instrumentation and controls used to monitor and operate those track and power supply systems. Major considerations of this analysis include: (1) Operational life of the SET; (2) Geometric constraints on the track layout; (3) Operating loads on the track; (4) Environmentally induced loads on the track; (5) Power supply (electrification) requirements; and (6) Instrumentation and control requirements. This analysis will provide the basis for development of the system description document (SDD) for the SET. This analysis also defines the interfaces that need to be considered in the design of the SET. These interfaces include, but are not limited to, the following: (1) Waste handling building; (2) Monitored Geologic Repository (MGR) surface site layout; (3) Waste Emplacement System (WES); (4) Waste Retrieval System (WRS); (5) Ground Control System (GCS); (6) Ex-Container System (XCS); (7) Subsurface Electrical Distribution System (SED); (8) MGR Operations Monitoring and Control System (OMC); (9) Subsurface Facility System (SFS); (10) Subsurface Fire Protection System (SFR); (11) Performance Confirmation Emplacement Drift Monitoring System (PCM); and (12) Backfill Emplacement System (BES).

  9. Identifiability, exchangeability and confounding revisited

    OpenAIRE

    Greenland, Sander; Robins, James Matthew

    2009-01-01

    In 1986 the International Journal of Epidemiology published "Identifiability, Exchangeability and Epidemiological Confounding". We review the article from the perspective of a quarter century after it was first drafted and relate it to subsequent developments on confounding, ignorability, and collapsibility.

  10. Identifying discharge practice training needs.

    Science.gov (United States)

    Lees, L; Emmerson, K

    A training needs analysis tool was developed to identify nurses' discharge training needs and to improve discharge practice. The tool includes 49 elements of discharge practice subdivided into four areas: corporate, operational, clinical and nurse-led discharge. The tool was disseminated to 15 wards on two hospital sites with assistance from the practice development team. Analysis of discharge training is important to assess discharge training needs and to identify staff who may assist with training.

  11. Individual Identifiability Predicts Population Identifiability in Forensic Microsatellite Markers.

    Science.gov (United States)

    Algee-Hewitt, Bridget F B; Edge, Michael D; Kim, Jaehee; Li, Jun Z; Rosenberg, Noah A

    2016-04-01

    Highly polymorphic genetic markers with significant potential for distinguishing individual identity are used as a standard tool in forensic testing [1, 2]. At the same time, population-genetic studies have suggested that genetically diverse markers with high individual identifiability also confer information about genetic ancestry [3-6]. The dual influence of polymorphism levels on ancestry inference and forensic desirability suggests that forensically useful marker sets with high levels of individual identifiability might also possess substantial ancestry information. We study a standard forensic marker set-the 13 CODIS loci used in the United States and elsewhere [2, 7-9]-together with 779 additional microsatellites [10], using direct population structure inference to test whether markers with substantial individual identifiability also produce considerable information about ancestry. Despite having been selected for individual identification and not for ancestry inference [11], the CODIS markers generate nontrivial model-based clustering patterns similar to those of other sets of 13 tetranucleotide microsatellites. Although the CODIS markers have relatively low values of the F(ST) divergence statistic, their high heterozygosities produce greater ancestry inference potential than is possessed by less heterozygous marker sets. More generally, we observe that marker sets with greater individual identifiability also tend toward greater population identifiability. We conclude that population identifiability regularly follows as a byproduct of the use of highly polymorphic forensic markers. Our findings have implications for the design of new forensic marker sets and for evaluations of the extent to which individual characteristics beyond identification might be predicted from current and future forensic data.

  12. Nucleo-cytoplasmic transport of proteins and RNA in plants.

    Science.gov (United States)

    Merkle, Thomas

    2011-02-01

    Transport of macromolecules between the nucleus and the cytoplasm is an essential necessity in eukaryotic cells, since the nuclear envelope separates transcription from translation. In the past few years, an increasing number of components of the plant nuclear transport machinery have been characterised. This progress, although far from being completed, confirmed that the general characteristics of nuclear transport are conserved between plants and other organisms. However, plant-specific components were also identified. Interestingly, several mutants in genes encoding components of the plant nuclear transport machinery were investigated, revealing differential sensitivity of plant-specific pathways to impaired nuclear transport. These findings attracted attention towards plant-specific cargoes that are transported over the nuclear envelope, unravelling connections between nuclear transport and components of signalling and developmental pathways. The current state of research in plants is summarised in comparison to yeast and vertebrate systems, and special emphasis is given to plant nuclear transport mutants.

  13. Transport Energy Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-07-01

    Transport is the sector with the highest final energy consumption and, without any significant policy changes, is forecast to remain so. In 2008, the IEA published 25 energy efficiency recommendations, among which four are for the transport sector. The recommendations focus on road transport and include policies on improving tyre energy efficiency, fuel economy standards for both light-duty vehicles and heavy-duty vehicles, and eco-driving. Implementation of the recommendations has been weaker in the transport sector than others. This paper updates the progress that has been made in implementing the transport energy efficiency recommendations in IEA countries since March 2009. Many countries have in the last year moved from 'planning to implement' to 'implementation underway', but none have fully implemented all transport energy efficiency recommendations. The IEA calls therefore for full and immediate implementation of the recommendations.

  14. The performance of intermodal inland waterway transport: Modeling conditions influencing its competitiveness

    NARCIS (Netherlands)

    Wiegmans, B.; Konings, J.W.

    2013-01-01

    In Europe, numerous obstacles have been identified which prevent the (extensive) use of intermodal transport. A major motivation to promote intermodal transport is that its cost performance is often assumed better than road-only transport. Considering that the cost of transport services remains one

  15. EUROPEAN MARITIME TRANSPORT POLICY

    Directory of Open Access Journals (Sweden)

    Jerzy Kujawa

    2014-03-01

    Full Text Available The article describes the common EU policy on maritime transport, which comprises almost 80% of the volume of external trade of the Union and about 40% of internal transport needs. The first part of the paper presents the origins of the common maritime transport policy and the difficulties encountered during its initial formation. Subsequently, the evolution of the concepts of the policy and its current shape is discussed. The final, substantial part of the article describes the main aims and directions of the EU maritime transport policy and includes an evaluation of the effects of the policy.

  16. RELATIVISTIC TRANSPORT-THEORY

    NARCIS (Netherlands)

    MALFLIET, R

    1993-01-01

    We discuss the present status of relativistic transport theory. Special emphasis is put on problems of topical interest: hadronic features, thermodynamical consistent approximations and spectral properties.

  17. UZ Colloid Transport Model

    Energy Technology Data Exchange (ETDEWEB)

    M. McGraw

    2000-04-13

    The UZ Colloid Transport model development plan states that the objective of this Analysis/Model Report (AMR) is to document the development of a model for simulating unsaturated colloid transport. This objective includes the following: (1) use of a process level model to evaluate the potential mechanisms for colloid transport at Yucca Mountain; (2) Provide ranges of parameters for significant colloid transport processes to Performance Assessment (PA) for the unsaturated zone (UZ); (3) Provide a basis for development of an abstracted model for use in PA calculations.

  18. Thermodynamics of ABC transporters.

    Science.gov (United States)

    Zhang, Xuejun C; Han, Lei; Zhao, Yan

    2016-01-01

    ABC transporters form the largest of all transporter families, and their structural study has made tremendous progress over recent years. However, despite such advances, the precise mechanisms that determine the energy-coupling between ATP hydrolysis and the conformational changes following substrate binding remain to be elucidated. Here, we present our thermodynamic analysis for both ABC importers and exporters, and introduce the two new concepts of differential-binding energy and elastic conformational energy into the discussion. We hope that the structural analysis of ABC transporters will henceforth take thermodynamic aspects of transport mechanisms into account as well.

  19. Moisture Transport in Wood

    DEFF Research Database (Denmark)

    Astrup, T.; Hansen, K. K.; Hoffmeyer, P.

    2005-01-01

    Modelling of moisture transport in wood is of great importance as most mechanical and physical properties of wood depend on moisture content. Moisture transport in porous materials is often described by Ficks second law, but several observations indicate that this does not apply very well to wood....... Recently at the Technical University of Denmark, Department of Civil Engineering, a new model for moisture transport in wood has been developed. The model divides the transport into two phases, namely water vapour in the cell lumens and bound water in the cell walls....

  20. Transportation Outreach Program Plan

    Energy Technology Data Exchange (ETDEWEB)

    1991-08-01

    The Department of Energy (DOE) Transportation Management Program (TMP) is committed to providing opportunities for public interaction, working cooperatively with groups interested in or affected by DOE transportation, and providing information through the development and implementation of its Outreach Program. This Plan describes how the DOE plans to involve the public in its transportation programs. This Transportation Outreach Program Plan will assist the Secretary of Energy is carrying out his vision of the good neighbor'' policy. The Department of Energy encourages face to face interaction and welcomes comments from everyone. Outreach means to go beyond,'' and the TMP, through its Outreach Program, will hear and address the public's concerns and recommendations about transportation of hazardous and radioactive materials. The TMP Outreach Program is based on a commitment to two-way communication. The TMP coordinates transportation policy for all DOE programs to ensure consistent approaches issues and operations. The TMP conducts outreach by interacting with many groups interested in DOE transportation, facilitating resolution of issues and information exchange, and coordinating the DOE's transportation emergency preparedness capabilities. Many of the specific activities in transportation outreach are usually carried out by field and area offices. 4 figs., 2 tabs.

  1. Moisture Transport in Wood

    DEFF Research Database (Denmark)

    Astrup, T.; Hansen, K. K.; Hoffmeyer, P.;

    2005-01-01

    Modelling of moisture transport in wood is of great importance as most mechanical and physical properties of wood depend on moisture content. Moisture transport in porous materials is often described by Ficks second law, but several observations indicate that this does not apply very well to wood....... Recently at the Technical University of Denmark, Department of Civil Engineering, a new model for moisture transport in wood has been developed. The model divides the transport into two phases, namely water vapour in the cell lumens and bound water in the cell walls....

  2. Hopping transport in solids

    CERN Document Server

    Pollak, M

    1991-01-01

    The hopping process, which differs substantially from conventional transport processes in crystals, is the central process in the transport phenomena discussed in this book. Throughout the book the term ``hopping'' is defined as the inelastic tunneling transfer of an electron between two localized electronic states centered at different locations. Such processes do not occur in conventional electronic transport in solids, since localized states are not compatible with the translational symmetry of crystals.The rapid growth of interest in hopping transport has followed in the footsteps of the

  3. Polar auxin transport: controlling where and how much

    Science.gov (United States)

    Muday, G. K.; DeLong, A.; Brown, C. S. (Principal Investigator)

    2001-01-01

    Auxin is transported through plant tissues, moving from cell to cell in a unique polar manner. Polar auxin transport controls important growth and developmental processes in higher plants. Recent studies have identified several proteins that mediate polar auxin transport and have shown that some of these proteins are asymmetrically localized, paving the way for studies of the mechanisms that regulate auxin transport. New data indicate that reversible protein phosphorylation can control the amount of auxin transport, whereas protein secretion through Golgi-derived vesicles and interactions with the actin cytoskeleton might regulate the localization of auxin efflux complexes.

  4. Football refereeing: Identifying innovative methods

    Directory of Open Access Journals (Sweden)

    Reza MohammadKazemi

    2014-08-01

    Full Text Available The aim of the present study is to identify the potentials innovation in football industry. Data were collected from 10 national and international referees, assistant referees and referees’ supervisors in Iran. In this study, technological innovations are identified that assist better refereeing performances. The analysis revealed a significant relationship between using new technologies and referees ‘performance. The results indicate that elite referees, assistant referees and supervisors agreed to use new technological innovations during the game. According to their comments, this kind of technology causes the referees’ performance development.

  5. Locally identifying coloring of graphs

    CERN Document Server

    Esperet, Louis; Montassier, Mickael; Ochem, Pascal; Parreau, Aline

    2010-01-01

    A vertex-coloring of a graph G is said to be locally identifying if for any pair (u,v) of adjacent vertices of G, with distinct closed neighborhood, the set of colors that appears in the closed neighborhoods of u and v are distinct. In this paper, we give several bounds on the minimum number of colors needed in such a coloring for different families of graphs (planar graphs, some subclasses of perfect graphs, graphs with bounded maximum degree) and prove that deciding whether a subcubic bipartite graph with large girth has a locally identifying coloring with 3 colors is an NP-complete problem.

  6. High fuel price: Will Indonesian shift to public transportation?

    Science.gov (United States)

    Sopha, Bertha Maya; Pamungkas, Adhiguna Ramadhani

    2016-06-01

    Public transportation has been declining over years, while on the other hand, private vehicles are dramatically increasing. The share of public transportation was 38.3% in 2002 and slowly decreasing to 12.9% in 2010. Cheap fuel price has been alleged to be the main cause for the increased private vehicles. The declining trend of public transportation needs further investigation whether higher fuel price indeed influences the choice of transportation mode. The present study therefore aims at exploring the preference of using public transportation compared to motorcycle and private car for various fuel price and identifying barriers toward public transportation. A survey was conducted in 2013 to capture the preference of each transportation mode given different fuel price. A questionnaire which was designed according to the structure of Analytical Hierarchy Process (AHP) was distributed using random sampling in ten cities in Sumatra and Java islands, Indonesia. Results indicate that the increased fuel price would not lead to significant increase of public transportation users. Motorcycle seems continuously being the dominating transportation mode in the future. On the other hand, issues resulted from limited public transportation capacity such as long travel time, security and safety issues, limited route, poor schedule appear to be the most barriers of using public transportation. It is implied that in order to promote public transportation, interventions should be introduced simultaneously at both supply (i.e., increasing public transportation capacity) and demand (i.e., high fuel price) sides. Limitations of the study are also discussed.

  7. Selective amino acid substitutions convert the creatine transporter to a gamma-aminobutyric acid transporter.

    Science.gov (United States)

    Dodd, Joanna R; Christie, David L

    2007-05-25

    The creatine transporter (CRT) is a member of a large family of sodium-dependent neurotransmitter and amino acid transporters. The CRT is closely related to the gamma-aminobutyric acid (GABA) transporter, GAT-1, yet GABA is not an effective substrate for the CRT. The high resolution structure of a prokaryotic homologue, LeuT has revealed precise details of the substrate binding site for leucine (Yamashita, A., Singh, S. K., Kawate, T., Jin, Y., and Gouaux, E. (2005) Nature 437, 215-223). We have now designed mutations based on sequence comparisons of the CRT with GABA transporters and the LeuT structural template in an attempt to alter the substrate specificity of the CRT. Combinations of two or three amino acid substitutions at four selected positions resulted in the loss of creatine transport activity and gain of a specific GABA transport function. GABA transport by the "gain of function" mutants was sensitive to nipecotic acid, a competitive inhibitor of GABA transporters. Our results show LeuT to be a good structural model to identify amino acid residues involved in the substrate and inhibitor selectivity of eukaryotic sodium-dependent neurotransmitter and amino acid transporters. However, modification of the binding site alone appears to be insufficient for efficient substrate translocation. Additional residues must mediate the conformational changes required for the diffusion of substrate from the binding site to the cytoplasm.

  8. SOCIODEMOGRAPHIC DATA USED FOR IDENTIFYING ...

    Science.gov (United States)

    Due to unique social and demographic characteristics, various segments of the population may experience exposures different from those of the general population, which, in many cases, may be greater. When risk assessments do not characterize subsets of the general population, the populations that may experience the greatest risk remain unidentified. When such populations are not identified, the social and demographic data relevant to these populations is not considered when preparing exposure estimates, which can underestimate exposure and risk estimates for at-risk populations. Thus, it is necessary for risk or exposure assessors characterizing a diverse population, to first identify and then enumerate certain groups within the general population who are at risk for greater contaminant exposures. The document entitled Sociodemographic Data Used for Identifying Potentially Highly Exposed Populations (also referred to as the Highly Exposed Populations document), assists assessors in identifying and enumerating potentially highly exposed populations. This document presents data relating to factors which potentially impact an individual or group's exposure to environmental contaminants based on activity patterns (how time is spent), microenvironments (locations where time is spent), and other socio-demographic data such as age, gender, race and economic status. Populations potentially more exposed to various chemicals of concern, relative to the general population

  9. Identifying the Gifted Child Humorist.

    Science.gov (United States)

    Fern, Tami L.

    1991-01-01

    This study attempted to identify gifted child humorists among 1,204 children in grades 3-6. Final identification of 13 gifted child humorists was determined through application of such criteria as funniness, originality, and exemplary performance or product. The influence of intelligence, development, social factors, sex differences, family…

  10. SNP interaction pattern identifier (SIPI)

    DEFF Research Database (Denmark)

    Lin, Hui-Yi; Chen, Dung-Tsa; Huang, Po-Yu

    2016-01-01

    MOTIVATION: Testing SNP-SNP interactions is considered as a key for overcoming bottlenecks of genetic association studies. However, related statistical methods for testing SNP-SNP interactions are underdeveloped. RESULTS: We propose the SNP Interaction Pattern Identifier (SIPI), which tests 45...

  11. Identifying high-risk medication

    DEFF Research Database (Denmark)

    Sædder, Eva; Brock, Birgitte; Nielsen, Lars Peter

    2014-01-01

    salicylic acid, and beta-blockers; 30 drugs or drug classes caused 82 % of all serious MEs. The top ten drugs involved in fatal events accounted for 73 % of all drugs identified. CONCLUSION: Increasing focus on seven drugs/drug classes can potentially reduce hospitalizations, extended hospitalizations...

  12. Distributed Persistent Identifiers System Design

    Directory of Open Access Journals (Sweden)

    Pavel Golodoniuc

    2017-06-01

    Full Text Available The need to identify both digital and physical objects is ubiquitous in our society. Past and present persistent identifier (PID systems, of which there is a great variety in terms of technical and social implementation, have evolved with the advent of the Internet, which has allowed for globally unique and globally resolvable identifiers. PID systems have, by in large, catered for identifier uniqueness, integrity, and persistence, regardless of the identifier’s application domain. Trustworthiness of these systems has been measured by the criteria first defined by Bütikofer (2009 and further elaborated by Golodoniuc 'et al'. (2016 and Car 'et al'. (2017. Since many PID systems have been largely conceived and developed by a single organisation they faced challenges for widespread adoption and, most importantly, the ability to survive change of technology. We believe that a cause of PID systems that were once successful fading away is the centralisation of support infrastructure – both organisational and computing and data storage systems. In this paper, we propose a PID system design that implements the pillars of a trustworthy system – ensuring identifiers’ independence of any particular technology or organisation, implementation of core PID system functions, separation from data delivery, and enabling the system to adapt for future change. We propose decentralisation at all levels — persistent identifiers and information objects registration, resolution, and data delivery — using Distributed Hash Tables and traditional peer-to-peer networks with information replication and caching mechanisms, thus eliminating the need for a central PID data store. This will increase overall system fault tolerance thus ensuring its trustworthiness. We also discuss important aspects of the distributed system’s governance, such as the notion of the authoritative source and data integrity

  13. Bronchial mucus transport

    NARCIS (Netherlands)

    van der Schans, Cees P.

    2007-01-01

    Effective clearance of inhaled particles requires mucus production and continuous mucus transport from the lower airways to the oropharynx. Mucus production takes place mainly in the peripheral airways. Mucus transport is achieved by the action of the ciliated cells that cover the inner surface of t

  14. Human peptide transporters

    DEFF Research Database (Denmark)

    Nielsen, Carsten Uhd; Brodin, Birger; Jørgensen, Flemming Steen

    2002-01-01

    Peptide transporters are epithelial solute carriers. Their functional role has been characterised in the small intestine and proximal tubules, where they are involved in absorption of dietary peptides and peptide reabsorption, respectively. Currently, two peptide transporters, PepT1 and PepT2, wh...

  15. Conservation in transportation

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-05-30

    A nationwide examination was made of grassroots energy conservation programs related to transportation. Information compiled from civic groups, trade associations, and corporations is included on driver awareness/mass transit; travel; and ride sharing. It is concluded that a willingness by the public to cooperate in transportation energy conservation exists and should be exploited. (LCL)

  16. Transport of sugars.

    Science.gov (United States)

    Chen, Li-Qing; Cheung, Lily S; Feng, Liang; Tanner, Widmar; Frommer, Wolf B

    2015-01-01

    Soluble sugars serve five main purposes in multicellular organisms: as sources of carbon skeletons, osmolytes, signals, and transient energy storage and as transport molecules. Most sugars are derived from photosynthetic organisms, particularly plants. In multicellular organisms, some cells specialize in providing sugars to other cells (e.g., intestinal and liver cells in animals, photosynthetic cells in plants), whereas others depend completely on an external supply (e.g., brain cells, roots and seeds). This cellular exchange of sugars requires transport proteins to mediate uptake or release from cells or subcellular compartments. Thus, not surprisingly, sugar transport is critical for plants, animals, and humans. At present, three classes of eukaryotic sugar transporters have been characterized, namely the glucose transporters (GLUTs), sodium-glucose symporters (SGLTs), and SWEETs. This review presents the history and state of the art of sugar transporter research, covering genetics, biochemistry, and physiology-from their identification and characterization to their structure, function, and physiology. In humans, understanding sugar transport has therapeutic importance (e.g., addressing diabetes or limiting access of cancer cells to sugars), and in plants, these transporters are critical for crop yield and pathogen susceptibility.

  17. Transportation: Topic Paper E.

    Science.gov (United States)

    National Council on the Handicapped, Washington, DC.

    As one of a series of topic papers assessing federal laws and programs affecting persons with disabilities, this paper reviews the issue of transportation services. In the area of urban mass transit, four relevant pieces of legislation and public transportation accessibility regulations are cited, and cost issues are explored. Paratransit systems,…

  18. Passenger transport research

    CSIR Research Space (South Africa)

    Mokonyama, Mathetha T

    2008-03-01

    Full Text Available In South Africa, airport and airline services epitomise what many would like to see in everyday public transport. The CSIR investigates what it will take to provide a commercial public transport service in South Africa which resembles commercial air...

  19. Human peptide transporters

    DEFF Research Database (Denmark)

    Nielsen, Carsten Uhd; Brodin, Birger; Jørgensen, Flemming Steen;

    2002-01-01

    Peptide transporters are epithelial solute carriers. Their functional role has been characterised in the small intestine and proximal tubules, where they are involved in absorption of dietary peptides and peptide reabsorption, respectively. Currently, two peptide transporters, PepT1 and PepT2...

  20. Energy technology for transport

    Energy Technology Data Exchange (ETDEWEB)

    Sloth, M. [H2 Logic (Denmark); Schroeder Pedersen, A. [Risoe National Lab. - DTU (Denmark)

    2007-11-15

    World energy demand for transport has increased significantly for many years. This trend is projected to continue in the years to come, one reason being that large and rapidly developing economies bring increasing demand for the transport of goods and people, including rising transport demand due to greater integration of developing countries in the international trade. Transport not only account for approximately 20 % of the total world energy consumption, but is almost entirely based on limited and expensive fossil energy resources. Technology development and economic incentives are key areas in bringing clean energy to the transportation sector. This chapter recommends that technology development must aim to make each link of the energy conversion chain cheaper, cleaner and more efficient. It should be driven by public-private partnerships, with a funding basis balance that reflects the nearness of each technology to commercial application. Onboard storage, for instance, still needs basic research, whereas fuel cells are already competitive in certain markets. For consumers, fossil fuels are certain to remain the cheapest option for transport as long as energy prices do not reflect the cost of environmental damage. To reduce CO{sub 2} emissions from transport, governments are recommended to set up strong economic or other incentives to encourage consumers to opt for low-carbon vehicles or public transport. As well as reducing environmental damage, such measures could generate money to support research and development in clean energy technologies. (BA)

  1. Sustainable Inland Transportation

    NARCIS (Netherlands)

    Bloemhof, J.M.; Laan, van der E.A.; Beijer, C.

    2011-01-01

    Inland navigation is often mentioned as a ‘green’ alternative for the two other main inland transport modes: rail and road transport. In order to investigate the opportunities for inland navigation we first analyze the competitive position of inland navigation vis-à-vis the other main inland transpo

  2. Sustainable Inland Transportation

    NARCIS (Netherlands)

    Bloemhof, J.M.; Laan, van der E.A.; Beijer, C.

    2011-01-01

    Inland navigation is often mentioned as a ‘green’ alternative for the two other main inland transport modes: rail and road transport. In order to investigate the opportunities for inland navigation we first analyze the competitive position of inland navigation vis-à-vis the other main inland transpo

  3. New prospects of transportation mobility

    OpenAIRE

    Cheng-Min Feng

    2014-01-01

    The demand for improving the quality and efficiency of transportation service has been growing, and new technologies have been entering the market at a rapid pace. Creative thinking and approaches are increasingly important for governments in shaping their transportation policy and actions. This paper aims to discuss several challenges pertaining to the topic, including instant transportation, sharing transportation, fast transportation, resilient transportation, affordable transportation, an...

  4. Charge Injection and Transport in Conjugated Polymers.

    Science.gov (United States)

    Malliaras, George

    2007-03-01

    We will overview the state-of-the-art in our understanding of charge injection and transport in conjugated polymers. We start by discussing the identifying characteristics of this class of materials, especially in relation with their structure and morphology. We follow by reviewing the advantages and limitations of experimental techniques that are used to probe charge transport. We then embark on a discussion of the fundamentals of charge transport in organics. We follow a didactic approach, where we start from transport in crystalline semiconductors and gradually introduce corrections for space charge effects, for the influence of disorder on mobility, for high charge densities, and for electric field-dependent charge densities. We compare with experimental data from polyfluorenes. We then shift our attention to charge injection. We review some of the recent theories and compared their predictions to experimental data, again from polyfluorenes. We close by proposing directions for future work.

  5. Lagrangian coherent structures and plasma transport processes

    CERN Document Server

    Falessi, M V; Schep, T J

    2015-01-01

    A dynamical system framework is used to describe transport processes in plasmas embedded in a magnetic field. For periodic systems with one degree of freedom the Poincar\\'e map provides a splitting of the phase space into regions where particles have different kinds of motion: periodic, quasi-periodic or chaotic. The boundaries of these regions are transport barriers; i.e., a trajectory cannot cross such boundaries during the whole evolution of the system. Lagrangian Coherent Structure (LCS) generalize this method to systems with the most general time dependence, splitting the phase space into regions with different qualitative behaviours. This leads to the definition of finite-time transport barriers, i.e. trajectories cannot cross the barrier for a finite amount of time. This methodology can be used to identify fast recirculating regions in the dynamical system and to characterize the transport between them.

  6. Surface transport in plasma-balls

    CERN Document Server

    Armas, Jay; Kundu, Nilay

    2015-01-01

    We study the surface transport properties of stationary localized configurations of relativistic fluids to the first two non-trivial orders in a derivative expansion. By demanding that these finite lumps of relativistic fluid are described by a thermal partition function with arbitrary stationary background metric and gauge fields, we are able to find several constraints among surface transport coefficients. At leading order, besides recovering the surface thermodynamics, we obtain a generalization of the Young-Laplace equation for relativistic fluid surfaces, by considering a temperature dependence in the surface tension, which is further generalized in the context of superfluids. At the next order, for uncharged fluids in 3+1 dimensions, we show that besides the 3 independent bulk transport coefficients previously known, a generic localized configuration is characterized by 3 additional surface transport coefficients, one of which may be identified with the surface modulus of rigidity. Finally, as an applic...

  7. Sugar Transport and Metabolism in Thermotoga

    Energy Technology Data Exchange (ETDEWEB)

    Noll, Kenneth M.; Romano, Antonio H.

    2003-02-11

    The work conducted under this grant demonstrated that the hyperthermophilic bacterium Thermotoga neapolitana carries out glucose and lactose transport in a sodium-dependent manner and that energization of anaerobic cells is required to observe transport. We also demonstrated that Thermotoga maritima carries out maltose and glucose transport using periplasmic sugar binding proteins. We began defining patterns of expression of genes encoding sugar transport and catabolic functions in both T. maritima and T. neapolitana. We began a collaborative effort to identify all the genes regulated at the transcriptional level in response to sugars substrates. These funds also allowed us to begin an examination of the functions of several periplasmic substrate binding proteins encoded in the genome of T. maritima.

  8. Transport Phenomena During Equiaxed Solidification of Alloys

    Science.gov (United States)

    Beckermann, C.; deGroh, H. C., III

    1997-01-01

    Recent progress in modeling of transport phenomena during dendritic alloy solidification is reviewed. Starting from the basic theorems of volume averaging, a general multiphase modeling framework is outlined. This framework allows for the incorporation of a variety of microscale phenomena in the macroscopic transport equations. For the case of diffusion dominated solidification, a simplified set of model equations is examined in detail and validated through comparisons with numerous experimental data for both columnar and equiaxed dendritic growth. This provides a critical assessment of the various model assumptions. Models that include melt flow and solid phase transport are also discussed, although their validation is still at an early stage. Several numerical results are presented that illustrate some of the profound effects of convective transport on the final compositional and structural characteristics of a solidified part. Important issues that deserve continuing attention are identified.

  9. Transport, environment and sustainability

    DEFF Research Database (Denmark)

    Joumard, Robert; Gudmundsson, Henrik; Kehagia, Fotini

    2010-01-01

    support tools are discussed. We define what "environmental sustainability in transport" may mean through the transport system, the concepts of sustainable development and of environment. The concept of 'chain of causality' between a source and a final target is developed, as a common reference...... as well as multi-criteria methods. Five case studies are presented. Finally, recommendations for continued research and development of indicators and joint considerations methods for assessment of environmental sustainability in transport are given.......This report is the final report of the action COST 356 'EST - Towards the definition of a measurable environmentally sustainable transport'. It tries to answer the following questions: How can environmental impacts of transport be measured? How can measurements be transformed into operational...

  10. Structure and Mechanism of a Pentameric Formate Channel

    Energy Technology Data Exchange (ETDEWEB)

    Waight, A.; Love, J; Wang, D

    2010-01-01

    Formate transport across the inner membrane is a critical step in anaerobic bacterial respiration. Members of the formate/nitrite transport protein family function to shuttle substrate across the cytoplasmic membrane. In bacterial pathogens, the nitrite transport protein is involved in protecting bacteria from peroxynitrite released by host macrophages. We have determined the 2.13-{angstrom} structure of the formate channel FocA from Vibrio cholerae, which reveals a pentamer in which each monomer possesses its own substrate translocation pore. Unexpectedly, the fold of the FocA monomer resembles that found in water and glycerol channels. The selectivity filter in FocA consists of a cytoplasmic slit and a central constriction ring. A 2.5-{angstrom} high-formate structure shows two formate ions bound to the cytoplasmic slit via both hydrogen bonding and van der Waals interactions, providing a structural basis for the substrate selectivity of the channel.

  11. BEST Project: bioethanol for sustainable transportation; Projeto BEST: bioetanol para o transporte sustentavel

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, J.R.; Velazquez, S.M.S.G.; Apolinario, S.M.; Melo, E.H.; Elmadjian, P.H. [Universidade de Sao Paulo (IEE/CENBIO/USP), SP (Brazil). Inst. de Eletrotecnica e Energia. Centro Nacional de Referencia em Biomassa

    2008-07-01

    The BEST Project BioEthanol for Sustainable Transport aims to promote the ethanol usage, replacing diesel, in the urban public transport in Brazil and worldwide. Apart from Sao Paulo, leading city in the Americas, another eight cities located in Europe and Asia takes part in the project. One of the Brazilian project's goals is to evaluate ethanol usage as diesel fuel replacement in public transport buses by comparatively following the operational output of the experimental fleet, taking as reference an equivalent diesel bus. The utilized test vehicles will be evaluated and monitored to demonstrate ethanol energetic efficiency and, after the results the BEST project and the European Union will set a blue print for public policies to incentive ethanol usage in the urban public transport. The results will allow identifying technical and economical barriers that will eventually overlap the viability process of this technology in the Brazilian public transport. (author)

  12. Identifying patient risks during hospitalization

    Directory of Open Access Journals (Sweden)

    Lucélia Ferreira Lima

    2008-12-01

    Full Text Available Objective: To identify the risks reported at a public institution andto know the main patient risks from the nursing staff point of view.Methods: A retrospective, descriptive and exploratory study. Thesurvey was developed at a hospital in the city of Taboão da Serra, SãoPaulo, Brazil. The study included all nurses working in care areas whoagreed to participate in the study. At the same time, sentinel eventsoccurring in the period from July 2006 to July 2007 were identified.Results: There were 440 sentinel events reported, and the main risksincluded patient falls, medication errors and pressure ulcers. Sixty-fivenurses were interviewed. They also reported patient falls, medicationerrors and pressure ulcers as the main risks. Conclusions: Riskassessment and implementation of effective preventive actions arenecessary to ensure patient’s safety. Involvement of a multidisciplinaryteam is one of the steps for a successful process.

  13. Sparse Linear Identifiable Multivariate Modeling

    DEFF Research Database (Denmark)

    Henao, Ricardo; Winther, Ole

    2011-01-01

    In this paper we consider sparse and identifiable linear latent variable (factor) and linear Bayesian network models for parsimonious analysis of multivariate data. We propose a computationally efficient method for joint parameter and model inference, and model comparison. It consists of a fully...... Bayesian hierarchy for sparse models using slab and spike priors (two-component δ-function and continuous mixtures), non-Gaussian latent factors and a stochastic search over the ordering of the variables. The framework, which we call SLIM (Sparse Linear Identifiable Multivariate modeling), is validated...... and bench-marked on artificial and real biological data sets. SLIM is closest in spirit to LiNGAM (Shimizu et al., 2006), but differs substantially in inference, Bayesian network structure learning and model comparison. Experimentally, SLIM performs equally well or better than LiNGAM with comparable...

  14. Logistic innovations in transport

    Directory of Open Access Journals (Sweden)

    Mirosław Antonowicz

    2014-03-01

    Full Text Available Introduction: The article discusses the issue of logistic innovations in transport. The essentials of logistic innovations in transport together with some examples of specific innovations are presented. The role of the client's needs in transport innovations is indicated. The most vital postulates affecting the innovativeness of shipping companies and derived from the author's experience as well as scholarly publications, are time, safety, reliability as well as comprehensiveness of service offer. Following the analysis of the issue, and on the grounds of Kaizen's and Lean's method, the concept of continuous innovations is suggested as very useful for the development of transport. The potential of clusters as the source of logistic innovations in transport is emphasised. Methods: The discussion of the issue was preceded by the author's analysis of written sources on innovativeness, the evaluation of ratings of innovativeness as well as the analysis of rewarded innovative solutions in transport subsequent to the businesses participation in the programme of innovative solutions in transport. The role of innovation practical business operations is argued following the analysis of some strategic documents such as: 2011 White Paper and the Strategy for the Development of Transport by 2020 adopted by the Polish government in 2013. Aim: The aim of the article is to present the role and significance of the issue of logistic innovations in transport and to cite instances of practical solutions implemented by shipping companies, the solutions which resulted in measurable effects. Following the author's observation of the instances of innovative solutions as well as his analysis of the ratings of innovativeness, the article aims to present the conclusions as for the specific kinds of activities which are indispensable to foster innovativeness in transport. Conclusions: The conclusions derived from the author's analyses and observations show that logistic

  15. Neutron transport simulation (selected topics)

    Energy Technology Data Exchange (ETDEWEB)

    Vaz, P. [Instituto Tecnologico e Nuclear, Estrada Nacional 10, P-2686-953 Sacavem (Portugal)], E-mail: pedrovaz@itn.pt

    2009-10-15

    Neutron transport simulation is usually performed for criticality, power distribution, activation, scattering, dosimetry and shielding problems, among others. During the last fifteen years, innovative technological applications have been proposed (Accelerator Driven Systems, Energy Amplifiers, Spallation Neutron Sources, etc.), involving the utilization of intermediate energies (hundreds of MeV) and high-intensity (tens of mA) proton accelerators impinging in targets of high Z elements. Additionally, the use of protons, neutrons and light ions for medical applications (hadrontherapy) impose requirements on neutron dosimetry-related quantities (such as kerma factors) for biologically relevant materials, in the energy range starting at several tens of MeV. Shielding and activation related problems associated to the operation of high-energy proton accelerators, emerging space-related applications and aircrew dosimetry-related topics are also fields of intense activity requiring as accurate as possible medium- and high-energy neutron (and other hadrons) transport simulation. These applications impose specific requirements on cross-section data for structural materials, targets, actinides and biologically relevant materials. Emerging nuclear energy systems and next generation nuclear reactors also impose requirements on accurate neutron transport calculations and on cross-section data needs for structural materials, coolants and nuclear fuel materials, aiming at improved safety and detailed thermal-hydraulics and radiation damage studies. In this review paper, the state-of-the-art in the computational tools and methodologies available to perform neutron transport simulation is presented. Proton- and neutron-induced cross-section data needs and requirements are discussed. Hot topics are pinpointed, prospective views are provided and future trends identified.

  16. Neutron transport simulation (selected topics)

    Science.gov (United States)

    Vaz, P.

    2009-10-01

    Neutron transport simulation is usually performed for criticality, power distribution, activation, scattering, dosimetry and shielding problems, among others. During the last fifteen years, innovative technological applications have been proposed (Accelerator Driven Systems, Energy Amplifiers, Spallation Neutron Sources, etc.), involving the utilization of intermediate energies (hundreds of MeV) and high-intensity (tens of mA) proton accelerators impinging in targets of high Z elements. Additionally, the use of protons, neutrons and light ions for medical applications (hadrontherapy) impose requirements on neutron dosimetry-related quantities (such as kerma factors) for biologically relevant materials, in the energy range starting at several tens of MeV. Shielding and activation related problems associated to the operation of high-energy proton accelerators, emerging space-related applications and aircrew dosimetry-related topics are also fields of intense activity requiring as accurate as possible medium- and high-energy neutron (and other hadrons) transport simulation. These applications impose specific requirements on cross-section data for structural materials, targets, actinides and biologically relevant materials. Emerging nuclear energy systems and next generation nuclear reactors also impose requirements on accurate neutron transport calculations and on cross-section data needs for structural materials, coolants and nuclear fuel materials, aiming at improved safety and detailed thermal-hydraulics and radiation damage studies. In this review paper, the state-of-the-art in the computational tools and methodologies available to perform neutron transport simulation is presented. Proton- and neutron-induced cross-section data needs and requirements are discussed. Hot topics are pinpointed, prospective views are provided and future trends identified.

  17. Globalisation and transport

    Energy Technology Data Exchange (ETDEWEB)

    Ubbels, B.; Rodenburg, C.; Nijkamp, P. [Department of Spatial Economics, Vrije Universiteit, Amsterdam (Netherlands)

    2001-02-01

    The relationship between globalisation and traffic volume is a complex one for many reasons. The transport sector is influenced by a variety of developments at different scales. Increasing incomes, more leisure time, new technology and a greying population are only a few examples of trends that are influencing future developments in transport and traffic. The future of transport is thus very uncertain. The project GITAGE (Globalisation, International Transport and the Global Environment) is being conducted by the Vrije Universteit Amsterdam, TRAIL (Delft University), the Netherlands Central Planning Bureau (CPB) and IVM (Institute for Environmental Studies). It was within this context that a layered assessment model was used to attempt to chart the possible influence of globalisation on the transport sector in terms of transport flows: and CO2 emissions. Four future scenarios at different scales (Global, European and Netherlands) produced virtually everywhere a (steep) rise in transport and emissions. The introduction of focused policy can change this picture. In fact, however, in most cases only a combination of stringent environmental policy and an environmentally conscious vision of the future can lead to a decline in CO2 emissions between 1995 and 2020.

  18. Solving Hitchcock's transportation problem by a genetic algorithm

    Institute of Scientific and Technical Information of China (English)

    CHEN Hai-feng; CHO Joong Rae; LEE Jeong.Tae

    2004-01-01

    Genetic algorithms (GAs) employ the evolutionary process of Darwin's nature selection theory to find the solutions of optimization problems. In this paper, an implementation of genetic algorithm is put forward to solve a classical transportation problem, namely the Hitchcock's Transportation Problem (HTP), and the GA is improved to search for all optimal solutions and identify them automatically. The algorithm is coded with C++ and validated by numerical examples. The computational results show that the algorithm is efficient for solving the Hitchcock's transportation problem.

  19. Globalisation and Air Transportation Industry: A Case Study of Malaysia

    OpenAIRE

    Kamaruddin, Shahrul Kamal

    2010-01-01

    Air transportation remains a large and growing industry that is central to the globalisation process. The globalisation impact on the air transportation industry remains largely focused on the airlines, while the impact on airports is rarely defined. The objective of this research is to identify the processes of globalisation that impact the air transportation industry specifically on airport development and operations that will greatly influence the changing nature of airports. A survey ques...

  20. VIMT: The Next-Generation Media transport Standard

    Institute of Scientific and Technical Information of China (English)

    Gerard Femando

    2012-01-01

    In this paper, we discuss the development of MPEG media transport (MMT), which is a next-generation media transport standard effort by ISQ/MPEG. The architecture and functional areas of MMT are described. The functionality of existing media transport is analyzed to determine whether there is a need for this new media standard. From this analysis, potential areas for standardization in MMT have been identified.

  1. Transports and environment; Transports et environnements

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2004-07-01

    In the framework of the greenhouse gases reduction, this study proposes many advices to control the fuel consumption of the vehicles and to change habits in the transportation sector. It presents also the alternatives to the pollutant today vehicles in the domain of the vehicles and buses fuels but also the new motors. Many Internet addresses are provided to complete the presentation. (A.L.B.)

  2. Regulators of Slc4 bicarbonate transporter activity

    Directory of Open Access Journals (Sweden)

    Ian M. Thornell

    2015-06-01

    Full Text Available The Slc4 family of transporters is comprised of anion exchangers (AE1-4, Na-coupled bicarbonate transporters (NCBTs including electrogenic Na/bicarbonate cotransporters (NBCe1 and NBCe2, electroneutral Na/bicarbonate cotransporters (NBCn1 and NBCn2, and the electroneutral Na-driven Cl-bicarbonate exchanger (NDCBE, as well as a borate transporter (BTR1. These transporters regulate intracellular pH (pHi and contribute to steady-state pHi, but are also involved in other physiological processes including CO2 carriage by red blood cells and solute secretion/reabsorption across epithelia. Acid-base transporters function as either acid extruders or acid loaders, with the Slc4 proteins moving HCO3– either into or out of cells. According to results from both molecular and functional studies, multiple Slc4 proteins and/or associated splice variants with similar expected effects on pHi are often found in the same tissue or cell. Such apparent redundancy is likely to be physiologically important. In addition to regulating pHi, a HCO3– transporter contributes to a cell’s ability to fine tune the intracellular regulation of the cotransported/exchanged ion(s (e.g., Na+ or Cl–. In addition, functionally similar transporters or splice variants with different regulatory profiles will optimize pH physiology and solute transport under various conditions or within subcellular domains. Such optimization will depend on activated signaling pathways and transporter expression profiles. In this review, we will summarize and discuss both classical and more recently identified regulators of the Slc4 proteins. Some of these regulators include traditional second messengers, lipids, binding proteins, autoregulatory domains, and less conventional regulators. The material presented will provide insight into the diversity and physiological significance of multiple members within the Slc4 gene family.

  3. Transport Coefficients of Fluids

    CERN Document Server

    Eu, Byung Chan

    2006-01-01

    Until recently the formal statistical mechanical approach offered no practicable method for computing the transport coefficients of liquids, and so most practitioners had to resort to empirical fitting formulas. This has now changed, as demonstrated in this innovative monograph. The author presents and applies new methods based on statistical mechanics for calculating the transport coefficients of simple and complex liquids over wide ranges of density and temperature. These molecular theories enable the transport coefficients to be calculated in terms of equilibrium thermodynamic properties, and the results are shown to account satisfactorily for experimental observations, including even the non-Newtonian behavior of fluids far from equilibrium.

  4. Transporte del paciente politraumatizado

    OpenAIRE

    J. López Bayón; A. Medina Villanueva; A. Concha Torre

    2008-01-01

    Tal como se ha explicado en otros capítulos, en el paciente pediátrico politraumatizado es fundamental una buena evaluación y reanimación inicial. Pero tan importante como estos puntos son la categorización y el transporte al centro más adecuado para un tratamiento definitivo. Por otra parte, el niño tiene unas características físicas y fisiológicas muy diferentes que hacen que el transporte pediátrico y la ventilación mecánica (VM) durante dicho transporte tengan una serie de particulari...

  5. Quantum Transport in Semiconductors

    Science.gov (United States)

    1991-10-01

    SRS i 91 4. TITLE AND SUBTITLE Quantum Transport in Semiconductors 5. FUNDING NUMBER söMtos-rizk-ooss 6. AUTHOR(S) D. K. Ferry ©fte ELECTE...OF ABSTRACT UL NSN 7540-01-280-5500 O 1 9 Standard Form 298 (Rev. 2-89) Presented by ANSI Std «9-18 298-102 Final Report Quantum Transport in... Quantum Transport in Semiconductor Devices This final report describes a program of research investigating quantum effects which become important in

  6. Inositol transport proteins.

    Science.gov (United States)

    Schneider, Sabine

    2015-04-28

    The cyclic polyol myo-inositol is a key molecule in many different metabolic pathways among all organisms; in addition, it is fundamental for osmotic balance in the mammalian brain. This review sums up inositol transporters from eukaryotic organisms, elucidating their vital role in regulating the intracellular distribution and uptake of inositol. They can be divided into two groups according to their transport mechanisms: (1) sodium ion coupled inositol transporters that belong to the Solute Carrier Families 5 and 6-like Superfamily and, (2) proton coupled inositol symporters that are members of the Major Facilitator Superfamily. Intriguingly members of both families offer promising targets for medical treatment of a variety of diseases.

  7. Critical care transport.

    Science.gov (United States)

    Williams, Kenneth A; Sullivan, Francis M

    2013-12-03

    Critical care transport (CCT) is the segment of the Emergency Medical Services (EMS) system that transports patients who are critically ill or injured. Nearly 1,000 medical helicopters affiliated with over 300 transport programs, hundreds of fixed-wing aircraft, and many, many ground ambulances assisting adult, pediatric and neonatal CCT teams are operating in the United States.1 This article reviews the history of and indications for CCT, team qualifications, vehicle options, safety, CCT system design, and physician involvement in CCT. It concludes with a brief review of CCT services in Rhode Island.

  8. Identifying flares in rheumatoid arthritis

    DEFF Research Database (Denmark)

    Bykerk, Vivian P; Bingham, Clifton O; Choy, Ernest H

    2016-01-01

    Set. METHODS: Candidate flare questions and legacy measures were administered at consecutive visits to Canadian Early Arthritis Cohort (CATCH) patients between November 2011 and November 2014. The American College of Rheumatology (ACR) core set indicators were recorded. Concordance to identify flares...... to flare, with escalation planned in 61%. CONCLUSIONS: Flares are common in rheumatoid arthritis (RA) and are often preceded by treatment reductions. Patient/MD/DAS agreement of flare status is highest in patients worsening from R/LDA. OMERACT RA flare questions can discriminate between patients with...

  9. Identifying the health conscious consumer.

    Science.gov (United States)

    Kraft, F B; Goodell, P W

    1993-01-01

    Individuals who lead a "wellness-oriented" lifestyle are concerned with nutrition, fitness, stress, and their environment. They accept responsibility for their health and are excellent customers for health-related products and services. Those who lack a wellness orientation are identified as higher health risks and become candidates for health promotion program intervention. The authors report a new scale by which to measure the wellness-oriented lifestyle. Scale development procedures are detailed, followed by information from five studies that support its validity. The authors suggest ways health care marketers may use the Wellness Scale to segment and target potential customers and position their products and services.

  10. Transport Fitness of Cull Sows and Boars: A Comparison of Different Guidelines on Fitness for Transport

    Science.gov (United States)

    Grandin, Temple

    2016-01-01

    Simple Summary Breeding sows and boars that are shipped to slaughter, auctions, or buying stations have a greater risk for welfare problems because they are older animals. Sows are sold when they fail to rebreed, are too thin or have difficulty walking. The transport guidelines of four organizations were compared. Most guidelines typically do not allow transport of non-ambulatory, severely injured animals or sows likely to give birth. The guidelines were less likely to agree on transport of extremely thin sows. Abstract Sows and boars that have reached the end of their productive lives have a greater risk for welfare problems. This paper reviews literature on culling reasons that may affect the animals’ fitness for transport. The top two reasons identified for culling boars were: obesity and reproductive problems. Sows are most often culled due to lameness, low body condition, or failure to rebreed. The OIE (World Organization for Animal Health) fitness for transport guidelines that would apply to sows and boars were compared with documents from the Canadian Code of Practice, Northern American Meat Institute (NAMI), EU-UK-DEFRA (European Union-United Kingdom, Dept. Environment, Food and Rural Affairs), U.S. National Pork Board, European Practical Guidelines to Assess Fitness for Transport of Pigs, and U.S. Pork Trucker Quality Assurance. The guidelines had the greatest agreement on the following fitness for transport issues: non-ambulatory, severely injured animals, sows in the last ten percent of pregnancy and sows with uterine prolapses were not fit for transport. There was less agreement on low body condition. One of the reasons for the lack of agreement is that there were stakeholders who specialized in transporting and processing extremely thin animals. A standard that would severely restrict the transport and slaughter of these animals could hinder the business practices of these stakeholders. Many welfare specialists would agree that some of these animals

  11. Featured Image: Identifying Weird Galaxies

    Science.gov (United States)

    Kohler, Susanna

    2017-08-01

    Hoags Object, an example of a ring galaxy. [NASA/Hubble Heritage Team/Ray A. Lucas (STScI/AURA)]The above image (click for the full view) shows PanSTARRSobservationsof some of the 185 galaxies identified in a recent study as ring galaxies bizarre and rare irregular galaxies that exhibit stars and gas in a ring around a central nucleus. Ring galaxies could be formed in a number of ways; one theory is that some might form in a galaxy collision when a smaller galaxy punches through the center of a larger one, triggering star formation around the center. In a recent study, Ian Timmis and Lior Shamir of Lawrence Technological University in Michigan explore ways that we may be able to identify ring galaxies in the overwhelming number of images expected from large upcoming surveys. They develop a computer analysis method that automatically finds ring galaxy candidates based on their visual appearance, and they test their approach on the 3 million galaxy images from the first PanSTARRS data release. To see more of the remarkable galaxies the authors found and to learn more about their identification method, check out the paper below.CitationIan Timmis and Lior Shamir 2017 ApJS 231 2. doi:10.3847/1538-4365/aa78a3

  12. Economical Logistics Transportation planning Case

    Institute of Scientific and Technical Information of China (English)

    王蓉

    2014-01-01

    Transportation is one of the most important nodes of supply chain. Economical transportation planning enables enterprises to reduce cost and perhaps optimize supply chain. This report clarifies the optimization of the transport node with a door-door project.

  13. Transportation of Hazardous Materials Emergency Preparedness Hazards Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    2000-02-28

    This report documents the Emergency Preparedness Hazards Assessment (EPHA) for the Transportation of Hazardous Materials (THM) at the Department of Energy (DOE) Savannah River Site (SRS). This hazards assessment is intended to identify and analyze those transportation hazards significant enough to warrant consideration in the SRS Emergency Management Program.

  14. Characterisation of CMP-sialic acid transporter substrate recognition

    NARCIS (Netherlands)

    Maggioni, A.; Itzstein, M. von; Guzman, I.B. Rodriguez; Ashikov, A.M.; Stephens, A.S.; Haselhorst, T.; Tiralongo, J.

    2013-01-01

    CMP-sialic acid transporter: We report an in-depth, multidisciplinary, structural study that has identified the amino acid residues intimately involved in CMP-sialic acid transporter (CST) substrate specificity. Our data provide a significant contribution towards a better understanding the structure

  15. Two nucleoside transporters in Lactococcus lactis with different substrate specificities

    DEFF Research Database (Denmark)

    Martinussen, Jan; Sørensen, Claus; Jendresen, Christian Bille

    2010-01-01

    at both genetic and physiological level, using mutagenesis and by measuring the growth and uptake of nucleosides in the different mutants supplemented with different nucleosides. Two high affinity transporters were identified: BmpA-NupABC was shown to be an ABC transporter with the ability to actively...

  16. Assessment of Logistics effects from Transport Infrastructure Investments

    DEFF Research Database (Denmark)

    Holvad, Torben; Salling, Kim Bang

    2004-01-01

    on the basis of the importance of this research area from a societal and economic viewpoint. This paper aims to identify a framework for assessment of logistic effects from transport infrastructure investment such that these effects can be integrated into the appraisal methodologies. Particular attention...... Transport (CLG) http://www.ctt.dtu.dk/projects/clg/. Finally, section 5 presents conclusions and the research perspective....

  17. Substrate recognition by the 2-hydroxycarboxylate transport proteins

    NARCIS (Netherlands)

    Bandell, Michael

    2000-01-01

    The object of the research described in this thesis was to identify substrate-protein interactions that provide affinity and specificity for CitPLEME from Lc.mesenteroides and MlePLALA form L.lactis. The ability of these transporters to transport substrates that differ in structure and charge implie

  18. Prehospital transported patients

    DEFF Research Database (Denmark)

    Bech, Camilla Louise Nørgaard; Brabrand, M.; Lassen, Annmarie Touborg

    2015-01-01

    Introduction The survival of patients transported by ambulance to the emergency department (ED) depends on clinical conditions, patient-related factors and organisational prehospital set up. Data and information concerning patients in the prehospital system could form a valuable resource for asse......Introduction The survival of patients transported by ambulance to the emergency department (ED) depends on clinical conditions, patient-related factors and organisational prehospital set up. Data and information concerning patients in the prehospital system could form a valuable resource......-time ambulance transport to the ED at Odense University Hospital in the period 1 April 2012 to 30 September 2013. Ambulance personnel recorded vital signs and other clinical findings on a structured form on paper during the ambulance transport. Each contact was linked to information from population...

  19. Molecular electronic junction transport

    DEFF Research Database (Denmark)

    Solomon, Gemma C.; Herrmann, Carmen; Ratner, Mark

    2012-01-01

    Whenasinglemolecule,oracollectionofmolecules,isplacedbetween two electrodes and voltage is applied, one has a molecular transport junction. We discuss such junctions, their properties, their description, and some of their applications. The discussion is qualitative rather than quantitative, and f...

  20. Cooperative Transport Planning

    NARCIS (Netherlands)

    Zutt, J.; De Weerdt, M.M.

    2000-01-01

    To test and compare different forms of cooperative planning algorithms developed in the CABS project we use a generic simulator called MARS. Examples in the transportation sector are implemented in this simulator.

  1. Transportation Security Administration

    Science.gov (United States)

    ... content Official website of the Department of Homeland Security Transportation Security Administration A - Z Index What Can I Bring? ... form Search the Site Main menu Administrator Travel Security Screening Special Procedures TSA Pre✓® Passenger Support Travel ...

  2. Urban transportation projects conceptualised:

    DEFF Research Database (Denmark)

    Pineda, Andres Felipe Valderrama

    During the last ten years two innovations in urban transportation have been accomplished in two different parts of the planet: in the city of Bogotá, in Colombia, the first mass bus rapid transit system was designed, built and put into operation becoming the most visible icon of a great urban...... is straightforward: transportation projects transform cities. The paradoxical reality thus is that a problem that has been traditionally conceptualized in technical terms (transportation engineering, transportation economics, planning theory, traffic engineering, urban planning, etc.), has tremendous consequences...... idea underlying all this approaches is that cities, policies and their support systems co-evolve in permanent interaction shaping one another. Thus, if change is to be produced in desired ways actions must be taken in all fronts to render a desired result. In a wider perspective this approach to urban...

  3. Transportation Emissions: some basics

    DEFF Research Database (Denmark)

    Kontovas, Christos A.; Psaraftis, Harilaos N.

    2016-01-01

    Transportation is the backbone of international trade and a key engine driving globalization. However, there is growing concern that the Earth’s atmospheric composition is being altered by human activities, including transportation, which can lead to climate change. Air pollution from...... transportation and especially carbon dioxide emissions are at the center stage of discussion by the world community through various international treaties, such as the Kyoto Protocol. The transportation sector also emits non-CO2 pollutants that have important effects on air quality, climate, and public health...... and its contribution to climate change. In addition, this chapter presents the basics of environmental policy measures. In that context, we describe a way to measure the cost-effectiveness of various measures through the so-called Marginal Abatement Cost (MAC). Finally, the chapter deals with the topic...

  4. Energy and transportation(*

    Directory of Open Access Journals (Sweden)

    Hermans J.

    2015-01-01

    Full Text Available Transportation takes a considerable and increasing fraction of the energy use worldwide, and more than half the oil consumption. By far the largest part is used by cars powered by internal combustion engines. The advantage of using internal combustion engines is that the energy density of liquid fuels is extremely high. The disadvantage is that gasoline and diesel engines have a poor performance: 20 to 25% only. How does this compare with electric cars? What are the alternative transportation systems and their efficiencies anyway? In this lecture we analyse the efficiency of various transport systems, using elementary physics principles. We will look at cars, buses, trains and TGVs, ships and aircraft. In addition, the efficiency of human powered vehicles will be considered. New and promising developments in the field of Intelligent Transportation Systems, like Cooperative Adaptive Cruise Control, are also discussed.

  5. Planning Public Transport

    DEFF Research Database (Denmark)

    Andersen, Jonas Lohmann Elkjær; Landex, Alex

    2009-01-01

    This good practice guide is composed for the master course 13120 Public Transport Planning held at the Department of Transport, Technical University of Denmark. It is intended to use as guide in the different planning aspects and assignments of the course. Since the course is about the planning...... of new public transport infrastructure this guide also focuses on the planning of new infrastructure. Furthermore, the new infrastructure in the course is expected to be a light rail and even though this guide aims at being general for public transport some of the issues evidently become more relevant...... for light rail. A light rail system is chosen as focus because light rail systems generally have higher impacts in the traffic modeling than busses and are more challenging in the planning than urban rail and metro. This is emanated by the assumption that a capability for planning light rail inevitable...

  6. Appraisal of Transport Projects

    DEFF Research Database (Denmark)

    Jensen, Anders Vestergaard

    The evaluation of transport projects has traditionally been based on quantitative descriptions of selected impacts by the use of cost-benefit analysis (CBA). However, environmental impacts are now taking into consideration when decisions have to be made, regarding which large transport projects...... complexity. Optimisation has been replaced with satisficing, where satisficing is defined as finding an acceptable or satisfactory solution to a problem instead of a socio-economical optimal solution. This calls for new approaches of appraising transport projects that goes beyond what the classical CBA......, seems suitable for. As a result of the above mentioned issues regarding conflict of interests, multiple impacts, participation of stakeholders, and sustainability, additional approaches for appraisal have been suggested. Multi-criteria decision analysis (MCDA) has been introduced in the transport...

  7. Appraisal of Transport Projects

    DEFF Research Database (Denmark)

    Jensen, Anders Vestergaard

    be dealt with by the use of sensitivity analysis and robustness measures. This also calls for an appraisal methodology which is transparent and able to include the different preferences among experts, the public, and stakeholders. This PhD thesis has three main focuses concerning appraisal of transport...... papers written during the PhD study. The potential for transport appraisal demonstrated in this PhD study can be listed in the following main findings. • To reconcile socio-economic analysis and public acceptance it can be recommended to widen the appraisal methodology. • When widening the appraisal......The evaluation of transport projects has traditionally been based on quantitative descriptions of selected impacts by the use of cost-benefit analysis (CBA). However, environmental impacts are now taking into consideration when decisions have to be made, regarding which large transport projects...

  8. Transport statistics 1996

    CSIR Research Space (South Africa)

    Shepperson, L

    1997-12-01

    Full Text Available This publication contains transport and related statistics on roads, vehicles, infrastructure, passengers, freight, rail, air, maritime and road traffic, and international comparisons. The information compiled in this publication has been gathered...

  9. Urban regeneration and transportation

    CSIR Research Space (South Africa)

    Van Wyk, Llewellyn V

    2011-01-01

    Full Text Available The built environment is the stage upon which we live out our daily lives: the built environment comprises urban design, land use, and the transportation system, and the patterns of human activity within this physical environment. Unfortunately...

  10. Crew Transportation Operations Standards

    Science.gov (United States)

    Mango, Edward J.; Pearson, Don J. (Compiler)

    2013-01-01

    The Crew Transportation Operations Standards contains descriptions of ground and flight operations processes and specifications and the criteria which will be used to evaluate the acceptability of Commercial Providers' proposed processes and specifications.

  11. Animal transportation networks.

    Science.gov (United States)

    Perna, Andrea; Latty, Tanya

    2014-11-01

    Many group-living animals construct transportation networks of trails, galleries and burrows by modifying the environment to facilitate faster, safer or more efficient movement. Animal transportation networks can have direct influences on the fitness of individuals, whereas the shape and structure of transportation networks can influence community dynamics by facilitating contacts between different individuals and species. In this review, we discuss three key areas in the study of animal transportation networks: the topological properties of networks, network morphogenesis and growth, and the behaviour of network users. We present a brief primer on elements of network theory, and then discuss the different ways in which animal groups deal with the fundamental trade-off between the competing network properties of travel efficiency, robustness and infrastructure cost. We consider how the behaviour of network users can impact network efficiency, and call for studies that integrate both network topology and user behaviour. We finish with a prospectus for future research.

  12. CHARTB multigroup transport package

    Energy Technology Data Exchange (ETDEWEB)

    Baker, L.

    1979-03-01

    The physics and numerical implementation of the radiation transport routine used in the CHARTB MHD code are discussed. It is a one-dimensional (Cartesian, cylindrical, and spherical symmetry), multigroup,, diffusion approximation. Tests and applications will be discussed as well.

  13. Nebraska Department of Transportation

    Science.gov (United States)

    The EPA is providing notice of a proposed Administrative Penalty Assessment against the Nebraska Department of Transportation, a state agency located at 1500 Highway 2, Lincoln, NE 68509, for alleged violations of its municipal separate stormwater sewer sy

  14. Accident resistant transport container

    Science.gov (United States)

    Andersen, John A.; Cole, James K.

    1980-01-01

    The invention relates to a container for the safe air transport of plutonium having several intermediate wood layers and a load spreader intermediate an inner container and an outer shell for mitigation of shock during a hypothetical accident.

  15. MANAGEMENT OF TOURISM TRANSPORT

    Directory of Open Access Journals (Sweden)

    Gabriela Cecilia STĂNCIULESCU

    2016-06-01

    Full Text Available Undoubtedly, the relevance of transport activities in relation to tourism activities is essential, because it is extremely important and necessary to offer feasible information about tourism services to help consumer to choose the mode of travel to destinations ideal holiday. The methods used in the development of this hypothesis were explanation, exemplification (brief presentation of each mode of transport comparison etc. Analyzing the current situation of national, European and World Wide tourism transportation, the paper proposes practical applications able to explain that the conduct of economic activities as an integral part of the sector of trade and services within a national economy, would not be possible without the involvement of transport, whether by road, rail and air and naval. The results of the analysis are perfectly applicable offering guests the opportunity to reach the most remote corners of the world in a short time, high degree of comfort and affordable price.

  16. Animal transportation networks

    Science.gov (United States)

    Perna, Andrea; Latty, Tanya

    2014-01-01

    Many group-living animals construct transportation networks of trails, galleries and burrows by modifying the environment to facilitate faster, safer or more efficient movement. Animal transportation networks can have direct influences on the fitness of individuals, whereas the shape and structure of transportation networks can influence community dynamics by facilitating contacts between different individuals and species. In this review, we discuss three key areas in the study of animal transportation networks: the topological properties of networks, network morphogenesis and growth, and the behaviour of network users. We present a brief primer on elements of network theory, and then discuss the different ways in which animal groups deal with the fundamental trade-off between the competing network properties of travel efficiency, robustness and infrastructure cost. We consider how the behaviour of network users can impact network efficiency, and call for studies that integrate both network topology and user behaviour. We finish with a prospectus for future research. PMID:25165598

  17. Transportation Network Topologies

    Science.gov (United States)

    Holmes, Bruce J.; Scott, John

    2004-01-01

    A discomforting reality has materialized on the transportation scene: our existing air and ground infrastructures will not scale to meet our nation's 21st century demands and expectations for mobility, commerce, safety, and security. The consequence of inaction is diminished quality of life and economic opportunity in the 21st century. Clearly, new thinking is required for transportation that can scale to meet to the realities of a networked, knowledge-based economy in which the value of time is a new coin of the realm. This paper proposes a framework, or topology, for thinking about the problem of scalability of the system of networks that comprise the aviation system. This framework highlights the role of integrated communication-navigation-surveillance systems in enabling scalability of future air transportation networks. Scalability, in this vein, is a goal of the recently formed Joint Planning and Development Office for the Next Generation Air Transportation System. New foundations for 21st thinking about air transportation are underpinned by several technological developments in the traditional aircraft disciplines as well as in communication, navigation, surveillance and information systems. Complexity science and modern network theory give rise to one of the technological developments of importance. Scale-free (i.e., scalable) networks represent a promising concept space for modeling airspace system architectures, and for assessing network performance in terms of scalability, efficiency, robustness, resilience, and other metrics. The paper offers an air transportation system topology as framework for transportation system innovation. Successful outcomes of innovation in air transportation could lay the foundations for new paradigms for aircraft and their operating capabilities, air transportation system architectures, and airspace architectures and procedural concepts. The topology proposed considers air transportation as a system of networks, within which

  18. Bæredygtig transport

    DEFF Research Database (Denmark)

    Haas, Henning de; Søndergaard, Mads

    2009-01-01

    I denne artikel sættes fokus på bæredygtighed og transport. Baggrunden for artiklen er en undersøgelse af status for bæredygtig transport i et antal danske virksomheder i samarbejde med DHL. Indledningen giver en baggrund for fokus på bæredygtighed, efterfølgende sættes der fokus på "Green SCM...

  19. Sustainability - and sustainable transport

    Energy Technology Data Exchange (ETDEWEB)

    Thisgaard, P.

    1996-12-31

    To gain the fulfillment of basic sustainable objectives in a medium- and long-term perspective for transport. The necessary activities must be genuinely complementary i.e. it must solve problems within at least two sectors and at the same time this activity must be sustainable in a Brundtland report perspective. The transport sector must take steps to develop an `ECO-NOMY`. The principle here is a `fusion` of economy and ecology, and the first place this can take place is in the transport sector. This can only take place in a close cooperation between the transport sector and the other sectors of society. Methods to carry out cross-sectional priorities and allocation of resources must be developed in order to avoid societal sub-optimization of single issue solutions. Besides, a development of public administration must take place through a very heavy limitation of the principles of `sector thinking` as well as the carrying through of totally new principles in the selection of personnel as well as the principles of promotion and control. `Management by objectives` combined with an emphasis of certain moral codes - may contribute substantially to such a development. The principles are to economize with resources and as far as possible adjust the supply to a given demand with reasonable regard to comfort and transport considerations. Besides, the transport sector must try to solve other sector`s sociological problems and actively try to point out where other sectors create problems for the transport sector which prevent this in becoming `sustainable`. The transport sector must also continually try to forward its ability to change by avoiding capital investment or other forms of bindings which might hinder a different development if or when important technological changes occur. In a number of ways you can point to different concrete possibilities with the following headlines: diversification, integration, development of vehicles, information and concrete project areas

  20. Transporte forestal con cables

    OpenAIRE

    Anaya L. Héctor J.

    2012-01-01

    La explotación forestal es un problema fundamentalmente de transporte. El apeo y la preparación de las trozas, aunque a veces presentan algunas dificultades, son operaciones fáciles de resolver comparadas con la operación de transporte la cual absorbe del 60% al 70% o más del costo total del aprovechamiento del bosque. El 30% o 40% restante es absorbido por las faenas previas de apeo y troceo.

  1. Membrane Transport Phenomena (MTP)

    Science.gov (United States)

    Mason, Larry W.

    1997-01-01

    The third semi-annual period of the MTP project has been involved with performing experiments using the Membrane Transport Apparatus (MTA), development of analysis techniques for the experiment results, analytical modeling of the osmotic transport phenomena, and completion of a DC-9 microgravity flight to test candidate fluid cell geometries. Preparations were also made for the MTP Science Concept Review (SCR), held on 13 June 1997 at Lockheed Martin Astronautics in Denver. These activities are detailed in the report.

  2. Transport of reservoir fines

    DEFF Research Database (Denmark)

    Yuan, Hao; Shapiro, Alexander; Stenby, Erling Halfdan

    Modeling transport of reservoir fines is of great importance for evaluating the damage of production wells and infectivity decline. The conventional methodology accounts for neither the formation heterogeneity around the wells nor the reservoir fines’ heterogeneity. We have developed an integral...... dispersion equation in modeling the transport and the deposition of reservoir fines. It successfully predicts the unsymmetrical concentration profiles and the hyperexponential deposition in experiments....

  3. Comparative analyses of fundamental differences in membrane transport capabilities in prokaryotes and eukaryotes.

    Directory of Open Access Journals (Sweden)

    Qinghu Ren

    2005-08-01

    Full Text Available Whole-genome transporter analyses have been conducted on 141 organisms whose complete genome sequences are available. For each organism, the complete set of membrane transport systems was identified with predicted functions, and classified into protein families based on the transporter classification system. Organisms with larger genome sizes generally possessed a relatively greater number of transport systems. In prokaryotes and unicellular eukaryotes, the significant factor in the increase in transporter content with genome size was a greater diversity of transporter types. In contrast, in multicellular eukaryotes, greater number of paralogs in specific transporter families was the more important factor in the increase in transporter content with genome size. Both eukaryotic and prokaryotic intracellular pathogens and endosymbionts exhibited markedly limited transport capabilities. Hierarchical clustering of phylogenetic profiles of transporter families, derived from the presence or absence of a certain transporter family, showed that clustering patterns of organisms were correlated to both their evolutionary history and their overall physiology and lifestyles.

  4. Comparative Analyses of Fundamental Differences in Membrane Transport Capabilities in Prokaryotes and Eukaryotes.

    Directory of Open Access Journals (Sweden)

    2005-08-01

    Full Text Available Whole-genome transporter analyses have been conducted on 141 organisms whose complete genome sequences are available. For each organism, the complete set of membrane transport systems was identified with predicted functions, and classified into protein families based on the transporter classification system. Organisms with larger genome sizes generally possessed a relatively greater number of transport systems. In prokaryotes and unicellular eukaryotes, the significant factor in the increase in transporter content with genome size was a greater diversity of transporter types. In contrast, in multicellular eukaryotes, greater number of paralogs in specific transporter families was the more important factor in the increase in transporter content with genome size. Both eukaryotic and prokaryotic intracellular pathogens and endosymbionts exhibited markedly limited transport capabilities. Hierarchical clustering of phylogenetic profiles of transporter families, derived from the presence or absence of a certain transporter family, showed that clustering patterns of organisms were correlated to both their evolutionary history and their overall physiology and lifestyles.

  5. Diverse Functional Roles of Monosaccharide Transporters and their Homologs in Vascular Plants: A Physiological Perspective

    Institute of Scientific and Technical Information of China (English)

    Thomas L. Slewinski

    2011-01-01

    Vascular plants contain two gene families that encode monosaccharide transporter proteins. The classical monosaccharide transporter(-like)gene superfamily is large and functionally diverse, while the recently identified SWEET transporter family is smaller and, thus far, only found to transport glucose. These transporters play essential roles at many levels, ranging from organelles to the whole plant. Many family members are essential for cellular homeostasis and re-productive success. Although most transporters do not directly participate in long-distance transport, their indirect roles greatly impact carbon allocation and transport flux to the heterotrophic tissues of the plant. Functional characterization of some members from both gene families has revealed their diverse roles in carbohydrate partitioning, phloem function,resource allocation, plant defense, and sugar signaling. This review highlights the broad impacts and implications of monosaccharide transport by describing some of the functional roles of the monosaccharide transporter(-like)superfamily and the SWEET transporter family.

  6. Methods, measures and indicators for evaluating benefits of transportation research

    CSIR Research Space (South Africa)

    Du Plessis, Louw

    2016-04-01

    Full Text Available The purpose of this article is to provide updated information by identifying and discussing methods, measures and indicators for evaluating benefits appropriate for transportation-related research facilities/programmes. The information has been...

  7. Excitatory amino acid transporters as potential drug targets

    DEFF Research Database (Denmark)

    Bunch, Lennart; Erichsen, Mette Navy; Jensen, Anders Asbjørn

    2009-01-01

    BACKGROUND: Excitatory amino acid transporters (EAATs) are transmembrane proteins responsible for the uptake of (S)-glutamate (Glu) from the synaptic cleft, thereby terminating the glutamatergic neurotransmitter signal. Today five subtypes have been identified. Except for EAAT2, their individual...

  8. Transportation Plan Rappahannock River Valley National Wildlife Refuge 2010

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This study is intended to present a plan to identify transportation enhancements that will provide efficient mobility for visitors and staff to and within the...

  9. Complexity of Public Transport Networks

    Institute of Scientific and Technical Information of China (English)

    LU Huapu; SHI Ye

    2007-01-01

    The theory of complex networks was used to classify public transport networks into public transportation route networks, public transportation transfer networks, and bus station networks. The practical significance of the network parameters was then analyzed. The public transport networks in Langfang, Jining, and Dalian were then chosen as specific research cases. The results show that the public transportation networks have the characteristics of complex networks. In addition, the urban transportation network parameters all significantly affect the accessibility, convenience, and terrorist security capability of the urban public transportation network. The results link the findings with the actual situations to explore means to solve transportation system problems.

  10. Transportation needs assessment: Emergency response section

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1989-05-01

    The transportation impacts of moving high level nuclear waste (HLNW) to a repository at Yucca Mountain in Nevada are of concern to the residents of the State as well as to the residents of other states through which the nuclear wastes might be transported. The projected volume of the waste suggests that shipments will occur on a daily basis for some period of time. This will increase the risk of accidents, including a catastrophic incident. Furthermore, as the likelihood of repository construction and operation and waste shipments increase, so will the attention given by the national media. This document is not to be construed as a willingness to accept the HLNW repository on the part of the State. Rather it is an initial step in ensuring that the safety and well-being of Nevada residents and visitors and the State`s economy will be adequately addressed in federal decision-making pertaining to the transportation of HLNW into and across Nevada for disposal in the proposed repository. The Preferred Transportation System Needs Assessment identifies critical system design elements and technical and social issues that must be considered in conducting a comprehensive transportation impact analysis. Development of the needs assessment and the impact analysis is especially complex because of the absence of information and experience with shipping HLNW and because of the ``low probability, high consequence`` aspect of the transportation risk.

  11. Zn2+ modulation of neurotransmitter transporters

    DEFF Research Database (Denmark)

    Nørgaard-Nielsen, K.; Gether, U.

    2006-01-01

    Neurotransmitter transporters located at the presynaptic or glial cell membrane are responsible for the stringent and rapid clearance of the transmitter from the synapse, and hence they terminate signaling and control the duration of synaptic inputs in the brain. Two distinct families of neurotra......Neurotransmitter transporters located at the presynaptic or glial cell membrane are responsible for the stringent and rapid clearance of the transmitter from the synapse, and hence they terminate signaling and control the duration of synaptic inputs in the brain. Two distinct families...... of neurotransmitter transporters have been identified based on sequence homology: (1) the neurotransmitter sodium symporter family (NSS), which includes the Na+/C1(-)-dependent transporters for dopamine, norepinephrine, and serotonin; and (2) the dicarboxylate/amino acid cation symporter family (DAACS), which...... indirectly suggested the possibility that several of the transporters are modulated by Zn2+ in vivo, and thus that Zn2+ can play a role as a neuromodulator by affecting the function of neurotransmitter transporters....

  12. Transport of thyroid hormone in brain.

    Science.gov (United States)

    Wirth, Eva K; Schweizer, Ulrich; Köhrle, Josef

    2014-01-01

    Thyroid hormone (TH) transport into the brain is not only pivotal for development and differentiation, but also for maintenance and regulation of adult central nervous system (CNS) function. In this review, we highlight some key factors and structures regulating TH uptake and distribution. Serum TH binding proteins play a major role for the availability of TH since only free hormone concentrations may dictate cellular uptake. One of these proteins, transthyretin is also present in the cerebrospinal fluid (CSF) after being secreted by the choroid plexus. Entry routes into the brain like the blood-brain-barrier (BBB) and the blood-CSF-barrier will be explicated regarding fetal and adult status. Recently identified TH transmembrane transporters (THTT) like monocarboxylate transporter 8 (Mct8) play a major role in uptake of TH across the BBB but as well in transport between cells like astrocytes and neurons within the brain. Species differences in transporter expression will be presented and interference of TH transport by endogenous and exogenous compounds including endocrine disruptors and drugs will be discussed.

  13. Transport of thyroid hormone in brain

    Directory of Open Access Journals (Sweden)

    Eva K Wirth

    2014-06-01

    Full Text Available Thyroid hormone (TH transport into the brain is not only pivotal for development and differentiation, but also for maintenance and regulation of adult central nervous system (CNS function. In this review, we highlight some key factors and structures regulating thyroid hormone uptake and distribution. Serum TH binding proteins play a major role for the availability of TH since only free hormone concentrations may dictate cellular uptake. One of these proteins, transthyretin is also present in the cerebrospinal fluid (CSF after being secreted by the choroid plexus. Entry routes into the brain like the blood-brain-barrier (BBB and the blood-CSF-barrier will be explicated regarding fetal and adult status. Recently identified TH transmembrane transporters (THTT like monocarboxylate transporter 8 (Mct8 play a major role in uptake of TH across the BBB but as well in transport between cells like astrocytes and neurons within the brain. Species differences in transporter expression will be presented and interference of TH transport by endogenous and exogenous compounds including endocrine disruptors and drugs will be discussed.

  14. Aquaporins Mediate Silicon Transport in Humans.

    Science.gov (United States)

    Garneau, Alexandre P; Carpentier, Gabriel A; Marcoux, Andrée-Anne; Frenette-Cotton, Rachelle; Simard, Charles F; Rémus-Borel, Wilfried; Caron, Luc; Jacob-Wagner, Mariève; Noël, Micheline; Powell, Jonathan J; Bélanger, Richard; Côté, François; Isenring, Paul

    2015-01-01

    In animals, silicon is an abundant and differentially distributed trace element that is believed to play important biological functions. One would thus expect silicon concentrations in body fluids to be regulated by silicon transporters at the surface of many cell types. Curiously, however, and even though they exist in plants and algae, no such transporters have been identified to date in vertebrates. Here, we show for the first time that the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells. In particular, heterologously expressed AQP7, AQP9 and AQP10 are all able to induce robust, saturable, phloretin-sensitive silicon transport activity in the range that was observed for low silicon rice 1 (lsi1), a silicon transporter in plant. Furthermore, we show that the aquaglyceroporins appear as relevant silicon permeation pathways in both mice and humans based on 1) the kinetics of substrate transport, 2) their presence in tissues where silicon is presumed to play key roles and 3) their transcriptional responses to changes in dietary silicon. Taken together, our data provide new evidence that silicon is a potentially important biological element in animals and that its body distribution is regulated. They should open up original areas of investigations aimed at deciphering the true physiological role of silicon in vertebrates.

  15. Aquaporins Mediate Silicon Transport in Humans.

    Directory of Open Access Journals (Sweden)

    Alexandre P Garneau

    Full Text Available In animals, silicon is an abundant and differentially distributed trace element that is believed to play important biological functions. One would thus expect silicon concentrations in body fluids to be regulated by silicon transporters at the surface of many cell types. Curiously, however, and even though they exist in plants and algae, no such transporters have been identified to date in vertebrates. Here, we show for the first time that the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells. In particular, heterologously expressed AQP7, AQP9 and AQP10 are all able to induce robust, saturable, phloretin-sensitive silicon transport activity in the range that was observed for low silicon rice 1 (lsi1, a silicon transporter in plant. Furthermore, we show that the aquaglyceroporins appear as relevant silicon permeation pathways in both mice and humans based on 1 the kinetics of substrate transport, 2 their presence in tissues where silicon is presumed to play key roles and 3 their transcriptional responses to changes in dietary silicon. Taken together, our data provide new evidence that silicon is a potentially important biological element in animals and that its body distribution is regulated. They should open up original areas of investigations aimed at deciphering the true physiological role of silicon in vertebrates.

  16. Tartanilla: A Symbolism of Cebuano Transportation Heritage

    Directory of Open Access Journals (Sweden)

    Benita Manugas

    2015-12-01

    Full Text Available This study described the tartanilla’s existence in Cebu as a mode of transportation centuries ago. To answer this, the following objectives are raised: describe a Cebuano tartanilla, determine its significance to Cebu’s local history, analyze its enduring utilization in an urban environment, identify the challenges as a form of transportation and trade, and generate mechanisms how itsstakeholders resolve the identified challenges.The study utilizedan ethnographic design with naturalistic observation, interviews of key informants (KIs, field notes, and photographsas appropriate means for collecting information. The KIs comprised eightkuchero or tartanilla drivers identified through a snowball sampling to be known as KIks (key informant kucheros, in order to get the emic or inside views, and another eight KIps (key informant pasaheros were selected, through a convenient sampling, in order to get the etic or outside views.Tartanilla symbolized a century old transportation heritage of the Cebu with the kuchero and the pasahero, as living witnesses along the narrow streets of Cebu City, Philippines then and now. This means of transportation used to be a luxury vehicle among the affluent members of Cebuano society in the past. As time went by, the tartanilla, regarded by the local government of Cebu as a means of transportation; but its status was introduced to simple means of transportation among the average masses in the Cebuano community. The pasahero’s interest in saving for money resulted in the existence of the tartanilla. Being a kuchero reflected a sentimental value in inheriting the job handed down across his generations. Part of his inheritance handed on him is the cart and the horse from his family. Though, driving a tartanilla met various problems, it has been a sustainable job for a kuchero to undertake for the daily subsistence. Its significance to the Cebuano history and culture, created an identity worthy of appreciation and

  17. Rail transportation of biofuels; Jaernvaegstransport av biobraenslen

    Energy Technology Data Exchange (ETDEWEB)

    Frosch, Martin; Thoren, Peter

    2010-05-15

    The project has had the task of describing how the rail transportation of biofuels can be increased. This has been made by analyzing the current conditions of five transmission terminals and five different CHP plants, henceforth called reference cases, and the prevailing conditions at their reception terminals. For each of the five reference cases several transport solutions have been created that take in consideration how these conditions affect the efficiency of the transport solutions for 23 different relations. The study will also show to what extent reduction of environmental impacts can be achieved with the rail transportation of biofuels as alternative to road transport. Three of the reference cases are in operation, one under construction and one in the development phase. To develop transportation solutions and identify potential catchment areas for biofuels a slightly higher resolution than what normally is analyzed in existing literature is required. Therefore, these analysis have been made for each of the relevant catchment areas with the help of forest assessment data, kNN-data, from the Swedish agricultural university (SLU), statistics of peat production from the Swedish geological survey (SGU) and the Forestry boards (Skogsstyrelsen) statistical yearbook of 2008. The calculations underlying the transport solutions are relating to the sustainability of each catchment area, constraints and opportunities at both the reception and transmission terminals, and the practical solutions for wagons, containers and number of possible weekly circulations. The target audience is the heating and CHP plants in Sweden, wishing to use rail transport of biofuels, regardless of available infrastructure since remote receiving terminals also can be used if needed. The results of the economical analysis for all possible relations are based on calculations with 20 wagons in each circulation. Due to topographic limitations and limited traction capacity all relations

  18. Review of Transportation Mode Detection techniques

    Directory of Open Access Journals (Sweden)

    Jacopo Biancat

    2014-10-01

    Full Text Available This paper reviews the works found in the literature in the field of Transportation Mode Detection (TMD which is a subfield of Activity Recognition aiming at indentifying (i.e. classifying the mean of transportation a person is using. The solutions found in literature have different characteristics according to the device for which the solution was tailored (smartphones or other systems such as, e.g., GPS loggers and to the algorithm used for the classification task. This may vary a lot according to the number and type of input used (e.g. accelerations, GPS, maps information or GIS - Geographical Information System information and to the identified classes of transportation mode. These two aspects are the most relevant to consider when evaluating and comparing the accuracies claimed by each work. A comparison of the works is proposed taking into account the characteristics discussed above. In general the accelerometer is the most widely used sensor for TMD applications, as it limits battery consumption and captures relevant features for detecting motion. Indeed a key challenge in TMD is to detect different motorized classes such as bus, car, train and metro because they share common characteristics (such as e.g. the average speed and accelerations which make hard identifying suitable features for the classification algorithm. Identifying the “walk” and “stationary” transportation modes is a simpler task because they are characterized by distinct features.

  19. Towards a relevant and sustainable R&D agenda for transport and transport infrastructure in South Africa

    CSIR Research Space (South Africa)

    Rust, FC

    2009-01-01

    Full Text Available and engineers will need to take cognisance of the environmental impact and sustainability of transport provision. This chapter analyses the drivers identified in the previous chapter and relates that to research, development and innovation activities world wide...

  20. Human proton/oligopeptide transporter (POT) genes

    DEFF Research Database (Denmark)

    Botka, C. W.; Wittig, T. W.; Graul, R. C.

    2000-01-01

    The proton-dependent oligopeptide transporters (POT) gene family currently consists of approximately 70 cloned cDNAs derived from diverse organisms. In mammals, two genes encoding peptide transporters, PepT1 and PepT2 have been cloned in several species including humans, in addition to a rat...... the presence of several possible splice variants of hPHT1. A second closely related human EST-contig displayed high identity to a recently cloned mouse cDNA encoding cyclic adenosine monophosphate (cAMP)-inducible 1 protein (gi:4580995). This contig served to identify a PAC clone containing deduced exons...

  1. Intermodal Transport Security: Need for an Integrated Approach

    Directory of Open Access Journals (Sweden)

    Nil Kula Degirmenci

    2012-11-01

    Full Text Available Transportation industry has been facing challenges due to various security-related issues such as piracy, terrorism, thefts and accidents. Intermodal transportation as a system that incorporates many players, transportation modes, interchange points as well as various technologies can also be considered as an important platform for securityrelated problems. Although intermodal transportation is quite vulnerable to security-related risks, recent literature heavily focused on the security problems of specific transportation modes. Since intermodal industry consists of many operations, vehicles and actors, responding to security-related issues for each transportation mode only may not be sufficient. In the light of these, this study mainly aims to provide a framework for overall understanding of the security concept in the intermodal transportation chain. The study firstly focuses on the security dimension of each transportation mode that can be a part of an intermodal transportation chain by considering mainly legal, technological and economic factors. Then, a framework is suggested which identifies the main components of security in intermodal transport by focusing on the need for an integrated approach. Since the evaluation of security dimension in transportation industry is only limited to the industry projects and analysis of specific transport modes; mainly sea transport, it is believed that this study will provide significant contribution to the understanding and the evaluation of security concept in intermodal transportation system. This will be achieved through the identification of main security gaps in the system and the analysis of the intermodal transportation security concept. Moreover, some suggestions will be provided in the light of the factors mentioned in order to provide an overall intermodal security framework and an integrated approach.

  2. Facilitative plasma membrane transporters function during ER transit.

    Science.gov (United States)

    Takanaga, Hitomi; Frommer, Wolf B

    2010-08-01

    Although biochemical studies suggested a high permeability of the endoplasmic reticulum (ER) membrane for small molecules, proteomics identified few specialized ER transporters. To test functionality of transporters during ER passage, we tested whether glucose transporters (GLUTs, SGLTs) destined for the plasma membrane are active during ER transit. HepG2 cells were characterized by low-affinity ER transport activity, suggesting that ER uptake is protein mediated. The much-reduced capacity of HEK293T cells to take up glucose across the plasma membrane correlated with low ER transport. Ectopic expression of GLUT1, -2, -4, or -9 induced GLUT isoform-specific ER transport activity in HEK293T cells. In contrast, the Na(+)-glucose cotransporter SGLT1 mediated efficient plasma membrane glucose transport but no detectable ER uptake, probably because of lack of a sufficient sodium gradient across the ER membrane. In conclusion, we demonstrate that GLUTs are sufficient for mediating ER glucose transport en route to the plasma membrane. Because of the low volume of the ER, trace amounts of these uniporters contribute to ER solute import during ER transit, while uniporters and cation-coupled transporters carry out export from the ER, together potentially explaining the low selectivity of ER transport. Expression levels and residence time of transporters in the ER, as well as their coupling mechanisms, could be key determinants of ER permeability.

  3. Synaptically evoked glutamate transporter currents in Spinal Dorsal Horn Astrocytes

    Directory of Open Access Journals (Sweden)

    Dougherty Patrick M

    2009-07-01

    Full Text Available Abstract Background Removing and sequestering synaptically released glutamate from the extracellular space is carried out by specific plasma membrane transporters that are primarily located in astrocytes. Glial glutamate transporter function can be monitored by recording the currents that are produced by co-transportation of Na+ ions with the uptake of glutamate. The goal of this study was to characterize glutamate transporter function in astrocytes of the spinal cord dorsal horn in real time by recording synaptically evoked glutamate transporter currents. Results Whole-cell patch clamp recordings were obtained from astrocytes in the spinal substantia gelatinosa (SG area in spinal slices of young adult rats. Glutamate transporter currents were evoked in these cells by electrical stimulation at the spinal dorsal root entry zone in the presence of bicuculline, strychnine, DNQX and D-AP5. Transporter currents were abolished when synaptic transmission was blocked by TTX or Cd2+. Pharmacological studies identified two subtypes of glutamate transporters in spinal astrocytes, GLAST and GLT-1. Glutamate transporter currents were graded with stimulus intensity, reaching peak responses at 4 to 5 times activation threshold, but were reduced following low-frequency (0.1 – 1 Hz repetitive stimulation. Conclusion These results suggest that glutamate transporters of spinal astrocytes could be activated by synaptic activation, and recording glutamate transporter currents may provide a means of examining the real time physiological responses of glial cells in spinal sensory processing, sensitization, hyperalgesia and chronic pain.

  4. Intestinal and placental zinc transport pathways.

    Science.gov (United States)

    Ford, Dianne

    2004-02-01

    Mammalian members of the cation diffusion facilitator (CDF) and zrt-, irt-like protein (ZIP) families of Zn transporters, initially identified in Saccharomyces cerevisiae and Arabidopsis thalania spp., have been cloned during the last 8 years and have been classified as families SLC30 and SLC39 respectively. The cloning of human Zn transporters ZnT-like transporter 1 (hZTL1)/ZnT5 (SLC30A5) and hZIP4 (SLC39A4) were major advances in the understanding of the molecular mechanisms of dietary Zn absorption. Both transporters are localised at the enterocyte apical membrane and are, therefore, potentially of fundamental importance in dietary Zn uptake. hZTL1 mediates Zn uptake when expressed in Xenopus laevis oocytes and hZIP4 is mutated in most cases of the inherited Zn deficiency disease acrodermatitis enteropathica. Localisation of hZTL1/ZnT5 at the apical membrane of the placental syncytiotrophoblast indicates a fundamental role in the transfer of Slc30 Zn to the foetus. Observations in rodent models indicate that in the intestine increased Zn availability increases expression of Zn transporters. Human intestinal Caco-2 cells show a similar response to increasing the Zn2+ concentration of the nutrient medium in relation to the expression of mRNA corresponding to several Zn transporters and that of ZnT1 (SLC30A1) and hZTL1/ZnT5 proteins. In the human placental cell line JAR, however, expression at the mRNA level of a number of Zn transporters is not modified by Zn availability, whilst ZnT1 and hZTL1/ZnT5 proteins are reduced under Zn-supplemented conditions. These differences between Caco-2 and JAR cells in Zn transporter gene responses to Zn supply may reflect the different extracellular Zn concentrations encountered by the corresponding cell types in vitro.

  5. Bioreactor Mass Transport Studies

    Science.gov (United States)

    Kleis, Stanley J.; Begley, Cynthia M.

    1997-01-01

    The objectives of the proposed research efforts were to develop both a simulation tool and a series of experiments to provide a quantitative assessment of mass transport in the NASA rotating wall perfused vessel (RWPV) bioreactor to be flown on EDU#2. This effort consisted of a literature review of bioreactor mass transport studies, the extension of an existing scalar transport computer simulation to include production and utilization of the scalar, and the evaluation of experimental techniques for determining mass transport in these vessels. Since mass transport at the cell surface is determined primarily by the relative motion of the cell assemblage and the surrounding fluid, a detailed assessment of the relative motion was conducted. Results of the simulations of the motion of spheres in the RWPV under microgravity conditions are compared with flight data from EDU#1 flown on STS-70. The mass transport across the cell membrane depends upon the environment, the cell type, and the biological state of the cell. Results from a literature review of cell requirements of several scalars are presented. As a first approximation, a model with a uniform spatial distribution of utilization or production was developed and results from these simulations are presented. There were two candidate processes considered for the experimental mass transport evaluations. The first was to measure the dissolution rate of solid or gel beads. The second was to measure the induced fluorescence of beads as a stimulant (for example hydrogen peroxide) is infused into the vessel. Either technique would use video taped images of the process for recording the quantitative results. Results of preliminary tests of these techniques are discussed.

  6. Transport in gyrokinetic tokamaks

    Energy Technology Data Exchange (ETDEWEB)

    Mynick, H.E.; Parker, S.E.

    1995-01-01

    A comprehensive study of transport in full-volume gyrokinetic (gk) simulations of ion temperature gradient driven turbulence in core tokamak plasmas is presented. Though this ``gyrokinetic tokamak`` is much simpler than experimental tokamaks, such simplicity is an asset, because a dependable nonlinear transport theory for such systems should be more attainable. Toward this end, we pursue two related lines of inquiry. (1) We study the scalings of gk tokamaks with respect to important system parameters. In contrast to real machines, the scalings of larger gk systems (a/{rho}{sub s} {approx_gt} 64) with minor radius, with current, and with a/{rho}{sub s} are roughly consistent with the approximate theoretical expectations for electrostatic turbulent transport which exist as yet. Smaller systems manifest quite different scalings, which aids in interpreting differing mass-scaling results in other work. (2) With the goal of developing a first-principles theory of gk transport, we use the gk data to infer the underlying transport physics. The data indicate that, of the many modes k present in the simulation, only a modest number (N{sub k} {approximately} 10) of k dominate the transport, and for each, only a handful (N{sub p} {approximately} 5) of couplings to other modes p appear to be significant, implying that the essential transport physics may be described by a far simpler system than would have been expected on the basis of earlier nonlinear theory alone. Part of this analysis is the inference of the coupling coefficients M{sub kpq} governing the nonlinear mode interactions, whose measurement from tokamak simulation data is presented here for the first time.

  7. Transport of radioactive materials; Transporte de materiais radioativos

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-11-15

    This ninth chapter presents de CNEN-NE--5.01 norm 'Transport of radioactive material'; the specifications of the radioactive materials for transport; the tests of the packages; the requests for controlling the transport and the responsibilities during the transport of radioactive material.

  8. Paleoclassical transport explains electron transport barriers in RTP and TEXTOR

    NARCIS (Netherlands)

    Hogeweij, G. M. D.; Callen, J.D.

    2008-01-01

    The recently developed paleoclassical transport model sets the minimum level of electron thermal transport in a tokamak. This transport level has proven to be in good agreement with experimental observations in many cases when fluctuation-induced anomalous transport is small, i.e. in (near-) ohmic

  9. Paleoclassical transport explains electron transport barriers in RTP and TEXTOR

    NARCIS (Netherlands)

    Hogeweij, G. M. D.; Callen, J.D.

    2008-01-01

    The recently developed paleoclassical transport model sets the minimum level of electron thermal transport in a tokamak. This transport level has proven to be in good agreement with experimental observations in many cases when fluctuation-induced anomalous transport is small, i.e. in (near-) ohmic p

  10. ANALYISIS OF TRANSPORTATION SYSTEMS AND TRANSPORTATION POLICIES IN TURKEY

    Directory of Open Access Journals (Sweden)

    Ali Payıdar AKGÜNGÖR

    2004-03-01

    Full Text Available Transportation systems have to be considered and analysed as a whole while transportation demand, becoming as a natural outcome of socioeconomic and socio-cultural structure, is being evaluated. It is desired that transportation system, which will be selected for both passenger and freight transport, should be rapid, economic, safe, causing least harm to environment and appropriate for the conditions of a country. However, it is difficult for a transportation system to have all these properties. Every transportation system has advantages and disadvantages over each other. Therefore, comprehensive plans for future periods have to be prepared and how the sources of the country should be reasonably distributed among transportation systems must be investigated. Also, transportation plans have to be prepared to get coordinated operations among transportation systems while great investments are instituted in the entire country. There is no doubt that it is possible with combined transportation instead of concentration on one transportation system. Transportation policies in Turkey should be questioned since the level of highway transportation usage reaches to 95 % and level of sea transportation usage drops to less than 1 % in spite of being surrounded with sea in three sides of our land. In this paper, transportation systems and transportation policies in Turkey are evaluated in general and problems are analysed. Proposals are presented for the solutions of these problems.

  11. RECOVIR Software for Identifying Viruses

    Science.gov (United States)

    Chakravarty, Sugoto; Fox, George E.; Zhu, Dianhui

    2013-01-01

    Most single-stranded RNA (ssRNA) viruses mutate rapidly to generate a large number of strains with highly divergent capsid sequences. Determining the capsid residues or nucleotides that uniquely characterize these strains is critical in understanding the strain diversity of these viruses. RECOVIR (an acronym for "recognize viruses") software predicts the strains of some ssRNA viruses from their limited sequence data. Novel phylogenetic-tree-based databases of protein or nucleic acid residues that uniquely characterize these virus strains are created. Strains of input virus sequences (partial or complete) are predicted through residue-wise comparisons with the databases. RECOVIR uses unique characterizing residues to identify automatically strains of partial or complete capsid sequences of picorna and caliciviruses, two of the most highly diverse ssRNA virus families. Partition-wise comparisons of the database residues with the corresponding residues of more than 300 complete and partial sequences of these viruses resulted in correct strain identification for all of these sequences. This study shows the feasibility of creating databases of hitherto unknown residues uniquely characterizing the capsid sequences of two of the most highly divergent ssRNA virus families. These databases enable automated strain identification from partial or complete capsid sequences of these human and animal pathogens.

  12. Intelligent Transport Systems in the Management of Road Transportation

    Science.gov (United States)

    Kalupová, Blanka; Hlavoň, Ivan

    2016-11-01

    Extension of European Union causes increase of free transfer of people and goods. At the same time they raised the problems associated with the transport, e.g. congestion and related accidents on roads, air traffic delays and more. To increase the efficiency and safety of transport, the European Commission supports the introduction of intelligent transport systems and services in all transport sectors. Implementation of intelligent transport systems and services in the road transport reduces accident frequency, increases the capacity of existing infrastructure and reduces congestions. Use of toll systems provides resources needed for the construction and operation of a new road network, improves public transport, cycling transport and walking transport, and also their multimodal integration with individual car transport.

  13. A new transport hub

    CERN Multimedia

    Corinne Pralavorio

    2016-01-01

    CERN’s new Mobility Centre, allowing you to switch easily from one mode of transport to another, has just been officially opened.   Inauguration of the CERN Mobility Centre by Martin Steinacher, Director for Finance and Human Resources, and Lluis Miralles, Head of the SMB department. CERN’s new Mobility Centre, on the car park next to the Globe of Science and Innovation was officially opened on Tuesday, 22 March. The centre brings together all of CERN’s transport options in a single location. "Our aim is to create an intermodal hub where CERN users and personnel can switch from one mode of transport to another, and from CERN transport to public transport," explains Lluis Miralles, head of the Site Management and Buildings (SMB) department. The Mobility Centre incorporates the CERN bike and car rental services, the self-service car- and bike-sharing schemes, and SIXT car rental facilities (for long-distance journeys). It is located right ne...

  14. Sustainable Transport Data Collection and Application: China Urban Transport Database

    OpenAIRE

    Tian Jiang; Zhongyi Wu; Yu Song; Xianglong Liu; Haode Liu; Haozhi Zhang

    2013-01-01

    Transport policy making process of national and local governments should be supported by a comprehensive database to ensure a sustainable and healthy development of urban transport. China Urban Transport Database (CUTD) has been built to play such a role. This paper is to make an introduction of CUTD framework including user management, data warehouse, and application modules. Considering the urban transport development features of Chinese cities, sustainable urban transport development indic...

  15. Identifying ELIXIR Core Data Resources.

    Science.gov (United States)

    Durinx, Christine; McEntyre, Jo; Appel, Ron; Apweiler, Rolf; Barlow, Mary; Blomberg, Niklas; Cook, Chuck; Gasteiger, Elisabeth; Kim, Jee-Hyub; Lopez, Rodrigo; Redaschi, Nicole; Stockinger, Heinz; Teixeira, Daniel; Valencia, Alfonso

    2016-01-01

    The core mission of ELIXIR is to build a stable and sustainable infrastructure for biological information across Europe. At the heart of this are the data resources, tools and services that ELIXIR offers to the life-sciences community, providing stable and sustainable access to biological data. ELIXIR aims to ensure that these resources are available long-term and that the life-cycles of these resources are managed such that they support the scientific needs of the life-sciences, including biological research. ELIXIR Core Data Resources are defined as a set of European data resources that are of fundamental importance to the wider life-science community and the long-term preservation of biological data. They are complete collections of generic value to life-science, are considered an authority in their field with respect to one or more characteristics, and show high levels of scientific quality and service. Thus, ELIXIR Core Data Resources are of wide applicability and usage. This paper describes the structures, governance and processes that support the identification and evaluation of ELIXIR Core Data Resources. It identifies key indicators which reflect the essence of the definition of an ELIXIR Core Data Resource and support the promotion of excellence in resource development and operation. It describes the specific indicators in more detail and explains their application within ELIXIR's sustainability strategy and science policy actions, and in capacity building, life-cycle management and technical actions. The identification process is currently being implemented and tested for the first time. The findings and outcome will be evaluated by the ELIXIR Scientific Advisory Board in March 2017. Establishing the portfolio of ELIXIR Core Data Resources and ELIXIR Services is a key priority for ELIXIR and publicly marks the transition towards a cohesive infrastructure.

  16. Building sustainable policy framework for transport development: A review of national transport policy initiatives in Nigeria

    Directory of Open Access Journals (Sweden)

    Sumaila A.F.

    2013-06-01

    Full Text Available This paper is concerned with building a sustainable policy framework for transport development in Nigeria. Its objective is to review the country’s transport policy initiatives in order to understand the extent to which it addresses Nigeria’s mobility and transportation problems. From published materials and official government documents and files, the study identifies four national policy initiatives which are reviewed and analysed with regard to their context, contents, and consequences. The study reveals that while the policy initiatives could be said to be adequate and comprehensive in terms of their context and contents, the major challenge is implementation of recommended solutions. The study therefore provides a general checklist to guide policy direction, while advocating for policy-based researches and empirical studies in order to provide the data base for formulation of a sustainable national transport policy for Nigeria.

  17. Packet transport network in metro

    Science.gov (United States)

    Huang, Feng; Yi, Xiaobo; Zhang, Hanzheng; Gong, Ping

    2008-11-01

    IP packet based services such as high speed internet, IP voice and IP video will be widely deployed in telecom network, which make transport network evolution to packet transport network. Characteristics of transport network and requirements of packet transport network are analyzed, T-MPLS/MPLS-TP based PTN technology is given and it will be used in metro (access, aggregation and core) network.

  18. Evaluation of public transport

    DEFF Research Database (Denmark)

    Flyvbjerg, Bent; Kahr, Kjeld; Petersen, Peter Bo

    1986-01-01

    This paper discusses a method to evaluate sceduled, fixed-route public transport. One major evaluation criterion in the method is total travel time, subdivided into walking time, waiting time, time on vehicle, transfer time, and concealed waiting time. The other major criterion is cost incurred...... by a given supply of transport. In contrast with conventional methods, this method operates with real measures, i.e. real location (instead of traffic zones), real time (instead of average travel time), and real costs (instead of proxy-costs). The purpose is to produce relevant and easily understandable...... results suitable to open planning, for instance with citizen participation. Five examples of application of the method are given: (1) evaluation of changes in suburban bus services; (2) evaluation of geographical localities as regards public transport; (3) evaluation of circular bus routes; (4) evaluation...

  19. Intestinal sugar transport

    Institute of Scientific and Technical Information of China (English)

    Laurie A Drozdowski; Alan BR Thomson

    2006-01-01

    Carbohydrates are an important component of the diet.The carbohydrates that we ingest range from simple monosaccharides (glucose, fructose and galactose) to disaccharides (lactose, sucrose) to complex polysaccharides. Most carbohydrates are digested by salivary and pancreatic amylases, and are further broken down into monosaccharides by enzymes in the brush border membrane (BBM) of enterocytes. For example, lactase-phloridzin hydrolase and sucraseisomaltase are two disaccharidases involved in the hydrolysis of nutritionally important disaccharides. Once monosaccharides are presented to the BBM, mature enterocytes expressing nutrient transporters transport the sugars into the enterocytes. This paper reviews the early studies that contributed to the development of a working model of intestinal sugar transport, and details the recent advances made in understanding the process by which sugars are absorbed in the intestine.

  20. Air transport system

    CERN Document Server

    Schmitt, Dieter

    2016-01-01

    The book addresses all major aspects to be considered for the design and operation of aircrafts within the entire transportation chain. It provides the basic information about the legal environment, which defines the basic requirements for aircraft design and aircraft operation. The interactions between  airport, air traffic management and the airlines are described. The market forecast methods and the aircraft development process are explained to understand the very complex and risky business of an aircraft manufacturer. The principles of flight physics as basis for aircraft design are presented and linked to the operational and legal aspects of air transport including all environmental impacts. The book is written for graduate students as well as for engineers and experts, who are working in aerospace industry, at airports or in the domain of transport and logistics.

  1. Water transport in brain:

    DEFF Research Database (Denmark)

    MacAulay, Nanna; Hamann, Steffan; Zeuthen, Thomas

    2004-01-01

    It is generally accepted that cotransporters transport water in addition to their normal substrates, although the precise mechanism is debated; both active and passive modes of transport have been suggested. The magnitude of the water flux mediated by cotransporters may well be significant: both...... the number of cotransporters per cell and the unit water permeability are high. For example, the Na(+)-glutamate cotransporter (EAAT1) has a unit water permeability one tenth of that of aquaporin (AQP) 1. Cotransporters are widely distributed in the brain and participate in several vital functions: inorganic......(+)-lactate cotransporters. We have previously determined water transport capacities for these cotransporters in model systems (Xenopus oocytes, cell cultures, and in vitro preparations), and will discuss their role in water homeostasis of the astroglial cell under both normo- and pathophysiologal situations. Astroglia...

  2. Transportation Institutional Plan

    Energy Technology Data Exchange (ETDEWEB)

    1986-08-01

    This Institutional Plan is divided into three chapters. Chapter 1 provides background information, discusses the purposes of the Plan and the policy guidance for establishing the transportation system, and describes the projected system and the plans for its integrated development. Chapter 2 discusses the major participants who must interact to build the system. Chapter 3 suggests mechanisms for interaction that will foster wide participation in program planning and implementation and provides a framework for managing and resolving the issues related to development and operation of the transportation system. A list of acronyms and a glossary are included for the reader's convenience. Also included in this Plan are four appendices. Of particular importance is Appendix A, which includes detailed discussion of specific transportation issues. Appendices B, C, and D provide supporting material to assist the reader in understanding the roles of the involved institutions.

  3. Innovations for sustainable public transport

    DEFF Research Database (Denmark)

    Hrelja, Robert; Hansson, Lisa; Richardson, Tim

    is to contribute effectively to the development of an efficient and sustainable transport system (for example, forms for the coordination of public transport, land use, and infrastructure planning); (ii) public transport must not be seen as an end in itself, or as merely a technical transport system; (iii...... qualitative case- studies of public transport in Skåne, Aarhus, and Trondheim, and uses an empirical material consisting of written material and interviews. It concludes that: (i) new forms of coordination between organizations and policy areas are called for in a number of critical areas, if public transport......- system developments that undermine the long-term competitiveness of public transport....

  4. Transport Research Needs

    DEFF Research Database (Denmark)

    Ortúzar, Juan de Dios; Cherchi, Elisabetta; Rizzi, Luis

    2014-01-01

    of supply and demand in strategic planning contexts; the latter involving large zoning systems, huge multimodal networks and highly complex dynamic modelling approaches (Mahmassani, 2001). But questions also arise at a more macro level (and in a different time span) regarding the interaction of transport...... and land use, and also at the more micro level with the dynamics of road traffic and public transport modelling, an area which is particularly interesting due to its high complexity in less developed nations (de Cea et al., 2005). We do not have the expertise or the space to dwell on all these issues...

  5. Regional transportation simulations

    Energy Technology Data Exchange (ETDEWEB)

    Nagel, K.; Rickert, M.; Frye, R.; Stretz, P.; Simon, P.; Jacob, R.; Barrett, C.L.

    1998-07-01

    For transportation planning applications, it is useful to not only model each individual traveler, but also the decision-making process leading to their travel demand. Simulation-based modeling of this process means iterations between the actual transportation micro-simulation and the modules simulating the process making the plans. This means that for understanding a single day of travel, it may be necessary to simulate that day hundreds of times for the iteration process, leading to a considerable strain on computational resources.

  6. Transportation of hazardous goods

    CERN Multimedia

    TS Department

    2008-01-01

    A general reminder: any transportation of hazardous goods by road is subject to the European ADR rules. The goods concerned are essentially the following: Explosive substances and objects; Gases (including aerosols and non-flammable gases such as helium and nitrogen); Flammable substances and liquids (inks, paints, resins, petroleum products, alcohols, acetone, thinners); Toxic substances (acids, thinners); Radioactive substances; Corrosive substances (paints, acids, caustic products, disinfectants, electrical batteries). Any requests for the transport of hazardous goods must be executed in compliance with the instructions given at this URL: http://ts-dep.web.cern.ch/ts-dep/groups/he/HH/adr.pdf Heavy Handling Section TS-HE-HH 73793 - 160364

  7. Pickering UDM transportation system

    Energy Technology Data Exchange (ETDEWEB)

    Brennan, P.J.; Vissers, J.J. [GE Canada Nuclear Products, Mechanical Engineering, Peterborough, Ontario (Canada)]. E-mail: patrick.brennan@cdnnuc.ge.com; jeff.vissers@cdnnuc.ge.com; Brown, R. [Ontario Power Generation, Inspection Services Div., Tiverton, Ontario (Canada)

    2003-07-01

    The Universal Delivery Machine (UDM) is a new CANDU reactor maintenance tool that allows safe, timely, and cost-effective inspection and maintenance of fuel channels. The UDM had to be transported through the Pickering nuclear station and installed onto the reactor bridge. This involved lifting the UDM between station levels, navigating it through several challenging airlock and vault areas, and traversing the bridge opening directly in front of the reactor. This paper describes the system used to transport and install the Pickering UDM. (author)

  8. Personalized public transportation information

    OpenAIRE

    Silva, Henrique Cabrita Marques da

    2015-01-01

    Thesis to obtain the Master of Science Degree in Computer Science and Engineering O presente trabalho de projeto foi desenvolvido em parceria com uma empresa de soluções informáticas na área dos transportes, a Tecmic. Resulta de um necessidade real da empresa e de uma oportunidade de negócio. O objetivo foi o desenvolvimento de uma aplicação para dispositivos móveis que permita a personalização da informação e acesso em tempo real à informação de transportes públicos disponível nos servido...

  9. Transport and Sustainability

    DEFF Research Database (Denmark)

    Jørgensen, Kaj

    1997-01-01

    Ph.D. study of the scope for sustainable transport in Denmark, and particularly of the role of the motor vehicle in this context. The distribution of groceries is used as case study of the introduction of the motor vehicle in Denmark, concluding that this has resulted in increases of the transport...... demand, energy consumption and emissions for distributing roughly the same quantities of groceries as in the 1950s. Next the scope for promoting sustainability by means of technical improvement of vehicles is assessed....

  10. TRANSPORT OF COUNTERFEIT GOODS

    Directory of Open Access Journals (Sweden)

    Dagmar Babčanová

    2014-09-01

    Full Text Available The paper is focused on a current problem of transport of counterfeit goods in the European Union. Counterfeiting has a strong influence on the distribution organizations worldwide because most of counterfeit goods threaten the health and safety of consumers. Counterfeiting is a serious problem in the world economy today. The purpose of this paper is to point out the danger of counterfeiting in connection with the transport of Intellectual Property (IP rights - infringing goods. Background of the paper’s content is based on secondary data research of publicly available sources - international statistics and world reports.

  11. The transnational territorial transport system of the Baltic Region

    Directory of Open Access Journals (Sweden)

    Gumenyuk Ivan

    2012-03-01

    Full Text Available In this paper we focus on the structure and territorial borders of the Baltic Sea region, and examine the key structural elements of the transnational territorial transport system. In this respect, we clarify some terms used in transport geography. For the first time the transport system gets territorially localized, which allows for a broad range of new studies of transnational transportation in the Baltic Sea area. We also identify the main principles of development and operation of international territorial transport systems and present them taking the Baltic Sea region as an example. Our findings, we hope, will have a great practical application for researchers of transport geography, especially those studying international logistics.

  12. Secondary metabolites in plants: transport and self-tolerance mechanisms.

    Science.gov (United States)

    Shitan, Nobukazu

    2016-07-01

    Plants produce a host of secondary metabolites with a wide range of biological activities, including potential toxicity to eukaryotic cells. Plants generally manage these compounds by transport to the apoplast or specific organelles such as the vacuole, or other self-tolerance mechanisms. For efficient production of such bioactive compounds in plants or microbes, transport and self-tolerance mechanisms should function cooperatively with the corresponding biosynthetic enzymes. Intensive studies have identified and characterized the proteins responsible for transport and self-tolerance. In particular, many transporters have been isolated and their physiological functions have been proposed. This review describes recent progress in studies of transport and self-tolerance and provides an updated inventory of transporters according to their substrates. Application of such knowledge to synthetic biology might enable efficient production of valuable secondary metabolites in the future.

  13. Scallop DMT functions as a Ca2+ transporter.

    Science.gov (United States)

    Toyohara, Haruhiko; Yamamoto, Sayuri; Hosoi, Masatomi; Takagi, Masaya; Hayashi, Isao; Nakao, Kenji; Kaneko, Shuji

    2005-05-01

    We identified a DMT (divalent metal transporter) homologous protein that functions as a Ca(2+) transporter. Scallop DMT cDNA encodes a 539-amino-acid protein with 12 putative membrane-spanning domains and has a consensus transport motif in the fourth extracellular loop. Since its mRNA is significantly expressed in the gill and intestine, it is assumed that scallop DMT transports Ca(2+) from seawater by the gill and from food by the intestine. Scallop DMT lacks the iron-responsive element commonly found in iron-regulatory proteins, suggesting that it is free of the post-transcriptional regulation from intracellular Fe(2+) concentration. Scallop DMT distinctly functions as a Ca(2+) transporter unlike other DMTs, however, it also transports Fe(2+) and Cd(2+) similar to them.

  14. Unifying concept of serotonin transporter-associated currents.

    Science.gov (United States)

    Schicker, Klaus; Uzelac, Zeljko; Gesmonde, Joan; Bulling, Simon; Stockner, Thomas; Freissmuth, Michael; Boehm, Stefan; Rudnick, Gary; Sitte, Harald H; Sandtner, Walter

    2012-01-02

    Serotonin (5-HT) uptake by the human serotonin transporter (hSERT) is driven by ion gradients. The stoichiometry of transported 5-HT and ions is predicted to result in electroneutral charge movement. However, hSERT mediates a current when challenged with 5-HT. This discrepancy can be accounted for by an uncoupled ion flux. Here, we investigated the mechanistic basis of the uncoupled currents and its relation to the conformational cycle of hSERT. Our observations support the conclusion that the conducting state underlying the uncoupled ion flux is in equilibrium with an inward facing state of the transporter with K+ bound. We identified conditions associated with accumulation of the transporter in inward facing conformations. Manipulations that increased the abundance of inward facing states resulted in enhanced steady-state currents. We present a comprehensive kinetic model of the transport cycle, which recapitulates salient features of the recorded currents. This study provides a framework for exploring transporter-associated currents.

  15. Membrane transporter engineering in industrial biotechnology and whole cell biocatalysis.

    Science.gov (United States)

    Kell, Douglas B; Swainston, Neil; Pir, Pınar; Oliver, Stephen G

    2015-04-01

    Because they mainly do not involve chemical changes, membrane transporters have been a Cinderella subject in the biotechnology of small molecule production, but this is a serious oversight. Influx transporters contribute significantly to the flux towards product, and efflux transporters ensure the accumulation of product in the much greater extracellular space of fermentors. Programmes for improving biotechnological processes might therefore give greater consideration to transporters than may have been commonplace. Strategies for identifying important transporters include expression profiling, genome-wide knockout studies, stress-based selection, and the use of inhibitors. In addition, modern methods of directed evolution and synthetic biology, especially those effecting changes in energy coupling, offer huge opportunities for increasing the flux towards extracellular product formation by transporter engineering.

  16. Structural and functional dynamics of Excitatory Amino Acid Transporters (EAAT

    Directory of Open Access Journals (Sweden)

    Thomas Rauen

    2014-09-01

    Full Text Available Glutamate transporters control the glutamate homeostasis in the central nervous system, and, thus, are not only crucial for physiological excitatory synaptic signaling, but also for the prevention of a large number of neurodegenerative diseases that are associated with excessive and prolonged presence of the neurotransmitter glutamate in the extracellular space. Until now, five subtypes of high-affinity glutamate transporters (excitatory amino acid transporters, EAATs 1–5 have been identified. These 5 high-affinity glutamate transporter subtypes belong to the solute carrier 1 (SLC1 family of transmembrane proteins: EAAT1/GLAST (SLC1A3, EAAT2/GLT1 (SLC1A2, EAAT3/EAAC1 (SLC1A1, EAAT4 (SLC1A6 and EAAT5 (SLC1A7. EAATs are secondary-active transporters, taking up glutamate into the cell against a substantial concentration gradient. The driving force for concentrative uptake is provided by the co-transport of Na+ ions and the counter-transport of one K+ in a step independent of the glutamate translocation step. Due to the electrogenicity of transport, the transmembrane potential can also act as driving force. Glutamate transporters are also able to run in reverse, resulting in glutamate release from cells. Due to these important physiological functions, glutamate transporter expression and, therefore, the transport rate, are tightly regulated. The EAAT protein family are structurally expected to be highly similar, however, these transporters show a functional diversity that ranges from high capacity glutamate uptake systems (EAATs 1–3 to receptor-like glutamate activated anion channels (EAATs 4–5. Here, we provide an update on most recent progress made on EAAT’s molecular transport mechanism, structure-function relationships, pharmacology, and will add recent insights into mechanism of rapid membrane trafficking of glutamate transporters.

  17. The Instruments of Transport Policy

    Directory of Open Access Journals (Sweden)

    Gordana Štefančić

    2006-09-01

    Full Text Available The work proposes the transport policy instruments, suchas the infrastructure measures, management measures and informationprovision measures as the means that could reduceor eliminate transport problems. All these measures have beenfollowed through the provisions for passenger cars, provisionsfor public transport, provisions for cyclists and pedestrians andprovisions regarding transport. A range of solutions is given toreduce congestion, improve accessibility and improve the trafficconditions for those who depend on public transport along withthe improvement of environmental conditions.

  18. Molecular identification and characterisation of the glycine transporter (GLYT1) and the glutamine/glutamate transporter (ASCT2) in the rat lens

    DEFF Research Database (Denmark)

    Lim, Julie; Lorentzen, Karen Axelgaard; Kistler, Joerg;

    2006-01-01

    the molecular identity of GSH transporters in the lens, we have focused on identifying transporters involved in the uptake of the precursor amino acids required for GSH synthesis. Previously, we identified an uptake system for cyst(e)ine mediated by the Xc(-) exchanger and the Excitatory Amino Acid Transporters...... in the centre of the lens raises the possibility that ASCT2 may work with the Xc(-) exchanger to accumulate cysteine where it can potentially act as a low molecular mass antioxidant....

  19. Isolation and characterization of rice cesium transporter genes from a rice-transporter-enriched yeast expression library.

    Science.gov (United States)

    Yamaki, Tomohiro; Otani, Masahiro; Ono, Kohei; Mimura, Takuro; Oda, Koshiro; Minamii, Takeshi; Matsumoto, Shingo; Matsuo, Yuzy; Kawamukai, Makoto; Akihiro, Takashi

    2017-08-01

    A considerable portion of agricultural land in central-east Japan has been contaminated by radioactive material, particularly radioactive Cs, due to the industrial accident at the Fukushima Daiichi nuclear power plant. Understanding the mechanism of absorption, translocation and accumulation of Cs(+) in plants will greatly assist in developing approaches to help reduce the radioactive contamination of agricultural products. At present, however, little is known regarding the Cs(+) transporters in rice. A transporter-enriched yeast expression library was constructed and the library was screened for Cs(+) transporter genes. The 1452 full length cDNAs encoding transporter genes were obtained from the Rice Genome Resource Center and 1358 clones of these transporter genes were successively subcloned into yeast expression vectors; which were then transferred into yeast. Using this library, both positive and negative selection screens can be performed, which have not been previously possible. The constructed library is an excellent tool for the isolation of novel transporter genes. This library was screened for clones that were sensitive to Cs(+) using a SD-Gal medium containing either 30 or 70 mM CsCl; resulting in the isolation of 13 Cs(+) sensitive clones. (137) Cs absorption experiments were conducted and confirmed that all of the identified clones were able to absorb (137) Cs. A total of 3 potassium transporters, 2 ABC transporters and 1 NRAMP transporter were among the 13 identified clones. © 2017 Scandinavian Plant Physiology Society.

  20. Large Payload Ground Transportation and Test Considerations

    Science.gov (United States)

    Rucker, Michelle A.

    2016-01-01

    Many spacecraft concepts under consideration by the National Aeronautics and Space Administration’s (NASA’s) Evolvable Mars Campaign take advantage of a Space Launch System payload shroud that may be 8 to 10 meters in diameter. Large payloads can theoretically save cost by reducing the number of launches needed--but only if it is possible to build, test, and transport a large payload to the launch site in the first place. Analysis performed previously for the Altair project identified several transportation and test issues with an 8.973 meters diameter payload. Although the entire Constellation Program—including Altair—has since been canceled, these issues serve as important lessons learned for spacecraft designers and program managers considering large payloads for future programs. A transportation feasibility study found that, even broken up into an Ascent and Descent Module, the Altair spacecraft would not fit inside available aircraft. Ground transportation of such large payloads over extended distances is not generally permitted, so overland transportation alone would not be an option. Limited ground transportation to the nearest waterway may be possible, but water transportation could take as long as 67 days per production unit, depending on point of origin and acceptance test facility; transportation from the western United States would require transit through the Panama Canal to access the Kennedy Space Center launch site. Large payloads also pose acceptance test and ground processing challenges. Although propulsion, mechanical vibration, and reverberant acoustic test facilities at NASA’s Plum Brook Station have been designed to accommodate large spacecraft, special handling and test work-arounds may be necessary, which could increase cost, schedule, and technical risk. Once at the launch site, there are no facilities currently capable of accommodating the combination of large payload size and hazardous processing such as hypergolic fuels

  1. SWEETs, transporters for intracellular and intercellular sugar translocation.

    Science.gov (United States)

    Eom, Joon-Seob; Chen, Li-Qing; Sosso, Davide; Julius, Benjamin T; Lin, I W; Qu, Xiao-Qing; Braun, David M; Frommer, Wolf B

    2015-06-01

    Three families of transporters have been identified as key players in intercellular transport of sugars: MSTs (monosaccharide transporters), SUTs (sucrose transporters) and SWEETs (hexose and sucrose transporters). MSTs and SUTs fall into the major facilitator superfamily; SWEETs constitute a structurally different class of transporters with only seven transmembrane spanning domains. The predicted topology of SWEETs is supported by crystal structures of bacterial homologs (SemiSWEETs). On average, angiosperm genomes contain ∼20 paralogs, most of which serve distinct physiological roles. In Arabidopsis, AtSWEET8 and 13 feed the pollen; SWEET11 and 12 provide sucrose to the SUTs for phloem loading; AtSWEET11, 12 and 15 have distinct roles in seed filling; AtSWEET16 and 17 are vacuolar hexose transporters; and SWEET9 is essential for nectar secretion. The remaining family members await characterization, and could play roles in the gametophyte as well as other important roles in sugar transport in the plant. In rice and cassava, and possibly other systems, sucrose transporting SWEETs play central roles in pathogen resistance. Notably, the human genome also contains a glucose transporting isoform. Further analysis promises new insights into mechanism and regulation of assimilate allocation and a new potential for increasing crop yield. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. TonB-dependent maltose transport by Caulobacter crescentus.

    Science.gov (United States)

    Lohmiller, S; Hantke, K; Patzer, S I; Braun, V

    2008-06-01

    We have shown previously that Caulobacter crescentus grows on maltodextrins which are actively transported across the outer membrane by the MalA protein. Evidence for energy-coupled transport was obtained by deletion of the exbB exbD genes which abolished transport. However, removal of the TonB protein, which together with the ExbB ExbD proteins is predicted to form an energy-coupling device between the cytoplasmic membrane and the outer membrane, left transport unaffected. Here we identify an additional tonB gene encoded by the cc2334a ORF, which when deleted abolished maltose transport. MalA contains a TonB box that reads EEVVIT and is predicted to interact with TonB. Replacement of valine number 15 in the TonB box by proline abolished maltose transport. Maltose was transported across the cytoplasmic membrane by the MalY protein (CC2283). Maltose transport was induced by maltose and repressed by the MalI protein (CC2284). In addition to MalA, MalY and MalI, the mal locus encodes two predicted cytoplasmic alpha-amylases (CC2285 and CC2286) and a periplasmic glucoamylase (CC2282). The TonB dependence together with the previously described ExbB ExbD dependence demonstrates energy-coupled maltose transport across the outer membrane. MalY is involved in maltose transport across the cytoplasmic membrane by a presumably ion-coupled mechanism.

  3. Transporters in human platelets: physiologic function and impact for pharmacotherapy.

    Science.gov (United States)

    Jedlitschky, Gabriele; Greinacher, Andreas; Kroemer, Heyo K

    2012-04-12

    Platelets store signaling molecules (eg, serotonin and ADP) within their granules. Transporters mediate accumulation of these molecules in platelet granules and, on platelet activation, their translocation across the plasma membrane. The balance between transporter-mediated uptake and elimination of signaling molecules and drugs in platelets determines their intracellular concentrations and effects. Several members of the 2 major transporter families, ATP-binding cassette (ABC) transporters and solute carriers (SLCs), have been identified in platelets. An example of an ABC transporter is MRP4 (ABCC4), which facilitates ADP accumulation in dense granules. MRP4 is a versatile transporter, and various additional functions have been proposed, notably lipid mediator release and a role in aspirin resistance. Several other ABC proteins have been detected in platelets with functions in glutathione and lipid homeostasis. The serotonin transporter (SERT, SLC6A4) in the platelet plasma membrane represents a well-characterized example of the SLC family. Moreover, recent experiments indicate expression of OATP2B1 (SLCO2B1), a high affinity transporter for certain statins, in platelets. Changes in transporter localization and expression can affect platelet function and drug sensitivity. This review summarizes available data on the physiologic and pharmacologic role of transporters in platelets.

  4. Role of monocarboxylate transporters in drug delivery to the brain.

    Science.gov (United States)

    Vijay, Nisha; Morris, Marilyn E

    2014-01-01

    Monocarboxylate transporters (MCTs) are known to mediate the transport of short chain monocarboxylates such as lactate, pyruvate and butyrate. Currently, fourteen members of this transporter family have been identified by sequence homology, of which only the first four members (MCT1- MCT4) have been shown to mediate the proton-linked transport of monocarboxylates. Another transporter family involved in the transport of endogenous monocarboxylates is the sodium coupled MCTs (SMCTs). These act as a symporter and are dependent on a sodium gradient for their functional activity. MCT1 is the predominant transporter among the MCT isoforms and is present in almost all tissues including kidney, intestine, liver, heart, skeletal muscle and brain. The various isoforms differ in terms of their substrate specificity and tissue localization. Due to the expression of these transporters in the kidney, intestine, and brain, they may play an important role in influencing drug disposition. Apart from endogenous short chain monocarboxylates, they also mediate the transport of exogenous drugs such as salicylic acid, valproic acid, and simvastatin acid. The influence of MCTs on drug pharmacokinetics has been extensively studied for γ-hydroxybutyrate (GHB) including distribution of this drug of abuse into the brain and the results will be summarized in this review. The physiological role of these transporters in the brain and their specific cellular localization within the brain will also be discussed. This review will also focus on utilization of MCTs as potential targets for drug delivery into the brain including their role in the treatment of malignant brain tumors.

  5. Societal Planning: Identifying a New Role for the Transport Planner-Part I

    DEFF Research Database (Denmark)

    Khisty, C. Jotin; Leleur, Steen

    1997-01-01

    It has been amply demonstrated over the last three decades that public planning is subject to rapid change and great uncertainties, both in dealing with political objectives as well as dealing with new technologies. In the paper the notion of "unbounded uncertainty" is set forth as a relevant...... concept. The concept is used collectively to point to and explain the many obstacles faced by planners in carrying out planning as prescribed by the well-known Rational Planning Model (RPM). It is concluded that there is a need for the planner to integrate and master in a new role skills both from...

  6. Societal Planning: Identifying a New Role for the Transport Planner-Part II: Planning Guidelines

    DEFF Research Database (Denmark)

    Khisty, C. Jotin; Leleur, Steen

    1997-01-01

    . The guidelines serve to frame the right considerations and questions when dealing with planning problems of a certain complexity. They can then facilitate the structuring and interpretation of empirical study. Emphasis is paid to describe the planning process as one of self-organizing dynamics vis...

  7. TRANSPORT THROUGH CRACKED CONCRETE: LITERATURE REVIEW

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C.

    2012-05-11

    Concrete containment structures and cement-based fills and waste forms are used at the Savannah River Site to enhance the performance of shallow land disposal systems designed for containment of low-level radioactive waste. Understanding and measuring transport through cracked concrete is important for describing the initial condition of radioactive waste containment structures at the Savannah River Site (SRS) and for predicting performance of these structures over time. This report transmits the results of a literature review on transport through cracked concrete which was performed by Professor Jason Weiss, Purdue University per SRR0000678 (RFP-RQ00001029-WY). This review complements the NRC-sponsored literature review and assessment of factors relevant to performance of grouted systems for radioactive waste disposal. This review was performed by The Center for Nuclear Waste Regulatory Analyses, San Antonio, TX, and The University of Aberdeen, Aberdeen Scotland and was focused on tank closure. The objective of the literature review on transport through cracked concrete was to identify information in the open literature which can be applied to SRS transport models for cementitious containment structures, fills, and waste forms. In addition, the literature review was intended to: (1) Provide a framework for describing and classifying cracks in containment structures and cementitious materials used in radioactive waste disposal, (2) Document the state of knowledge and research related to transport through cracks in concrete for various exposure conditions, (3) Provide information or methodology for answering several specific questions related to cracking and transport in concrete, and (4) Provide information that can be used to design experiments on transport through cracked samples and actual structures.

  8. The art of magnesium transport.

    Science.gov (United States)

    de Baaij, Jeroen H F

    2015-01-01

    Patients with hypomagnesemia suffer from a wide range of symptoms including muscle cramps, cardiac arrhythmias and epilepsy. Disturbances in body Mg(2+) homeostasis can often be attributed to increased Mg(2+) excretion by the kidney. Within the kidney, the distal convoluted tubule (DCT) segment determines the final Mg(2+) excretion, since no reabsorption takes place beyond this segment of the nephron. On 21(st) of January 2015, Jeroen de Baaij defended his thesis "The Distal Convoluted Tubule: the Art of Magnesium Transport", in which he aimed to identify new genes involved in Mg(2+) reabsorption in the DCT. This review summarizes the main findings of his graduate research. TRPM6 mediates apical Mg(2+) entry into the DCT cell and is highly regulated by EGF, insulin and pH. ATP and flavagline compounds have been characterized as new regulators of TRPM6 activity, providing novel pathways to target Mg(2+) disturbances. Using isolated primary DCT cells from mice, PCBD1 was identified as a new transcriptional regulator of Mg(2+) transport in the DCT. Indeed, patients with PCBD1 mutations were shown to suffer hypomagnesemia and MODY5-like diabetes. Subsequently, the work presented in the thesis focused on the elucidation of the basolateral Mg(2+) extrusion of the DCT cell. In vivo studies using SLC41A3-knockout mice suggest that SLC41A3 may act as Mg(2+) extrusion mechanism. CNNM2 has long been hypothesized to transport Mg(2+) at the basolateral membrane of the DCT. However, by determining the protein topology and homology modeling of the CBS domains, it was argued that CNNM2 is rather an Mg(2+)-sensing mechanism. Follow-up studies using (25)Mg(2+) isotopes showed that CNNM2 increases Mg(2+) uptake when overexpressed in HEK293 cells. Additionally, by knocking down cnnm2 in zebrafish, CNNM2 was demonstrated to be essential for brain development and Mg(2+) homeostasis. Mutations in CNNM2 were shown to cause hypomagnesemia, seizures and intellectual disability. Altogether

  9. Improved electron transport layer

    DEFF Research Database (Denmark)

    2012-01-01

    The present invention provides: a method of preparing a coating ink for forming a zinc oxide electron transport layer, comprising mixing zinc acetate and a wetting agent in water or methanol; a coating ink comprising zinc acetate and a wetting agent in aqueous solution or methanolic solution...

  10. Beam transport elements

    CERN Multimedia

    1965-01-01

    Two of the beam transport elements for the slow ejection system. On the left, a quadrupole 1.2 m long with a 5 cm aperture, capable of producing a gradient of 5000 gauss. On the right, a 1 m bending magnet with a 4 cm gap; its field is 20 000 gauss.

  11. Transport for smart cities

    DEFF Research Database (Denmark)

    Kristensen, Niels Buus; Pedersen, Allan Schrøder

    2011-01-01

    The global megatrend of the last century’s migration from rural to ever-larger conurbations has created immense gains to society through economies of scale and benefits from agglomeration. These include – other things remaining equal – a lesser need for transport because a bigger share of peoples...

  12. Demographic Change and Transport

    DEFF Research Database (Denmark)

    Haustein, Sonja; Siren, Anu Kristiina; Framke, Elisabeth

    This report is the literature review on demographic changes and transport of Work Package 1 of the EU project CONSOL, “CONcerns and SOLutions – Road Safety in the Ageing Societies” (contract period: 2011-2013). The report is a state-of-the art report that combines current knowledge with new findi...

  13. Natural Gas Transport

    OpenAIRE

    Tomás Correa; Nelson Osorio

    2009-01-01

    This paper reviews the present and future on natural gas transportation options, from oil and gas fields to markets, including liquefied natural gas, gas pipeline, compressed natural gas, natural gas hydrates, and gas to liquids and the perspectives of using them in Colombia, since this is the main fuel alternative to supply the world in at least the next 50 years.

  14. Evaluation of public transport

    DEFF Research Database (Denmark)

    Flyvbjerg, Bent; Kahr, Kjeld; Petersen, Peter Bo

    1986-01-01

    results suitable to open planning, for instance with citizen participation. Five examples of application of the method are given: (1) evaluation of changes in suburban bus services; (2) evaluation of geographical localities as regards public transport; (3) evaluation of circular bus routes; (4) evaluation...

  15. Phloem transport in trees

    Science.gov (United States)

    Michael G. Ryan; Shinichi. Asao

    2014-01-01

    Phloem is like an enigmatic central banker: we know how important phloem is to plant function, but very little about how phloem functions as part of a whole-plant economy. Phloem transports carbohydrates, produced by photosynthesis and hydrolysis of reserve compounds, to sink tissues for growth, respiration and storage. At photosynthetic tissues, carbohydrates are...

  16. Nearshore Sand Transport.

    Science.gov (United States)

    1987-01-01

    Born November 19, 1956 - Peoria, Illinois 1978 B.S., Civil Engineering, University of Miami, Coral Gables, Florida 1978 B.S., Physics, University of...Aubrey, 1985, "Theoretical and observational estimates of nearshore bedload transport rates," Marino Geology, v 64, p 91-111. Guza, R.T., N.C. Clifton

  17. Transporte Urbano en Venezuela

    Directory of Open Access Journals (Sweden)

    Rosa Virginia Ocaña Ortiz

    2005-01-01

    Full Text Available El diseño e implantación de políticas públicas expresas en el área del transporte urbano en Venezuela data de finales de los años ochenta. En él se contempló la “modernización” y la “municipalización” del transporte urbano. El objetivo del presente trabajo es analizar la intervención de los poderes locales en el diseño e implementación de la política de transporte urbano en las ciudades venezolanas. La metodología utilizada consistió en el análisis de información documental y entrevistas semiestructuradas a funcionarios de Alcaldías y del gobierno central. Los resultados indican que la política fue diseñada en el seno del Ministerio de Transporte y Comunicaciones y del Ministerio de Infraestructura, por un grupo de especialistas, siguiendo lineamientos de la banca multilateral, sin consultar a los actores del sistema, y muy especialmente a los Municipios o Alcaldías. Se concluye que los poderes locales han intervenido de forma limitada en la implantación de la política, con muy escaso poder de decisión y siguiendo lo establecido por el gobierno nacional.

  18. Metrics for Transportation.

    Science.gov (United States)

    Cooper, Gloria S., Ed.; Magisos, Joel H., Ed.

    Designed to meet the job-related metric measurement needs of students interested in transportation, this instructional package is one of five for the marketing and distribution cluster, part of a set of 55 packages for metric instruction in different occupations. The package is intended for students who already know the occupational terminology,…

  19. ADVANCED CUTTINGS TRANSPORT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Mark Pickell; Len Volk; Mike Volk; Evren Ozbayoglu; Lei Zhou

    2002-07-30

    This is the fourth quarterly progress report for Year-3 of the ACTS Project. It includes a review of progress made in: (1) Flow Loop construction and development and (2) research tasks during the period of time between April 1, 2002 and June 30, 2002. This report presents a review of progress on the following specific tasks: (a) Design and development of an Advanced Cuttings Transport Facility (Task 3: Addition of a Cuttings Injection/Separation System), (b) Research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)''; (c) Research project (Task 9b): ''Study of Foam Flow Behavior Under EPET Conditions''; (d) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions''; (e) Research on three instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), Foam texture while transporting cuttings. (Task 12), and Viscosity of Foam under EPET (Task 9b); (f) Development of a Safety program for the ACTS Flow Loop. Progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S); (g) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members.

  20. ADVANCED CUTTINGS TRANSPORT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Mark Pickell; Len Volk; Mike Volk; Lei Zhou; Zhu Chen; Crystal Redden; Aimee Washington

    2003-01-30

    This is the second quarterly progress report for Year-4 of the ACTS Project. It includes a review of progress made in: (1) Flow Loop construction and development and (2) research tasks during the period of time between October 1, 2002 and December 30, 2002. This report presents a review of progress on the following specific tasks. (a) Design and development of an Advanced Cuttings Transport Facility Task 3: Addition of a Cuttings Injection/Separation System, Task 4: Addition of a Pipe Rotation System. (b) New research project (Task 9b): ''Development of a Foam Generator/Viscometer for Elevated Pressure and Elevated Temperature (EPET) Conditions''. (d) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions''. (e) Research on three instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), Foam texture while transporting cuttings. (Task 12), and Viscosity of Foam under EPET (Task 9b). (f) New Research project (Task 13): ''Study of Cuttings Transport with Foam under Elevated Pressure and Temperature Conditions''. (g) Development of a Safety program for the ACTS Flow Loop. Progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S). (h) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members.

  1. Thermal transport in graphene

    Science.gov (United States)

    Sadeghi, Mir Mohammad; Pettes, Michael Thompson; Shi, Li

    2012-08-01

    The recent advances in graphene isolation and synthesis methods have enabled potential applications of graphene in nanoelectronics and thermal management, and have offered a unique opportunity for investigation of phonon transport in two-dimensional materials. In this review, current understanding of phonon transport in graphene is discussed along with associated experimental and theoretical investigation techniques. Several theories and experiments have suggested that the absence of interlayer phonon scattering in suspended monolayer graphene can result in higher intrinsic basal plane thermal conductivity than that for graphite. However, accurate experimental thermal conductivity data of clean suspended graphene at different temperatures are still lacking. It is now known that contact of graphene with an amorphous solid or organic matrix can suppress phonon transport in graphene, although further efforts are needed to better quantify the relative roles of interface roughness scattering and phonon leakage across the interface and to examine the effects of other support materials. Moreover, opportunities remain to verify competing theories regarding mode specific scattering mechanisms and contributions to the total thermal conductivity of suspended and supported graphene, especially regarding the contribution from the flexural phonons. Several measurements have yielded consistent interface thermal conductance values between graphene and different dielectrics and metals. A challenge has remained in establishing a comprehensive theoretical model of coupled phonon and electron transport across the highly anisotropic and dissimilar interface.

  2. A lunar transportation system

    Science.gov (United States)

    1986-01-01

    Due to large amounts of oxygen required for space travel, a method of mining, transporting, and storing this oxygen in space would facilitate further space exploration. The following project deals specifically with the methods for transporting liquid oxygen from the lunar surface to the Lunar Orbit (LO) space station, and then to the Lower Earth Orbit (LEO) space station. Two vehicles were designed for operation between the LEO and LO space stations. The first of these vehicles is an aerobraked design vehicle. The Aerobrake Orbital Transfer Vehicle (OTV) is capable of transporting 5000 lbm of payload to LO while returning to LEO with 60,000 lbm of liquid oxygen, and thus meet mission requirements. The second vehicle can deliver 18,000 lbm of payload to LO and is capable of bringing 60,000 lbm of liquid oxygen back to LEO. A lunar landing vehicle was also designed for operation between LO and the established moon base. The use of an electromagnetic railgun as a method for launching the lunar lander was also investigated. The feasibility of the railgun is doubtful at this time. A system of spheres was also designed for proper storing and transporting of the liquid oxygen. The system assumes a safe means for transferring the liquid oxygen from tank to tank is operational. A sophisticated life support system was developed for both the OTV and the lunar lander. This system focuses on such factors as the vehicle environment, waste management, water requirements, food requirements, and oxygen requirements.

  3. Natural Gas Transport

    Directory of Open Access Journals (Sweden)

    Tomás Correa

    2009-06-01

    Full Text Available This paper reviews the present and future on natural gas transportation options, from oil and gas fields to markets, including liquefied natural gas, gas pipeline, compressed natural gas, natural gas hydrates, and gas to liquids and the perspectives of using them in Colombia, since this is the main fuel alternative to supply the world in at least the next 50 years.

  4. Bystruktur og transport

    DEFF Research Database (Denmark)

    Nielsen, Thomas Alexander Sick

    2003-01-01

    Paperet præsenterer hovedkonklusionerne fra et PhD-studie af sammenhængene mellem bystruktur (særligt boliglokalisering) og transport i Aalborg. Det konkluderes at boliglokaliseringen har væsentlig betydning for transporten i det daglige. Det gælder især lokaliseringen i forhold til det samlede...

  5. Slurry transport medium

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, W.; Schiffman, L.

    1980-06-03

    This invention provides for an improvement in slurry transport systems, especially coal slurry lines. Instead of the usual use of fresh water resources which, in some geographic areas, are scarce for slurry transport, concentrated brine is used which is prepared from abundant salt water resources. Because of the higher density of this concentrated brine, it is a superior carrier of pulverized material. It diminishes the separation and settling tendency of slurry components during transport and particularly during shutdown. Other advantages in the use of concentrated brine include: freezing point depression which permits ease of transport during winter and at lower temperatures; dust suppression of stored coal; avoidance of spontaneous combustion of stored coal; inhibit freeze packing of dewatered pipeline coal; and diminished extent of corrosion in ferrous metal pipelines as compared to that which might occur with lower concentration brines. Important in the economy of the process is that the concentrated brine can be recycled. An inexpensive method for producing the concentrated brine is given.

  6. Transport and Sustainability

    DEFF Research Database (Denmark)

    Jørgensen, Kaj

    1998-01-01

    of the distribution of food and other groceries in Denmark, covering both the distribution to the shops and the shopping transport. The outputs of the technical improvementanalysis are partly estimates of improvement potentials in different technical scenarios and partly studies of the penetration...

  7. School Transportation: Administrator's Handbook

    Science.gov (United States)

    Missouri Department of Elementary and Secondary Education, 2008

    2008-01-01

    Pupil transportation is an essential part of the overall school program, which requires constant supervision and direction. Perhaps no other phase of the school program is more closely observed by the public or has a greater tendency to mold public opinion about the schools than the school bus system. The success of any school district pupil…

  8. Artificial oxygen transport protein

    Science.gov (United States)

    Dutton, P. Leslie

    2014-09-30

    This invention provides heme-containing peptides capable of binding molecular oxygen at room temperature. These compounds may be useful in the absorption of molecular oxygen from molecular oxygen-containing atmospheres. Also included in the invention are methods for treating an oxygen transport deficiency in a mammal.

  9. Gas Transport Through Channels

    Science.gov (United States)

    2009-03-25

    HvPlP2;l increases internal CO; conductance and CO; assimilation in the leaves of transgenic rice plants. Plant Cell Physiol. 45, 521 529. Harris...human Rhesus-associated RhAG protein and a kidney homologue promote ammonium transport in yeast . Nat Genet 26 341-344 42. Payne JA, Forbush B (1994

  10. Phloem transport and drought.

    Science.gov (United States)

    Sevanto, Sanna

    2014-04-01

    Drought challenges plant water uptake and the vascular system. In the xylem it causes embolism that impairs water transport from the soil to the leaves and, if uncontrolled, may even lead to plant mortality via hydraulic failure. What happens in the phloem, however, is less clear because measuring phloem transport is still a significant challenge to plant science. In all vascular plants, phloem and xylem tissues are located next to each other, and there is clear evidence that these tissues exchange water. Therefore, drought should also lead to water shortage in the phloem. In this review, theories used in phloem transport models have been applied to drought conditions, with the goal of shedding light on how phloem transport failure might occur. The review revealed that phloem failure could occur either because of viscosity build-up at the source sites or by a failure to maintain phloem water status and cell turgor. Which one of these dominates depends on the hydraulic permeability of phloem conduit walls. Impermeable walls will lead to viscosity build-up affecting flow rates, while permeable walls make the plant more susceptible to phloem turgor failure. Current empirical evidence suggests that phloem failure resulting from phloem turgor collapse is the more likely mechanism at least in relatively isohydric plants.

  11. Alternate Transportation Routes

    Science.gov (United States)

    Vogel, Carl

    2009-01-01

    Since last school year, the St. Lucie County (Florida) Public Schools reduced the number of buses it operates from 399 to 362, despite opening two new schools. Add in some other smart changes in policy, and the district lowered its annual transportation costs by more than $3 million over last year. Saving $3 million a year does not come easily,…

  12. Interfacial area transport in bubbly flow

    Energy Technology Data Exchange (ETDEWEB)

    Ishii, M.; Wu, Q.; Revankar, S.T. [Purdue Univ., West Lafayette, IN (United States)] [and others

    1997-12-31

    In order to close the two-fluid model for two-phase flow analyses, the interfacial area concentration needs to be modeled as a constitutive relation. In this study, the focus was on the investigation of the interfacial area concentration transport phenomena, both theoretically and experimentally. The interfacial area concentration transport equation for air-water bubbly up-flow in a vertical pipe was developed, and the models for the source and sink terms were provided. The necessary parameters for the experimental studies were identified, including the local time-averaged void fraction, interfacial area concentration, bubble interfacial velocity, liquid velocity and turbulent intensity. Experiments were performed with air-water mixture at atmospheric pressure. Double-sensor conductivity probe and hot-film probe were employed to measure the identified parameters. With these experimental data, the preliminary model evaluation was carried out for the simplest form of the developed interfacial area transport equation, i.e., the one-dimensional transport equation.

  13. Population-weighted efficiency in transportation networks

    Science.gov (United States)

    Dong, Lei; Li, Ruiqi; Zhang, Jiang; di, Zengru

    2016-05-01

    Transportation efficiency is critical for the operation of cities and is attracting great attention worldwide. Improving the transportation efficiency can not only decrease energy consumption, reduce carbon emissions, but also accelerate people’s interactions, which will become more and more important for sustainable urban living. Generally, traffic conditions in less-developed countries are not so good due to the undeveloped economy and road networks, while this issue is rarely studied before, because traditional survey data in these areas are scarce. Nowadays, with the development of ubiquitous mobile phone data, we can explore the transportation efficiency in a new way. In this paper, based on users’ call detailed records (CDRs), we propose an indicator named population-weighted efficiency (PWE) to quantitatively measure the efficiency of the transportation networks. PWE can provide insights into transportation infrastructure development, according to which we identify dozens of inefficient routes at both the intra- and inter-city levels, which are verified by several ongoing construction projects in Senegal. In addition, we compare PWE with excess commuting indices, and the fitting result of PWE is better than excess commuting index, which also proves the validity of our method.

  14. Liposome reconstitution and transport assay for recombinant transporters.

    Science.gov (United States)

    Johnson, Zachary Lee; Lee, Seok-Yong

    2015-01-01

    Secondary active transporters are responsible for the cellular uptake of many biologically important molecules, including neurotransmitters, nutrients, and drugs. Because of their physiological and clinical importance, a method for assessing their transport activity in vitro is necessary to gain a better understanding of how these transporters function at the molecular level. In this chapter, we describe a protocol for reconstituting the concentrative nucleoside transporter from Vibrio cholerae into proteoliposomes. We then describe a radiolabeled substrate uptake assay that can be used to functionally characterize the transporter. These methods are relatively common and can be applied to other secondary active transporters, with or without some modification.

  15. Molybdate transport through the plant sulfate transporter SHST1.

    Science.gov (United States)

    Fitzpatrick, Kate L; Tyerman, Stephen D; Kaiser, Brent N

    2008-04-30

    Molybdenum is an essential micronutrient required by plants. The mechanism of molybdenum uptake in plants is poorly understood, however, evidence has suggested that sulfate transporters may be involved. The sulfate transporter from Stylosanthes hamata, SHST1, restored growth of the sulfate transport yeast mutant, YSD1, on media containing low amounts of molybdate. Kinetic analysis using 99MoO4(2-) demonstrated that SHST1 enhanced the uptake of molybdate into yeast cells at nM concentrations. Uptake was not inhibited by sulfate, but sulfate transport via SHST1 was reduced with molybdate. These results are the first measurement of molybdate transport by a characterised plant sulfate transport protein.

  16. Transporte y Ciudad

    Directory of Open Access Journals (Sweden)

    GERMÁN CORREA DÍAZ

    2010-04-01

    Full Text Available Los servicios de transporte público operan de manera sistémica, así como lo hace todo aquello que se mueve en la ciudad. Toda intervención que se haga respecto a uno de los modos que la gente usa para movilizarse afecta inevitablemente al resto. Desde que en Santiago entró en operaciones un Sistema Integrado de Transporte Público, como es el Transantiago, pasó la hora de seguir haciendo inversiones en proyectos aislados relativos a la movilidad urbana. Es hora más bien de racionalizar sistémicamen-te dichas inversiones y evaluarlas en consecuencia. Los grandes proyectos de transporte urbano deben dejar de ser la idea emblemática de algún gobernante. En cambio, deben pasar a ser evaluados y decididos desde una visión sistémica y organizada sobre el territorio, el desarrollo urbano y la movilidad, estableciendo mejor el óptimo social de las inversiones públicas y privadas. De esta manera se servirá mejor al interés común de los habitantes de la ciudad.Public transport services operate in a systemic manner and so does everything that moves in the city. Interventions in one of the modes people use to move around affect inevitably the rest. Today, when a new Public Transport Integrated System as Transantiago is operating, whatever its problems, it makes no longer sense to keep making investments in isolated transport projects. It is time to rationalize such investments from a systemic point of view, evaluating them likewise. Large urban transport projects should no longer be the emblematic idea of some individual Government authority. Instead, they should be evaluated and decided upon from the standpoint of a systemic and organized vision of the territory, urban development and mobility, thus better establishing a social optimum of public and private investments. In this way the real common interest of the city dwellers would be better served.

  17. Ameloblast modulation and transport of Cl-, Na+, and K+ during amelogenesis

    NARCIS (Netherlands)

    Bronckers, A.L.J.J.; Lyaruu, D.; Jalali, R.; Medina, J.F.; Zandieh-Doulabi, B.; DenBesten, P.K.

    2015-01-01

    Ameloblasts express transmembrane proteins for transport of mineral ions and regulation of pH in the enamel space. Two major transporters recently identified in ameloblasts are the Na+K+-dependent calcium transporter NCKX4 and the Na+-dependent HPO42- (Pi) cotransporter NaPi-2b. To regulate pH, amel

  18. Measuring the performance of multi-agency programmatic permits for Washington State Department of Transportation activities

    OpenAIRE

    2005-01-01

    In 2001, the Washington State Legislature established the Transportation Permit Efficiency and Accountability Committee (TPEAC) to identify measures to streamline permit procedures for transportation activities and improve environmental outcomes. A programmatic subcommittee was created to develop a multi-agency approach for developing programmatic permits that would cover 60 to 70 percent of Washington State Department of Transportation (WSDOT) activities (mostly maintenance and preservation ...

  19. 78 FR 15664 - Approval and Promulgation of Air Quality Implementation Plans; New Mexico; Interstate Transport...

    Science.gov (United States)

    2013-03-12

    ...; Interstate Transport of Fine Particulate Matter AGENCY: Environmental Protection Agency (EPA). ACTION... and Interstate Transport Section 110(a)(2)(D)(i) of the CAA identifies four distinct elements related to the evaluation of impacts of interstate transport of air pollutants. In this action for the...

  20. A Transporter of Ibuprofen is Upregulated in MDCK I Cells under Hyperosmotic Culture Conditions

    DEFF Research Database (Denmark)

    Nielsen, Carsten Uhd; Rasmussen, Rune N; Mo, Junying

    2016-01-01

    Ibuprofen is a widely used drug. It has been identified as an inhibitor of several transporters, but it is not clear if ibuprofen is a substrate of any transporter itself. In the present work, we have characterized a transporter of ibuprofen, which is upregulated by hyperosmotic culture condition...

  1. 25 CFR 170.411 - What may a long-range transportation plan include?

    Science.gov (United States)

    2010-04-01

    ... RESERVATION ROADS PROGRAM Planning, Design, and Construction of Indian Reservation Roads Program Facilities Long-Range Transportation Planning § 170.411 What may a long-range transportation plan include? A...) Social and economic development planning to identify transportation improvements or needs to accommodate...

  2. ADVANCED CUTTINGS TRANSPORT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Mark Pickell; Len Volk; Mike Volk; Barkim Demirdal; Affonso Lourenco; Evren Ozbayoglu; Paco Vieira; Lei Zhou

    2000-01-30

    This is the second quarterly progress report for Year 2 of the ACTS project. It includes a review of progress made in Flow Loop development and research during the period of time between Oct 1, 2000 and December 31, 2000. This report presents a review of progress on the following specific tasks: (a) Design and development of an Advanced Cuttings Transport Facility (Task 2: Addition of a foam generation and breaker system), (b) Research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (c) Research project (Task 7): ''Study of Cuttings Transport with Aerated Muds Under LPAT Conditions (Joint Project with TUDRP)'', (d) Research project (Task 8): ''Study of Flow of Synthetic Drilling Fluids Under Elevated Pressure and Temperature Conditions'', (e) Research project (Task 9): ''Study of Foam Flow Behavior Under EPET Conditions'', (f) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions'', (g) Research on instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), and Foam properties while transporting cuttings. (Task 12), (h) Development of a Safety program for the ACTS Flow Loop. Progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S). (i) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members. The tasks Completed During This Quarter are Task 7 and Task 8.

  3. TransportDB 2.0: a database for exploring membrane transporters in sequenced genomes from all domains of life.

    Science.gov (United States)

    Elbourne, Liam D H; Tetu, Sasha G; Hassan, Karl A; Paulsen, Ian T

    2017-01-04

    All cellular life contains an extensive array of membrane transport proteins. The vast majority of these transporters have not been experimentally characterized. We have developed a bioinformatic pipeline to identify and annotate complete sets of transporters in any sequenced genome. This pipeline is now fully automated enabling it to better keep pace with the accelerating rate of genome sequencing. This manuscript describes TransportDB 2.0 (http://www.membranetransport.org/transportDB2/), a completely updated version of TransportDB, which provides access to the large volumes of data generated by our automated transporter annotation pipeline. The TransportDB 2.0 web portal has been rebuilt to utilize contemporary JavaScript libraries, providing a highly interactive interface to the annotation information, and incorporates analysis tools that enable users to query the database on a number of levels. For example, TransportDB 2.0 includes tools that allow users to select annotated genomes of interest from the thousands of species held in the database and compare their complete transporter complements.

  4. TransportDB 2.0: a database for exploring membrane transporters in sequenced genomes from all domains of life

    Science.gov (United States)

    Elbourne, Liam D. H.; Tetu, Sasha G.; Hassan, Karl A.; Paulsen, Ian T.

    2017-01-01

    All cellular life contains an extensive array of membrane transport proteins. The vast majority of these transporters have not been experimentally characterized. We have developed a bioinformatic pipeline to identify and annotate complete sets of transporters in any sequenced genome. This pipeline is now fully automated enabling it to better keep pace with the accelerating rate of genome sequencing. This manuscript describes TransportDB 2.0 (http://www.membranetransport.org/transportDB2/), a completely updated version of TransportDB, which provides access to the large volumes of data generated by our automated transporter annotation pipeline. The TransportDB 2.0 web portal has been rebuilt to utilize contemporary JavaScript libraries, providing a highly interactive interface to the annotation information, and incorporates analysis tools that enable users to query the database on a number of levels. For example, TransportDB 2.0 includes tools that allow users to select annotated genomes of interest from the thousands of species held in the database and compare their complete transporter complements. PMID:27899676

  5. TRANSPORT LOCOMOTIVE AND WASTE PACKAGE TRANSPORTER ITS STANDARDS IDENTIFICATION STUDY

    Energy Technology Data Exchange (ETDEWEB)

    K.D. Draper

    2005-03-31

    To date, the project has established important to safety (ITS) performance requirements for structures, systems and components (SSCs) based on identification and categorization of event sequences that may result in a radiological release. These performance requirements are defined within the ''Nuclear Safety Design Basis for License Application'' (NSDB) (BSC 2005). Further, SSCs credited with performing safe functions are classified as ITS. In turn, performance confirmation for these SSCs is sought through the use of consensus code and standards. The purpose of this study is to identify applicable codes and standards for the waste package (WP) transporter and transport locomotive ITS SSCs. Further, this study will form the basis for selection and the extent of applicability of each code and standard. This study is based on the design development completed for License Application only. Accordingly, identification of ITS SSCs beyond those defined within the NSDB are based on designs that may be subject to further development during detail design. Furthermore, several design alternatives may still be under consideration to satisfy certain safety functions, and that final selection will not be determined until further design development has occurred. Therefore, for completeness, throughout this study alternative designs currently under consideration will be discussed. Further, the results of this study will be subject to evaluation as part of a follow-on gap analysis study. Based on the results of this study the gap analysis will evaluate each code and standard to ensure each ITS performance requirement is fully satisfied. When a performance requirement is not fully satisfied a ''gap'' is highlighted. Thereafter, the study will identify supplemental requirements to augment the code or standard to meet performance requirements. Further, the gap analysis will identify non-standard areas of the design that will be subject to a

  6. The Full Cost of Intercity Highway Transportation

    OpenAIRE

    David Levinson; David Gillen

    1997-01-01

    In this paper we review the theoretical and empirical literature on the cost structure of the provision of intercity highway transportation and specify and estimate our own cost functions . We develop a full cost model which identifies the key cost components and then estimate costs component by component: user costs, infrastructure costs, time and congestion costs, noise costs, accident costs, and pollution costs. The total long run average cost is $0.34 per vehicle kilometer traveled. The s...

  7. Transportable Xenon Laboratory (TXL-1) Operations Manual

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, Robert C.; Stewart, Timothy L.; Willett, Jesse A.; Woods, Vincent T.

    2011-03-07

    The Transportable Xenon Laboratory Operations Manual is a guide to set up and shut down TXL, a fully contained laboratory made up of instruments to identify and measure concentrations of the radioactive isotopes of xenon by taking air samples and analyzing them. The TXL is housed in a standard-sized shipping container. TXL can be shipped to and function in any country in the world.

  8. THE ATTRACTIVENSS AND EFFICIENCY OF PUBLIC TRANSPORT

    Directory of Open Access Journals (Sweden)

    Corinne MULLEY

    2003-01-01

    Using available benchmarking experience, the paper evaluates the relevance of the theory and identifies key attributes for developing more successful performance measurement for public transport operators in the future. This is important because understanding what is best quality performance and attempting to move towards industry best is one of the most secure ways of ensuring the provision of quality services in a financially stable environment.

  9. Vesicular and Plasma Membrane Transporters for Neurotransmitters

    OpenAIRE

    2012-01-01

    The regulated exocytosis that mediates chemical signaling at synapses requires mechanisms to coordinate the immediate response to stimulation with the recycling needed to sustain release. Two general classes of transporter contribute to release, one located on synaptic vesicles that loads them with transmitter, and a second at the plasma membrane that both terminates signaling and serves to recycle transmitter for subsequent rounds of release. Originally identified as the target of psychoacti...

  10. Solute transport scales in an unsaturated stony soil

    Science.gov (United States)

    Coppola, Antonio; Comegna, Alessandro; Dragonetti, Giovanna; Dyck, Miles; Basile, Angelo; Lamaddalena, Nicola; Kassab, Mohamed; Comegna, Vincenzo

    2011-06-01

    Solute transport parameters are known to be scale-dependent due mainly to the increasing scale of heterogeneities with transport distance and with the lateral extent of the transport field examined. Based on a transect solute transport experiment, in this paper we studied this scale dependence by distinguishing three different scales with different homogeneity degrees of the porous medium: the observation scale, transport scale and transect scale. The main objective was to extend the approach proposed by van Wesenbeeck and Kachanoski to evaluating the role of textural heterogeneities on the transition from the observation scale to the transport scale. The approach is based on the scale dependence of transport moments estimated from solute concentrations distributions. In our study, these moments were calculated starting from time normalized resident concentrations measured by time domain reflectometry (TDR) probes at three depths in 37 soil sites 1 m apart along a transect during a steady state transport experiment. The Generalized Transfer Function (GTF) was used to describe the evolution of apparent solute spreading along the soil profile at each observation site by analyzing the propagation of the moments of the concentration distributions. Spectral analysis was used to quantify the relationship between the solid phase heterogeneities (namely, texture and stones) and the scale dependence of the solute transport parameters. Coupling the two approaches allowed us to identify two different transport scales (around 4-5 m and 20 m, respectively) mainly induced by the spatial pattern of soil textural properties. The analysis showed that the larger transport scale is mainly determined by the skeleton pattern of variability. Our analysis showed that the organization in hierarchical levels of soil variability may have major effects on the differences between solute transport behavior at transport scale and transect scale, as the transect scale parameters will include

  11. Sustainable Transport and Performance Indicators

    DEFF Research Database (Denmark)

    Gudmundsson, Henrik

    2004-01-01

    Sustainable transport has become a major policy concern in recent years. The term suggests a need to consider transport in a comprehensive perspective including the well-being of both present and future generations, and taking environmental, social and economic issues into account. Indicators...... in forecasting and tracking the performance of transport systems increasingly guide sustainable transport policy making. This review explores the implications of the sustainable transport” concept and how it can be made operational with indicators. A number of indicator systems are reviewed, and some strengths...... and weaknesses are highlighted with regard to the support they provide for sustainable transport development....

  12. Mifepristone modulates serotonin transporter function

    Institute of Scientific and Technical Information of China (English)

    Chaokun Li; Linlin Shan; Xinjuan Li; Linyu Wei; Dongliang Li

    2014-01-01

    Regulating serotonin expression can be used to treat psychotic depression. Mifepristone, a glu-cocorticoid receptor antagonist, is an effective candidate for psychotic depression treatment. However, the underlying mechanism related to serotonin transporter expression is poorly un-derstood. In this study, we cloned the human brain serotonin transporter into Xenopus oocytes, to establish an in vitro expression system. Two-electrode voltage clamp recordings were used to detect serotonin transporter activity. Our results show that mifepristone attenuates serotonin transporter activity by directly inhibiting the serotonin transporter, and suggests that the se-rotonin transporter is a pharmacological target of mifepristone for the treatment of psychotic depression.

  13. SAFETY AND QUALITY CONTROL OF TRANSPORT SERVICES ON RAILWAY TRANSPORT

    Directory of Open Access Journals (Sweden)

    I. P. Sadlovska

    2010-10-01

    Full Text Available The article presents the provisions to improve procedure of licensing of passenger and freight transportation, technical specifications for services related to the passenger and freight transportations.

  14. Transporter taxonomy - a comparison of different transport protein classification schemes.

    Science.gov (United States)

    Viereck, Michael; Gaulton, Anna; Digles, Daniela; Ecker, Gerhard F

    2014-06-01

    Currently, there are more than 800 well characterized human membrane transport proteins (including channels and transporters) and there are estimates that about 10% (approx. 2000) of all human genes are related to transport. Membrane transport proteins are of interest as potential drug targets, for drug delivery, and as a cause of side effects and drug–drug interactions. In light of the development of Open PHACTS, which provides an open pharmacological space, we analyzed selected membrane transport protein classification schemes (Transporter Classification Database, ChEMBL, IUPHAR/BPS Guide to Pharmacology, and Gene Ontology) for their ability to serve as a basis for pharmacology driven protein classification. A comparison of these membrane transport protein classification schemes by using a set of clinically relevant transporters as use-case reveals the strengths and weaknesses of the different taxonomy approaches.

  15. Polymorphism in ABC transporter genes of Dirofilaria immitis

    Directory of Open Access Journals (Sweden)

    Thangadurai Mani

    2017-08-01

    Full Text Available Dirofilaria immitis, a filarial nematode, causes dirofilariasis in dogs, cats and occasionally in humans. Prevention of the disease has been mainly by monthly use of the macrocyclic lactone (ML endectocides during the mosquito transmission season. Recently, ML resistance has been confirmed in D. immitis and therefore, there is a need to find new classes of anthelmintics. One of the mechanisms associated with ML resistance in nematodes has been the possible role of ATP binding cassette (ABC transporters in reducing drug concentrations at receptor sites. ABC transporters, mainly from sub-families B, C and G, may contribute to multidrug resistance (MDR by active efflux of drugs out of the cell. Gene products of ABC transporters may thus serve as the targets for agents that may modulate susceptibility to drugs, by inhibiting drug transport. ABC transporters are believed to be involved in a variety of physiological functions critical to the parasite, such as sterol transport, and therefore may also serve as the target for drugs that can act as anthelmintics on their own. Knowledge of polymorphism in these ABC transporter genes in nematode parasites could provide useful information for the process of drug design. We have identified 15 ABC transporter genes from sub-families A, B, C and G, in D. immitis, by comparative genomic approaches and analyzed them for polymorphism. Whole genome sequencing data from four ML susceptible (SUS and four loss of efficacy (LOE pooled populations were used for single nucleotide polymorphism (SNP genotyping. Out of 231 SNPs identified in those 15 ABC transporter genes, 89 and 75 of them were specific to the SUS or LOE populations, respectively. A few of the SNPs identified may affect gene expression, protein function, substrate specificity or resistance development and may be useful for transporter inhibitor/anthelmintic drug design, or in order to anticipate resistance development.

  16. Experimental methods for identifying failure mechanisms

    Science.gov (United States)

    Daniel, I. M.

    1983-01-01

    Experimental methods for identifying failure mechanisms in fibrous composites are studied. Methods to identify failure in composite materials includes interferometry, holography, fractography and ultrasonics.

  17. Service Robots for Hospitals: A Case Study of Transportation Tasks in a Hospital

    DEFF Research Database (Denmark)

    Özkil, Ali Gürcan; Fan, Zhun; Dawids, Steen

    2009-01-01

    In this paper, the need for automated transportation systems for hospitals is investigated. Among other alternatives, mobile robots stand out as the most prominent means of automation of transportation tasks in hospitals. Existing transportation routines of a hospital are analyzed in order...... to verify the need for automation and identify possible areas of improvement. The analysis shows that most of the existing transportation is carried out manually, and hospitals can greatly benefit from automated transportation. Based on the results of the analysis, three alternatives are derived...... for implementing mobile service robots for transportation tasks in hospitals....

  18. Advances in methods for identification and characterization of plant transporter function

    DEFF Research Database (Denmark)

    Larsen, Bo; Xu, Deyang; Halkier, Barbara Ann

    2017-01-01

    Transport proteins are crucial for cellular function at all levels. Numerous importers and exporters facilitate transport of a diverse array of metabolites and ions intra- and intercellularly. Identification of transporter function is essential for understanding biological processes at both...... the cellular and organismal level. Assignment of a functional role to individual transporter proteins or to identify a transporter with a given substrate specificity has notoriously been challenging. Recently, major advances have been achieved in function-driven screens, phenotype-driven screens, and in silico......-based approaches. In this review, we highlight examples that illustrate how new technology and tools have advanced identification and characterization of plant transporter functions....

  19. Cysteine transport through excitatory amino acid transporter 3 (EAAT3).

    Science.gov (United States)

    Watts, Spencer D; Torres-Salazar, Delany; Divito, Christopher B; Amara, Susan G

    2014-01-01

    Excitatory amino acid transporters (EAATs) limit glutamatergic signaling and maintain extracellular glutamate concentrations below neurotoxic levels. Of the five known EAAT isoforms (EAATs 1-5), only the neuronal isoform, EAAT3 (EAAC1), can efficiently transport the uncharged amino acid L-cysteine. EAAT3-mediated cysteine transport has been proposed to be a primary mechanism used by neurons to obtain cysteine for the synthesis of glutathione, a key molecule in preventing oxidative stress and neuronal toxicity. The molecular mechanisms underlying the selective transport of cysteine by EAAT3 have not been elucidated. Here we propose that the transport of cysteine through EAAT3 requires formation of the thiolate form of cysteine in the binding site. Using Xenopus oocytes and HEK293 cells expressing EAAT2 and EAAT3, we assessed the transport kinetics of different substrates and measured transporter-associated currents electrophysiologically. Our results show that L-selenocysteine, a cysteine analog that forms a negatively-charged selenolate ion at physiological pH, is efficiently transported by EAATs 1-3 and has a much higher apparent affinity for transport when compared to cysteine. Using a membrane tethered GFP variant to monitor intracellular pH changes associated with transport activity, we observed that transport of either L-glutamate or L-selenocysteine by EAAT3 decreased intracellular pH, whereas transport of cysteine resulted in cytoplasmic alkalinization. No change in pH was observed when cysteine was applied to cells expressing EAAT2, which displays negligible transport of cysteine. Under conditions that favor release of intracellular substrates through EAAT3 we observed release of labeled intracellular glutamate but did not detect cysteine release. Our results support a model whereby cysteine transport through EAAT3 is facilitated through cysteine de-protonation and that once inside, the thiolate is rapidly re-protonated. Moreover, these findings suggest

  20. Functional mining of transporters using synthetic selections

    DEFF Research Database (Denmark)

    Genee, Hans Jasper; Bali, Anne Pihl; Petersen, Søren Dalsgård;

    2016-01-01

    -responsive biosensor systems that enable selective growth of cells only if they encode a ligand-specific importer. We developed such a synthetic selection system for thiamine pyrophosphate and mined soil and gut metagenomes for thiamine-uptake functions. We identified several members of a novel class of thiamine...... transporters, PnuT, which is widely distributed across multiple bacterial phyla. We demonstrate that with modular replacement of the biosensor, we could expand our method to xanthine and identify xanthine permeases from gut and soil metagenomes. Our results demonstrate how synthetic-biology approaches can...

  1. Mass Transport within Soils

    Energy Technology Data Exchange (ETDEWEB)

    McKone, Thomas E.

    2009-03-01

    Contaminants in soil can impact human health and the environment through a complex web of interactions. Soils exist where the atmosphere, hydrosphere, geosphere, and biosphere converge. Soil is the thin outer zone of the earth's crust that supports rooted plants and is the product of climate and living organisms acting on rock. A true soil is a mixture of air, water, mineral, and organic components. The relative proportions of these components determine the value of the soil for agricultural and for other human uses. These proportions also determine, to a large extent, how a substance added to soil is transported and/or transformed within the soil (Spositio, 2004). In mass-balance models, soil compartments play a major role, functioning both as reservoirs and as the principal media for transport among air, vegetation, surface water, deeper soil, and ground water (Mackay, 2001). Quantifying the mass transport of chemicals within soil and between soil and atmosphere is important for understanding the role soil plays in controlling fate, transport, and exposure to multimedia pollutants. Soils are characteristically heterogeneous. A trench dug into soil typically reveals several horizontal layers having different colors and textures. As illustrated in Figure 1, these multiple layers are often divided into three major horizons: (1) the A horizon, which encompasses the root zone and contains a high concentration of organic matter; (2) the B horizon, which is unsaturated, lies below the roots of most plants, and contains a much lower organic carbon content; and (3) the C horizon, which is the unsaturated zone of weathered parent rock consisting of bedrock, alluvial material, glacial material, and/or soil of an earlier geological period. Below these three horizons lies the saturated zone - a zone that encompasses the area below ground surface in which all interconnected openings within the geologic media are completely filled with water. Similarly to the unsaturated

  2. The transport of phosphate between the plasma and dialysate compartments in peritoneal dialysis is influenced by an electric potential difference

    DEFF Research Database (Denmark)

    Graff, J; Fugleberg, S; Brahm, J

    1996-01-01

    was not identifiable. Furthermore, it was demonstrated that the electrochemical gradient between plasma water and dialysate favours the diffusive phosphate transport, and both electric and chemical potentials must be taken into account in calculations of the transperitoneal phosphate transport....

  3. Factors controlling large-wood transport in a mountain river

    Science.gov (United States)

    Ruiz-Villanueva, Virginia; Wyżga, Bartłomiej; Zawiejska, Joanna; Hajdukiewicz, Maciej; Stoffel, Markus

    2016-11-01

    decreases with increasing piece volume, although this relation is not linear. We also document a nonlinear relationship between wood transport and flood magnitude. A threshold discharge was identified below which wood transport is negligible. This threshold is higher in the multithread reach, while in the single-thread reach floods of lower magnitude are able to transport wood downstream. Wood transport ratio increases with discharge until it reaches an upper threshold or tipping point, and then decreases or increases much more slowly. This threshold is clearly related to bankfull discharge, but it is much higher for the multithread reach than for the single-thread one. Although modelling input and field observations were taken from a specific river, our findings and conclusions are likely to be applicable to a much larger suite of (mountain) rivers.

  4. Interaction of railway and marine transport (Murmansk Transport Hub

    Directory of Open Access Journals (Sweden)

    Sokolov A.A.

    2015-03-01

    Full Text Available The classification of problems of interaction between water (marine and railway transport on the example of the Murmansk Transport Hub has been presented; some prospects for the development of technology for interaction with the logistics of transportation of general cargo in the Murmansk Commercial Seaport, Murmansk Marine Fishing Port, and oil terminals of the Kola Bay have been shown

  5. The cost of transportation`s oil dependence

    Energy Technology Data Exchange (ETDEWEB)

    Greene, D.L.

    1995-05-01

    Transportation is critical to the world`s oil dependence problem because of the large share of world oil it consumes and because of its intense dependence on oil. This paper will focus on the economic costs of transportation`s oil dependence.

  6. Glutamate transporters combine transporter- and channel-like features

    NARCIS (Netherlands)

    Slotboom, DJ; Konings, WN; Lolkema, JS

    2001-01-01

    Glutamate transporters in the mammalian central nervous system have a unique position among secondary transport proteins as they exhibit glutamate-gated chloride-channel activity in addition to glutamate-transport activity. In this article, the available data on the structure of the glutamate transp

  7. Arsenite transport in plants.

    Science.gov (United States)

    Ali, Waqar; Isayenkov, Stanislav V; Zhao, Fang-Jie; Maathuis, Frans J M

    2009-07-01

    Arsenic is a metalloid which is toxic to living organisms. Natural occurrence of arsenic and human activities have led to widespread contamination in many areas of the world, exposing a large section of the human population to potential arsenic poisoning. Arsenic intake can occur through consumption of contaminated crops and it is therefore important to understand the mechanisms of transport, metabolism and tolerance that plants display in response to arsenic. Plants are mainly exposed to the inorganic forms of arsenic, arsenate and arsenite. Recently, significant progress has been made in the identification and characterisation of proteins responsible for movement of arsenite into and within plants. Aquaporins of the NIP (nodulin26-like intrinsic protein) subfamily were shown to transport arsenite in planta and in heterologous systems. In this review, we will evaluate the implications of these new findings and assess how this may help in developing safer and more tolerant crops.

  8. Competitiveness in Road Transport

    DEFF Research Database (Denmark)

    Borgström, Benedikte; Gammelgaard, Britta; Bruun, Poul

    Road transport is an important sector, connecting time and space of production and consumption. Its market conditions has changed. The EU single market implementation has increased price pressure due to supply of low cost road freight transport from counties with lower cost structures. Changes....... In this paper we will explore that knowledge gap and analyze what value proposition(s) and capabilities can transform potential cost disadvantages of acting in a market that includes both high- and low-cost-country actors? And in conceptual terminology, how are capabilities deployed and developed to construct...... take into account logistics service supplier strategic management. We also contribute with better understanding of value creation in order to escape commoditization and differentiate services through relationships (customers and/or other hauliers). Practical implications concern hauliers’ strategy...

  9. Rail transport systems approach

    CERN Document Server

    2017-01-01

    This book shows how the systems approach is employed by scientists in various countries to solve specific problems concerning railway transport. In particular, the book describes the experiences of scientists from Romania, Germany, the Czech Republic, the UK, Russia, Ukraine, Lithuania and Poland. For many of these countries there is a problem with the historical differences between the railways. In particular, there are railways with different rail gauges, with different signaling and communication systems, with different energy supplies and, finally, with different political systems, which are reflected in the different approaches to the management of railway economies. The book’s content is divided into two main parts, the first of which provides a systematic analysis of individual means of providing and maintaining rail transport. In turn, the second part addresses infrastructure and management development, with particular attention to security issues. Though primarily written for professionals involved...

  10. Transportation and the marketplace

    Energy Technology Data Exchange (ETDEWEB)

    Soeoet, S. [Univ. of Illinois, Chicago, IL (United States)

    1996-12-31

    In the Chicago six-county metropolitan area, the number of registered vehicles grew by over 800,000 vehicles in the 1980s; by contrast the population increased by just over 150,000 during the same time. This ratio of growth in automobiles versus population (five to one) has contributed to overall increases in travel, congestion and energy use. The objective of this report is to examine how and why this has occurred and what we might expect in the near future to address the growing traffic problems and energy use. Specifically, the focus is on energy use by household vehicles and other forms of passenger travel. Data on population trends, gasoline prices, commuting and transit use, and transportation energy use are presented and interpreted. Intelligent transportation systems and decreased single vehicle emissions are briefly described as methods to decrease congestion and pollution. 9 figs., 2 tabs.

  11. Fractional lattice charge transport

    Science.gov (United States)

    Flach, Sergej; Khomeriki, Ramaz

    2017-01-01

    We consider the dynamics of noninteracting quantum particles on a square lattice in the presence of a magnetic flux α and a dc electric field E oriented along the lattice diagonal. In general, the adiabatic dynamics will be characterized by Bloch oscillations in the electrical field direction and dispersive ballistic transport in the perpendicular direction. For rational values of α and a corresponding discrete set of values of E(α) vanishing gaps in the spectrum induce a fractionalization of the charge in the perpendicular direction - while left movers are still performing dispersive ballistic transport, the complementary fraction of right movers is propagating in a dispersionless relativistic manner in the opposite direction. Generalizations and the possible probing of the effect with atomic Bose-Einstein condensates and photonic networks are discussed. Zak phase of respective band associated with gap closing regime has been computed and it is found converging to π/2 value. PMID:28102302

  12. Macropores and macropore transport

    DEFF Research Database (Denmark)

    Iversen, Bo Vangsø; Lamandé, Mathieu; Torp, Søren Bent

    2012-01-01

    a stronger relationship was found at saturation. Results of a test of the number of soil columns needed for a representative distribution of macropores for the measurement of saturated hydraulic conductivity indicated that approximately six soil columns were enough. Our work suggests that integrating......Preferential transport of water through soil macropores is a governing process in the facilitated transport of strongly sorbing compounds. The aim of this study was to investigate the relationships between macropore density and the hydraulic conductivity of the soil and to test the sampling...... representativeness of soil columns for the measurement of saturated hydraulic conductivity. Macropore density was determined in three horizons in four typical, Danish soil types (third year of pasture) and saturated hydraulic conductivity and near-saturated hydraulic conductivity were measured in the laboratory...

  13. Means of Transport

    DEFF Research Database (Denmark)

    Balle, Søren Hattesen

    2004-01-01

    The car is probably one of the most central signifiers of modern scientific and technological progress. Not only did its introduction in early 20th century America quite literally move scientific progress into the street, it also provided its increasing number of users with new and technologically...... improved means of fast physical movement from one place to another. Yet, the impact that the technology of automobility came to have was not of a limited materialistic nature. As many literary and cultural critics have noted, car technology extended its influence into the field of imaginative transport...... as a means of physical and spiritual transport is thus consistently embedded in a less idealized context, where its technological machinery is foregrounded. In conclusion, the paper argues that Williams’s thematic treatment of the car in his writings may be read as a modern poet’s meta-poetic gloss on poetry...

  14. Vibration enhanced quantum transport

    CERN Document Server

    Semião, F L; Milburn, G J

    2009-01-01

    In this paper, we study the role of a collective vibrational motion in the phenomenon of electronic energy transfer (EET) between chromophores with different electronic transition frequencies. Previous experimental work on EET in conjugated polymer samples has suggested that the common structural framework of the macromolecule introduce correlations in the energy gap fluctuations which cause coherent EET. We present a simple model describing the coupling between the chromophores and a common vibrational mode, and find that vibration can indeed lead to an enhancement in the transport of excitations across the quantum network. Furthermore, in our model phase information is partially retained in the transfer process from a donor to an acceptor, as experimentally demonstrated in the conjugated polymer system. Consequently, this mechanism of vibration enhanced quantum transport might find applications in quantum information transfer of qubit states or entanglement.

  15. Cellular iron transport.

    Science.gov (United States)

    Garrick, Michael D; Garrick, Laura M

    2009-05-01

    Iron has a split personality as an essential nutrient that also has the potential to generate reactive oxygen species. We discuss how different cell types within specific tissues manage this schizophrenia. The emphasis in enterocytes is on regulating the body's supply of iron by regulating transport into the blood stream. In developing red blood cells, adaptations in transport manage the body's highest flux of iron. Hepatocytes buffer the body's stock of iron. Macrophage recycle the iron from effete red cells among other iron management tasks. Pneumocytes provide a barrier to prevent illicit entry that, when at risk of breaching, leads to a need to handle the dangers in a fashion essentially shared with macrophage. We also discuss or introduce cell types including renal cells, neurons, other brain cells, and more where our ignorance, currently still vast, needs to be removed by future research.

  16. retardo de transporte

    Directory of Open Access Journals (Sweden)

    Paola Niño-Suárez

    2006-01-01

    Full Text Available En este trabajo se presenta la obtención del modelo exacto en tiempo discreto de un robot móvil tipo (2,0, bajo la consideración de la existencia de retardos de transporte en la señal de control, producidos por la propagación de las señales entre los sensores y actuadores del robot y el control remoto. El modelo obtenido es evaluado mediante simulación, comparando su desempeño con un modelo discreto aproximado que incluye también retardos de transporte y con el modelo en tiempo continuo del mismo sistema.

  17. Current state and near-term prospects for development of the transport logistics market in Ukraine

    Directory of Open Access Journals (Sweden)

    Olena Karpenko

    2017-05-01

    Full Text Available The article has studied the current state of the transport services market in Ukraine, characterized features of the favorable geopolitical position of the country, identified segments of the market of transport and logistics services in Ukraine, made an analysis of the dynamics of freight transportation by land transport, determined its capacity in money terms and calculated the component share of this type of activity in the country’s GDP.

  18. Integration of inland waterway transport in the intermodal supply chain: a taxonomy of research challenges

    OpenAIRE

    Caris, An; Limbourg, Sabine; Macharis, Cathy; Van Lier, Tom; Cools, Mario

    2014-01-01

    This paper identifies research opportunities which will enable the further integration of inland waterway transport in the intermodal supply chain. Intermodal transport may be interpreted as a chain of actors who supply a transport service. Inland navigation can play a crucial role in increasing supply chain service performance. A first group of research challenges lies in the evolving relationship between transport geography and logistics activities. The next set of research challenges has t...

  19. Transport of lipopolysaccharide across the cell envelope: the long road of discovery.

    Science.gov (United States)

    Ruiz, Natividad; Kahne, Daniel; Silhavy, Thomas J

    2009-09-01

    Intracellular lipid transport is poorly understood. Genetic studies to identify lipid-transport factors are complicated by the essentiality of many lipids, whereas biochemical and cell biology approaches aiming to determine localization and mechanisms of lipid transport are often challenged by the lack of adequate technology. Here, we review the epic history of how different approaches, technological advances and ingenuity contributed to the recent discovery of a multi-protein pathway that transports lipopolysaccharide across the envelope of Gram-negative bacteria.

  20. Transport phenomena II essentials

    CERN Document Server

    REA, The Editors of

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Transport Phenomena II covers forced convention, temperature distribution, free convection, diffusitivity and the mechanism of mass transfer, convective mass transfer, concentration

  1. Community Sediment Transport Model

    Science.gov (United States)

    2007-01-01

    are used to determine that model results are consistent across compilers, platforms, and computer architectures , and to ensure that changes in code do...Mississippi State University: Bhate During the early months of this project, the focus was on understanding ROMS-CSTM model, architecture , and...Marchesiello, J.C. McWilliams, & K.D. Stolzenbach, 2007: Sediment transport modeling on Southern Californian shelves: A ROMS case study. Continental

  2. Transport Phenomena in Gel

    Directory of Open Access Journals (Sweden)

    Masayuki Tokita

    2016-05-01

    Full Text Available Gel becomes an important class of soft materials since it can be seen in a wide variety of the chemical and the biological systems. The unique properties of gel arise from the structure, namely, the three-dimensional polymer network that is swollen by a huge amount of solvent. Despite the small volume fraction of the polymer network, which is usually only a few percent or less, gel shows the typical properties that belong to solids such as the elasticity. Gel is, therefore, regarded as a dilute solid because its elasticity is much smaller than that of typical solids. Because of the diluted structure, small molecules can pass along the open space of the polymer network. In addition to the viscous resistance of gel fluid, however, the substance experiences resistance due to the polymer network of gel during the transport process. It is, therefore, of importance to study the diffusion of the small molecules in gel as well as the flow of gel fluid itself through the polymer network of gel. It may be natural to assume that the effects of the resistance due to the polymer network of gel depends strongly on the network structure. Therefore, detailed study on the transport processes in and through gel may open a new insight into the relationship between the structure and the transport properties of gel. The two typical transport processes in and through gel, that is, the diffusion of small molecules due to the thermal fluctuations and the flow of gel fluid that is caused by the mechanical pressure gradient will be reviewed.

  3. Introduction to thermal transport

    Directory of Open Access Journals (Sweden)

    Simon R. Phillpot

    2005-06-01

    Full Text Available The relentless increase in the thermal loads imposed on devices and materials structures is driving renewed interest among materials scientists and engineers in the area of thermal transport. Applications include thermal barrier coatings on turbine blades, thermoelectric coolers, high-performance thermal transfer liquids, and heat dissipation in microelectronics. These, and other applications, demand not only ever more efficient thermal management, but also a better fundamental understanding of the underlying physical mechanisms.

  4. ADVANCED CUTTINGS TRANSPORT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Mark Pickell; Len Volk; Mike Volk; Barkim Demirdal; Affonso Lourenco; Evren Ozbayoglu; Paco Vieira

    2000-10-30

    This is the first quarterly progress report for Year 2 of the ACTS project. It includes a review of progress made in Flow Loop development and research during the period of time between July 14, 2000 and September 30, 2000. This report presents information on the following specific tasks: (a) Progress in Advanced Cuttings Transport Facility design and development (Task 2), (b) Progress on research project (Task 8): ''Study of Flow of Synthetic Drilling Fluids Under Elevated Pressure and Temperature Conditions'', (c) Progress on research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (d) Progress on research project (Task 7): ''Study of Cuttings Transport with Aerated Muds Under LPAT Conditions (Joint Project with TUDRP)'', (e) Progress on research project (Task 9): ''Study of Foam Flow Behavior Under EPET Conditions'', (f) Initiate research on project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions'', (g) Progress on instrumentation tasks to measure: Cuttings concentration and distribution (Tasks 11), and Foam properties (Task 12), (h) Initiate a comprehensive safety review of all flow-loop components and operational procedures. Since the previous Task 1 has been completed, we will now designate this new task as: (Task 1S). (i) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members.

  5. ADVANCED CUTTINGS TRANSPORT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Ergun Kuru; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Len Volk; Mark Pickell; Evren Ozbayoglu; Barkim Demirdal; Paco Vieira; Affonso Lourenco

    1999-10-15

    This report includes a review of the progress made in ACTF Flow Loop development and research during 90 days pre-award period (May 15-July 14, 1999) and the following three months after the project approval date (July15-October 15, 1999) The report presents information on the following specific subjects; (a) Progress in Advanced Cuttings Transport Facility design and development, (b) Progress report on the research project ''Study of Flow of Synthetic Drilling Fluids Under Elevated Pressure and Temperature Conditions'', (c) Progress report on the research project ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (d) Progress report on the research project ''Study of Cuttings Transport with Aerated Muds Under LPAT Conditions (Joint Project with TUDRP)'', (e) Progress report on the research project ''Study of Foam Flow Behavior Under EPET Conditions'', (f) Progress report on the instrumentation tasks (Tasks 11 and 12) (g) Activities towards technology transfer and developing contacts with oil and service company members.

  6. ADVANCED CUTTINGS TRANSPORT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Mark Pickell; Len Volk, Mike Volk; Lei Zhou; Zhu Chen; Crystal Redden; Aimee Washington

    2002-10-30

    This is the first quarterly progress report for Year-4 of the ACTS Project. It includes a review of progress made in: (1) Flow Loop construction and development and (2) research tasks during the period of time between July 1, 2002 and Sept. 30, 2002. This report presents a review of progress on the following specific tasks: (a) Design and development of an Advanced Cuttings Transport Facility Task 3: Addition of a Cuttings Injection/Separation System, Task 4: Addition of a Pipe Rotation System, (b) New Research project (Task 9b): ''Development of a Foam Generator/Viscometer for Elevated Pressure and Elevated Temperature (EPET) Conditions'', (d) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions'', (e) Research on three instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), Foam texture while transporting cuttings (Task 12), Viscosity of Foam under EPET (Task 9b). (f) Development of a Safety program for the ACTS Flow Loop. Progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S). (g) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members.

  7. Mitochondrial ABC transporters.

    Science.gov (United States)

    Lill, R; Kispal, G

    2001-01-01

    In contrast to bacteria, mitochondria contain only a few ATP binding cassette (ABC) transporters in their inner membrane. The known mitochondrial ABC proteins fall into two major classes that, in the yeast Saccharomyces cerevisiae, are represented by the half-transporter Atm1p and the two closely homologous proteins Mdl1p and Mdl2p. In humans two Atm1p orthologues (ABC7 and MTABC3) and two proteins homologous to Mdll/2p have been localized to mitochondria. The Atm1p-like proteins perform an important function in mitochondrial iron homeostasis and in the maturation of Fe/S proteins in the cytosol. Mutations in ABC7 are causative of hereditary X-linked sideroblastic anemia and cerebellar ataxia (XLSA/A). MTABC3 may be a candidate gene for the lethal neonatal syndrome. The function of the mitochondrial Mdl1/2p-like proteins is not clear at present with the notable exception of murine ABC-me that may transport intermediates of heme biosynthesis from the matrix to the cytosol in erythroid tissues.

  8. GIS and Transport Modeling—Strengthening the Spatial Perspective

    Directory of Open Access Journals (Sweden)

    Martin Loidl

    2016-06-01

    Full Text Available The movement and transport of people and goods is spatial by its very nature. Thus, geospatial fundamentals of transport systems need to be adequately considered in transport models. Until recently, this was not always the case. Instead, transport research and geography evolved widely independently in domain silos. However, driven by recent conceptual, methodological and technical developments, the need for an integrated approach is obvious. This paper attempts to outline the potential of Geographical Information Systems (GIS for transport modeling. We identify three fields of transport modeling where the spatial perspective can significantly contribute to a more efficient modeling process and more reliable model results, namely, geospatial data, disaggregated transport models and the role of geo-visualization. For these three fields, available findings from various domains are compiled, before open aspects are formulated as research directions, with exemplary research questions. The overall aim of this paper is to strengthen the spatial perspective in transport modeling and to call for a further integration of GIS in the domain of transport modeling.

  9. Transport infrastructure development in China

    Directory of Open Access Journals (Sweden)

    Bouraima Mouhamed Bayane

    2017-05-01

    Full Text Available This paper reviews the historical configuration process of transportation systems in China and examines the relationship between economic development and transport system at three different levels. The current status of transport infrastructure system development in China is summarized at national and regional level. The investment trends for transport infrastructure in China are also depicted. The keys issues relating to government initiatives are presented.

  10. 'Resilience thinking' in transport planning

    OpenAIRE

    Wang, JYT

    2015-01-01

    Resilience has been discussed in ecology for over forty years. While some aspects of resilience have received attention in transport planning, there is no unified definition of resilience in transportation. To define resilience in transportation, I trace back to the origin of resilience in ecology with a view of revealing the essence of resilience thinking and its relevance to transport planning. Based on the fundamental concepts of engineering resilience and ecological resilience, I define "...

  11. 'Resilience thinking' in transport planning

    OpenAIRE

    Wang, JYT

    2015-01-01

    Resilience has been discussed in ecology for over forty years. While some aspects of resilience have received attention in transport planning, there is no unified definition of resilience in transportation. To define resilience in transportation, I trace back to the origin of resilience in ecology with a view of revealing the essence of resilience thinking and its relevance to transport planning. Based on the fundamental concepts of engineering resilience and ecological resilience, I define "...

  12. Cloning and characterization of a functional human ¿-aminobutyric acid (GABA) transporter, human GAT-2

    DEFF Research Database (Denmark)

    Christiansen, Bolette; Meinild, Anne-Kristine; Jensen, Anders A.

    2007-01-01

    Plasma membrane gamma-aminobutyric acid (GABA) transporters act to terminate GABA neurotransmission in the mammalian brain. Intriguingly four distinct GABA transporters have been cloned from rat and mouse, whereas only three functional homologs of these transporters have been cloned from human....... The aim of this study therefore was to search for this fourth missing human transporter. Using a bioinformatics approach, we successfully identified and cloned the full-length cDNA of a so far uncharacterized human GABA transporter (GAT). The predicted protein displays high sequence similarity to rat GAT......-2 and mouse GAT3, and in accordance with the nomenclature for rat GABA transporters, we therefore refer to the transporter as human GAT-2. We used electrophysiological and cell-based methods to demonstrate that this protein is a functional transporter of GABA. The transport was saturable...

  13. Spatial Planning & Transport Engineering Using Children's Maps to Locate Areas of Perceived Danger on Children's Routes to School

    OpenAIRE

    2014-01-01

    Dublin faces many of the modern day transport problems associated with automobile transport. The bicycle is increasingly being viewed by Urban Planners as an interesting form of individual transportation which can form part of an integrated transportation solution to this problem. For cycling to be a sustainable mode of transport it must be all inclusive. However, there are some identifiable barriers which prevent certain groups in society from cycling. Barriers to children cycling are direct...

  14. Challenges of Monte Carlo Transport

    Energy Technology Data Exchange (ETDEWEB)

    Long, Alex Roberts [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-10

    These are slides from a presentation for Parallel Summer School at Los Alamos National Laboratory. Solving discretized partial differential equations (PDEs) of interest can require a large number of computations. We can identify concurrency to allow parallel solution of discrete PDEs. Simulated particles histories can be used to solve the Boltzmann transport equation. Particle histories are independent in neutral particle transport, making them amenable to parallel computation. Physical parameters and method type determine the data dependencies of particle histories. Data requirements shape parallel algorithms for Monte Carlo. Then, Parallel Computational Physics and Parallel Monte Carlo are discussed and, finally, the results are given. The mesh passing method greatly simplifies the IMC implementation and allows simple load-balancing. Using MPI windows and passive, one-sided RMA further simplifies the implementation by removing target synchronization. The author is very interested in implementations of PGAS that may allow further optimization for one-sided, read-only memory access (e.g. Open SHMEM). The MPICH_RMA_OVER_DMAPP option and library is required to make one-sided messaging scale on Trinitite - Moonlight scales poorly. Interconnect specific libraries or functions are likely necessary to ensure performance. BRANSON has been used to directly compare the current standard method to a proposed method on idealized problems. The mesh passing algorithm performs well on problems that are designed to show the scalability of the particle passing method. BRANSON can now run load-imbalanced, dynamic problems. Potential avenues of improvement in the mesh passing algorithm will be implemented and explored. A suite of test problems that stress DD methods will elucidate a possible path forward for production codes.

  15. Algae and humans share a molybdate transporter.

    Science.gov (United States)

    Tejada-Jiménez, Manuel; Galván, Aurora; Fernández, Emilio

    2011-04-19

    Almost all living organisms need to obtain molybdenum from the external medium to achieve essential processes for life. Activity of important enzymes such as sulfite oxidase, aldehyde oxidase, xanthine dehydrogenase, and nitrate reductase is strictly dependent on the presence of Mo in its active site. Cells take up Mo in the form of the oxianion molybdate, but the molecular nature of the transporters is still not well known in eukaryotes. MOT1 is the first molybdate transporter identified in plant-type eukaryotic organisms, but it is absent in animal genomes. Here we report a molybdate transporter different from the MOT1 family, encoded by the Chlamydomonas reinhardtii gene MoT2, that is also present in animals including humans. The knockdown of CrMoT2 transcription leads to the deficiency of molybdate uptake activity in Chlamydomonas. In addition, heterologous expression in Saccharomyces cerevisiae of MoT2 genes from Chlamydomonas and humans support the functionality of both proteins as molybdate transporters. Characterization of CrMOT2 and HsMOT2 activities showed an apparent Km of about 550 nM that, though higher than the Km reported for MOT1, still corresponds to high affinity systems. CrMoT2 transcription is activated when extracellular molybdate concentration is low but in contrast to MoT1 is not activated by nitrate. Analysis of protein databases revealed the presence of four motifs present in all the proteins with high similarity to MOT2, that label a previously undescribed family of proteins probably related to molybdate transport. Our results open the way toward the understanding of molybdate transport as part of molybdenum homeostasis and Moco biosynthesis in animals.

  16. Saturated Zone Colloid Transport

    Energy Technology Data Exchange (ETDEWEB)

    H. S. Viswanathan

    2004-10-07

    This scientific analysis provides retardation factors for colloids transporting in the saturated zone (SZ) and the unsaturated zone (UZ). These retardation factors represent the reversible chemical and physical filtration of colloids in the SZ. The value of the colloid retardation factor, R{sub col} is dependent on several factors, such as colloid size, colloid type, and geochemical conditions (e.g., pH, Eh, and ionic strength). These factors are folded into the distributions of R{sub col} that have been developed from field and experimental data collected under varying geochemical conditions with different colloid types and sizes. Attachment rate constants, k{sub att}, and detachment rate constants, k{sub det}, of colloids to the fracture surface have been measured for the fractured volcanics, and separate R{sub col} uncertainty distributions have been developed for attachment and detachment to clastic material and mineral grains in the alluvium. Radionuclides such as plutonium and americium sorb mostly (90 to 99 percent) irreversibly to colloids (BSC 2004 [DIRS 170025], Section 6.3.3.2). The colloid retardation factors developed in this analysis are needed to simulate the transport of radionuclides that are irreversibly sorbed onto colloids; this transport is discussed in the model report ''Site-Scale Saturated Zone Transport'' (BSC 2004 [DIRS 170036]). Although it is not exclusive to any particular radionuclide release scenario, this scientific analysis especially addresses those scenarios pertaining to evidence from waste-degradation experiments, which indicate that plutonium and americium may be irreversibly attached to colloids for the time scales of interest. A section of this report will also discuss the validity of using microspheres as analogs to colloids in some of the lab and field experiments used to obtain the colloid retardation factors. In addition, a small fraction of colloids travels with the groundwater without any significant

  17. ADVANCED CUTTINGS TRANSPORT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Stefan Miska; Troy Reed; Ergun Kuru

    2004-09-30

    The Advanced Cuttings Transport Study (ACTS) was a 5-year JIP project undertaken at the University of Tulsa (TU). The project was sponsored by the U.S. Department of Energy (DOE) and JIP member companies. The objectives of the project were: (1) to develop and construct a new research facility that would allow three-phase (gas, liquid and cuttings) flow experiments under ambient and EPET (elevated pressure and temperature) conditions, and at different angle of inclinations and drill pipe rotation speeds; (2) to conduct experiments and develop a data base for the industry and academia; and (3) to develop mechanistic models for optimization of drilling hydraulics and cuttings transport. This project consisted of research studies, flow loop construction and instrumentation development. Following a one-year period for basic flow loop construction, a proposal was submitted by TU to the DOE for a five-year project that was organized in such a manner as to provide a logical progression of research experiments as well as additions to the basic flow loop. The flow loop additions and improvements included: (1) elevated temperature capability; (2) two-phase (gas and liquid, foam etc.) capability; (3) cuttings injection and removal system; (4) drill pipe rotation system; and (5) drilling section elevation system. In parallel with the flow loop construction, hydraulics and cuttings transport studies were preformed using drilling foams and aerated muds. In addition, hydraulics and rheology of synthetic drilling fluids were investigated. The studies were performed under ambient and EPET conditions. The effects of temperature and pressure on the hydraulics and cuttings transport were investigated. Mechanistic models were developed to predict frictional pressure loss and cuttings transport in horizontal and near-horizontal configurations. Model predictions were compared with the measured data. Predominantly, model predictions show satisfactory agreements with the measured data. As a

  18. The Capacity to Integrate and Deal with Environmental Issues in Local Transport Policy and Planning

    DEFF Research Database (Denmark)

    Hansen, Carsten Jahn

    2002-01-01

    The article identifies and discuss the capacity to integrate and deal with environmental issues in local transport policy-making and planning processes.......The article identifies and discuss the capacity to integrate and deal with environmental issues in local transport policy-making and planning processes....

  19. The Capacity to Integrate and Deal with Environmental Issues in Local Transport Policy and Planning

    DEFF Research Database (Denmark)

    Hansen, Carsten Jahn

    2002-01-01

    The article identifies and discuss the capacity to integrate and deal with environmental issues in local transport policy-making and planning processes.......The article identifies and discuss the capacity to integrate and deal with environmental issues in local transport policy-making and planning processes....

  20. The potential of Volunteered Geographic Information (VGI) in future transport systems

    OpenAIRE

    2016-01-01

    As transport systems are pushed to the limits in many cities, governments have tried to resolve problems of traffic and congestion by increasing capacity. Miller (2013) contends the need to identify new capabilities (instead of capacity) of the transport infrastructure in order to increase efficiency without extending the physical infrastructure. Kenyon and Lyons (2003) identified integrated traveller information as a facilitator for better transport decisions. Today, with further development...

  1. Genetic defects in hepatocanalicular transport

    NARCIS (Netherlands)

    Thompson, R; Jansen, PLM

    2000-01-01

    Bile is made as the result of active transport of its constituents into the biliary space. Most of this transport occurs across the canalicular membrane, with a further contribution from cholangiocytes. Water moves passively into bile. The major substrates that are transported out of hepatocytes are

  2. Improving Hygiene in Food Transportation

    NARCIS (Netherlands)

    Thoden van Velzen, E.U.; Lukasse, L.J.S.

    2016-01-01

    The hygiene aspect of food transport has become an issue for European transport operators. This development started roughly in 1990, when national governments urged transport operators to act on food safety. However, nowadays retailers and food producers are demanding more hygiene measures from

  3. Genetic defects in hepatocanalicular transport

    NARCIS (Netherlands)

    Thompson, R; Jansen, PLM

    2000-01-01

    Bile is made as the result of active transport of its constituents into the biliary space. Most of this transport occurs across the canalicular membrane, with a further contribution from cholangiocytes. Water moves passively into bile. The major substrates that are transported out of hepatocytes are

  4. Improving Hygiene in Food Transportation

    NARCIS (Netherlands)

    Thoden van Velzen, E.U.; Lukasse, L.J.S.

    2016-01-01

    The hygiene aspect of food transport has become an issue for European transport operators. This development started roughly in 1990, when national governments urged transport operators to act on food safety. However, nowadays retailers and food producers are demanding more hygiene measures from tran

  5. Energy efficiency in refrigerated transport

    NARCIS (Netherlands)

    Gerwen, R.J.M. van; Sluis, S.M. van der; Schiphouwer, H.

    1998-01-01

    In refrigerated road transport, 10 to 40 `)/0 of the total energy consumption is related to refrigeration. However, energy consumption and energy efficiency of refrigerated transport equipment is rarely mentioned in the discussions about energy saving, potentials in road transport. Two main approach

  6. Products - transport - storage; Produits - transports - stockages

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2005-04-15

    9 articles are gathered in this data-sheet; they deal with LPG products, transport and storage. Blackmer offers a full line of LPG equipment for the transfer of propane, butane and anhydrous ammonia. Clesse Industries and Gas Equipment Company equip luxury hotels in Dubai and Abu Dhabi. Since 1975 the company FAS Flussiggas-Anlagen Gmbh, Salzgitter - Germany is one of the leading manufacturers of LPG equipment and components for mobile and stationary bulk plants in Europe. The main products are dispensers, pumps, Auto-gas filling stations, vaporizers, loading arms, electronic cylinder filling scales, flanged valves and safety equipment. FAS is certified with 2 process orientated management systems according to DIN EN ISO 9001:2000 and to PED - Module H1 - Category IV. The company supplies all products and services according to the Pressure Equipment Directive 97/23/EC with CE-mark as well according to regulations ATEX, OIML, TUV, PTB... ECII Engineered Controls International/Rego USA is well known as a worldwide leader and designer/manufacturer of LPG and anhydrous ammonia equipment. The 10. of January Per Sture Jenssen retired from Ragasco A.S. Managing Director after 6 years in the company. Oyvind Hamre who has taken over from Mr. Jenssen, is 39 years of age and he has been 10 years with Ragasco, most recently as R and D Manager. Per Sture Jenssen will still be present in the company until summer 2005 to support during the transition. Corken has put in the market two new products: a new valve and a new pump. Impco Technologies announces completion of BRC acquisition. VOC reduction is a common discussion issue in almost all sectors of the oil business and beyond. Each industry sector has a different strategy towards this issue according to its perceived impact on the business. Although largely motivated by the need to satisfy national and international emission standards, the move towards reduction has encouraged equipment manufacturers to develop advanced

  7. Common folds and transport mechanisms of secondary active transporters.

    Science.gov (United States)

    Shi, Yigong

    2013-01-01

    Secondary active transporters exploit the electrochemical potential of solutes to shuttle specific substrate molecules across biological membranes, usually against their concentration gradient. Transporters of different functional families with little sequence similarity have repeatedly been found to exhibit similar folds, exemplified by the MFS, LeuT, and NhaA folds. Observations of multiple conformational states of the same transporter, represented by the LeuT superfamily members Mhp1, AdiC, vSGLT, and LeuT, led to proposals that structural changes are associated with substrate binding and transport. Despite recent biochemical and structural advances, our understanding of substrate recognition and energy coupling is rather preliminary. This review focuses on the common folds and shared transport mechanisms of secondary active transporters. Available structural information generally supports the alternating access model for substrate transport, with variations and extensions made by emerging structural, biochemical, and computational evidence.

  8. Active transport and obesity prevention - A transportation sector obesity impact scoping review and assessment for Melbourne, Australia.

    Science.gov (United States)

    Brown, V; Moodie, M; Mantilla Herrera, A M; Veerman, J L; Carter, R

    2017-03-01

    Given the alarming prevalence of obesity worldwide and the need for interventions to halt the growing epidemic, more evidence on the role and impact of transport interventions for obesity prevention is required. This study conducts a scoping review of the current evidence of association between modes of transport (motor vehicle, walking, cycling and public transport) and obesity-related outcomes. Eleven reviews and thirty-three primary studies exploring associations between transport behaviours and obesity were identified. Cohort simulation Markov modelling was used to estimate the effects of body mass index (BMI) change on health outcomes and health care costs of diseases causally related to obesity in the Melbourne, Australia population. Results suggest that evidence for an obesity effect of transport behaviours is inconclusive (29% of published studies reported expected associations, 33% mixed associations), and any potential BMI effect is likely to be relatively small. Hypothetical scenario analyses suggest that active transport interventions may contribute small but significant obesity-related health benefits across populations (approximately 65 health adjusted life years gained per year). Therefore active transport interventions that are low cost and targeted to those most amenable to modal switch are the most likely to be effective and cost-effective from an obesity prevention perspective. The uncertain but potentially significant opportunity for health benefits warrants the collection of more and better quality evidence to fully understand the potential relationships between transport behaviours and obesity. Such evidence would contribute to the obesity prevention dialogue and inform policy across the transportation, health and environmental sectors.

  9. Development of an analysis capability for the National Transportation System

    Energy Technology Data Exchange (ETDEWEB)

    Anson, D.; Nelson, R.

    1997-10-24

    The purpose of this report is to examine the Department of Transportation`s (DOT) National Transportation System (NTS) initiative, to document what has been learned, and to outline a National Transportation Network Analysis Capability (NTNAC) based on a ``TRANSIMS-like`` approach. This study was conducted over a two month period at the end of FY1997. The scope of the effort was carefully defined to accommodate the short time horizon and to provide focus to a very large analytical problem. The objectives were to: (1) define the NTS and the NTS problem; (2) identify problem characteristics; (3) describe an analytical solution based on the TRANSIMS approach; (4) identify data requirements and availability; (5) develop criteria for a scenario to be used in a prototype demonstration; and (6) select a scenario for the prototype demonstration.

  10. A cooperative system of silicon transport in plants.

    Science.gov (United States)

    Ma, Jian Feng; Yamaji, Naoki

    2015-07-01

    The high accumulation of silicon (Si) protects plants from biotic and abiotic stresses. Two different types of Si transporter [Low Silicon 1 (Lsi1) and 2 (Lsi2)] involved in the uptake and distribution of Si have been identified. Lsi1, a Si permeable channel, belongs to the Nod26-like major intrinsic protein (NIP) III subgroup of the aquaporin membrane protein family with a distinct selectivity, whereas Lsi2, an efflux Si transporter, belongs to an uncharacterized anion transporter family. These transporters are localized to the plasma membrane, but, in different plant species, show different expression patterns and tissue or cellular localizations that are associated with different levels of Si accumulation. A recent mathematical modeling study revealed that cooperation of Lsi1 and Lsi2, which show a polarized localization, is required for the efficient transport of Si in rice.

  11. Traffic jams II: an update of diseases of intracellular transport.

    Science.gov (United States)

    Aridor, Meir; Hannan, Lisa A

    2002-11-01

    As more details emerge on the mechanisms that mediate and control intracellular transport, the molecular basis for variety of human diseases has been revealed. In turn, disease pathology and physiology shed light on the intricate controls that regulate intracellular transport to assure proper cellular and tissue function and homeostasis. We previously listed a number of diseases that are the result of defects in intracellular transport, or cause defects in intracellular transport. (Aridor M, Hannan LA. Traffic Jam: A compendium of human diseases that affect intracellular transport processes. Traffic 2000; 1: 836-851). This Toolbox updates the previous list to include additional disorders that were recently identified to be related to intracellular trafficking. In the time since we have published our first list there have been significant advances in understanding of the molecular basis of these defects. Such advances will pave the way to future effective therapeutics.

  12. Two-time quantum transport and quantum diffusion.

    Science.gov (United States)

    Kleinert, P

    2009-05-01

    Based on the nonequilibrium Green's function technique, a unified theory is developed that covers quantum transport and quantum diffusion in bulk semiconductors on the same footing. This approach, which is applicable to transport via extended and localized states, extends previous semiphenomenological studies and puts them on a firm microscopic basis. The approach is sufficiently general and applies not only to well-studied quantum-transport problems, but also to models, in which the Hamiltonian does not commute with the dipole operator. It is shown that even for the unified treatment of quantum transport and quantum diffusion in homogeneous systems, all quasimomenta of the carrier distribution function are present and fulfill their specific function. Particular emphasis is put on the double-time nature of quantum kinetics. To demonstrate the existence of robust macroscopic transport effects that have a true double-time character, a phononless steady-state current is identified that appears only beyond the generalized Kadanoff-Baym ansatz.

  13. Use of ethanol in public urban transport: BEST (BioEthanol for Sustainable Transport) Project; Uso de etanol no transporte publico urbano: projeto BEST (Bio Ethanol para o Transporte Sustentavel)

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Jose Roberto; Apolinario, Sandra; Pecora, Vanessa [Universidade de Sao Paulo (CENBIO/USP), SP (Brazil). Inst. de Eletrotecnica e Energia. Centro Nacional de Referencia em Biomassa; Velazquez, Silvia [Universidade Presbiteriana Mackenzie, Sao Paulo, SP (Brazil)

    2008-07-01

    This paper present the BEST project - Bio Ethanol for Sustainable Transport, that aims to promote the ethanol usage, replacing diesel, in the urban public transport in Brazil and worldwide. Apart from Sao Paulo, leading city in the Americas, another eight cities located in Europe and Asia takes part in the project. One of the Brazilian project's goals is to evaluate ethanol usage as diesel fuel replacement in public transport buses by comparatively following the operational output of the experimental fleet, taking as reference an equivalent diesel bus. The utilized test vehicles will be evaluated and monitored to demonstrate ethanol energetic efficiency and, after the results the BEST project and the European Union will set a blue print for public policies to incentive ethanol usage in the urban public transport. The results will allow identifying technical and economical barriers that will eventually overlap the viability process of this technology in the Brazilian public transport. (author)

  14. Transport de marchandises et économie

    Directory of Open Access Journals (Sweden)

    Frank Bruns

    2009-03-01

    Full Text Available Le transport intra-alpin et transalpin est en constante augmentation. Dans les corridors de transit alpins, les répercussions négatives de cette circulation sur l’homme et l’environnement se ressentent particulièrement. Pour les régions alpines affectées, des solutions en terme de développement durable devront être trouvées au plus vite. Toutes suggestions pour résoudre ce problème, devront être discutées à la lumière de nombreux facteurs. Ainsi, les relations entre « le transport des marchandises et l’économie/la société » doivent être prises en compte. Le problème central est que l’impact du transport sur l’économie et la société, diffère selon les ressources économiques et la réactivité des acteurs des régions concernées. Le projet MONITRAF examine les impacts réciproques et identifie les indicateurs (Bruns, Delb, 2005.Transport through and within the Alps is continuously increasing. In the Alpine transit corridors the negative effects of transport on humans and the environment are felt particularly. From the focus point of the affected Alpine regions, a sustainable development solution for this problem is required as soon as possible. Any suggestions in order to solve this problem should be discussed in view of all the facts: Thus, the relationship between “freight transport and the Economy/Society” also need to be taken into account. In this context, the central issue is that the impact of transport on the economy and society will differ depending on the economic potential and the reaction of players in the relevant region. Within the project MONITRAF the respective relationships has been investigated and indicators identified (BRUNS F., DELB V., 2005.

  15. A comparison of the association of helicopter and ground ambulance transport with the outcome of injury in trauma patients transported from the scene.

    Science.gov (United States)

    Cunningham, P; Rutledge, R; Baker, C C; Clancy, T V

    1997-12-01

    Comprehensive emergency medical services and helicopter aeromedical transport systems have been developed based on the principle that early definitive care improves outcome. The purpose of this study was to compare outcomes between patients transported by helicopter and those transported by ground. Data were obtained from the North Carolina Trauma Registry for the period between 1987 and 1993 on all patients transported by helicopter and ground admitted to one of the eight state designated trauma centers. Study patients included only those who were transported directly from the scene of injury to the trauma center (interhospital transfers were excluded). Mortality (outcome) was compared after patient stratification by injury severity and transport time, using Cochran-Mantel-Haenszel statistics and logistic regression-derived probabilities of survival. One thousand three hundred forty-six patients (7.3% of the total) were transported from scene to trauma center by helicopter and 17,144 were transported by ground. In patients transported by helicopter, the mean Trauma Score was lower (12 +/- 3.6) versus 14.3 +/- 3.6 (p ground ambulance have low injury severity measures. Outcomes were not uniformly better among patients transported by helicopter. Only a very small subset of patients transported by helicopter appear to have any chance of improved survival based on their helicopter transport. This study suggests that further effort should be expended to try to better identify patients who may benefit from this expensive and risky mode of transport.

  16. Evolution of chloroplast vesicle transport.

    Science.gov (United States)

    Westphal, Sabine; Soll, Jürgen; Vothknecht, Ute C

    2003-02-01

    Vesicle traffic plays a central role in eukaryotic transport. The presence of a vesicle transport system inside chloroplasts of spermatophytes raises the question of its phylogenetic origin. To elucidate the evolution of this transport system we analyzed organisms belonging to different lineages that arose from the first photosynthetic eukaryote, i.e. glaucocystophytes, chlorophytes, rhodophytes, and charophytes/embryophytes. Intriguingly, vesicle transport is not apparent in any group other than embryophytes. The transfer of this eukaryotic-type vesicle transport system from the cytosol into the chloroplast thus seems a late evolutionary development that was acquired by land plants in order to adapt to new environmental challenges.

  17. Fundamentals of Biomedical Transport Processes

    CERN Document Server

    Miller, Gerald

    2010-01-01

    Transport processes represent important life-sustaining elements in all humans. These include mass transfer processes, including gas exchange in the lungs, transport across capillaries and alveoli, transport across the kidneys, and transport across cell membranes. These mass transfer processes affect how oxygen and carbon dioxide are exchanged in your bloodstream, how metabolic waste products are removed from your blood, how nutrients are transported to tissues, and how all cells function throughout the body. A discussion of kidney dialysis and gas exchange mechanisms is included. Another elem

  18. Rice Transcriptome Analysis to Identify Possible Herbicide Quinclorac Detoxification Genes

    Directory of Open Access Journals (Sweden)

    Wenying eXu

    2015-09-01

    Full Text Available Quinclorac is a highly selective auxin-type herbicide, and is widely used in the effective control of barnyard grass in paddy rice fields, improving the world’s rice yield. The herbicide mode of action of quinclorac has been proposed and hormone interactions affect quinclorac signaling. Because of widespread use, quinclorac may be transported outside rice fields with the drainage waters, leading to soil and water pollution and environmental health problems.In this study, we used 57K Affymetrix rice whole-genome array to identify quinclorac signaling response genes to study the molecular mechanisms of action and detoxification of quinclorac in rice plants. Overall, 637 probe sets were identified with differential expression levels under either 6 or 24 h of quinclorac treatment. Auxin-related genes such as GH3 and OsIAAs responded to quinclorac treatment. Gene Ontology analysis showed that genes of detoxification-related family genes were significantly enriched, including cytochrome P450, GST, UGT, and ABC and drug transporter genes. Moreover, real-time RT-PCR analysis showed that top candidate P450 families such as CYP81, CYP709C and CYP72A genes were universally induced by different herbicides. Some Arabidopsis genes for the same P450 family were up-regulated under quinclorac treatment.We conduct rice whole-genome GeneChip analysis and the first global identification of quinclorac response genes. This work may provide potential markers for detoxification of quinclorac and biomonitors of environmental chemical pollution.

  19. User manual for freight transportation analysis software

    Energy Technology Data Exchange (ETDEWEB)

    Terziev, M.N.; Wilson, L.B.

    1976-12-01

    Under sponsorship of the Federal Energy Administration, The Center for Transportation Studies at M.I.T. developed and tested a methodology for analysis of the impacts of various government and carrier policies on the demand for freight transportation. The purpose of this document is to familiarize the reader with the computer programs included in this methodology. The purpose of the computer software developed for this project is threefold. First, programs are used to calculate the cost of each of the transport alternatives available for the purchase of a given commodity by a receiver in a given industrial sector. Furthermore, these programs identify the least-cost alternative, and thus provide a forecasting capability at the disaggregate level. Given a description of the population of receivers in the destination city, a second group of programs applies the costing and forecasting programs to each receiver in a sample drawn from the population. The disaggregate forecasts are summed to produce an aggregate forecast of modal tonnages for the given origin/destination city-pair. Finally, a third group of programs computes fuel consumed in transportation from the aggregate modal tonnages. These three groups of programs were placed under the control of a master routine which coordinates the input and output of data.

  20. Transport and biological activities of bile acids.

    Science.gov (United States)

    Zwicker, Brittnee L; Agellon, Luis B

    2013-07-01

    Bile acids have emerged as important biological molecules that support the solubilization of various lipids and lipid-soluble compounds in the gut, and the regulation of gene expression and cellular function. Bile acids are synthesized from cholesterol in the liver and eventually released into the small intestine. The majority of bile acids are recovered in the distal end of the small intestine and then returned to the liver for reuse. The components of the mechanism responsible for the recycling of bile acids within the enterohepatic circulation have been identified whereas the mechanism for intracellular transport is less understood. Recently, the ileal lipid binding protein (ILBP; human gene symbol FABP6) was shown to be needed for the efficient transport of bile acids from the apical side to the basolateral side of enterocytes in the distal intestine. This review presents an overview of the transport of bile acids between the liver and the gut as well as within hepatocytes and enterocytes. A variety of pathologies is associated with the malfunction of the bile acid transport system.