WorldWideScience

Sample records for fnal e690 experiment

  1. Data acquisition for FNAL E665

    International Nuclear Information System (INIS)

    Geesaman, D.F.; Green, M.C.; Kaufman, S.

    1989-01-01

    The data acquisition system for FNAL E665, an experiment to study deep inelastic muon scattering from nucleons and nuclei, is described. The system is built with the FNAL VAXONLINE and RSX DA building blocks. The structure, capabilities and limitations for data flow, control and monitoring are discussed. 20 refs., 1 fig

  2. High luminosity muon scattering at FNAL

    International Nuclear Information System (INIS)

    Bazizi, K.; Conrad, J.; Fang, G.; Erdmann, M.; Geesaman, D.; Jackson, H.; Guyot, C.; Virchaux, M.; Holmgren, H.; Malensek, A.; Melanson, H.; Morfin, J.; Schellman, H.; Nickerson, R.

    1990-02-01

    The charge of this group was to evaluate the physics that can be done with a high luminosity μ scattering experiment at FNAL using the upgraded Tevatron muon beam, and consider the apparatus required. In this report, the physics that can be accomplished with a high luminosity μ scattering experiment is evaluated. The CERN and FNAL μ beams are compared in the context of such an experiment. The expected muon flux with the upgraded machine is estimated. Two possible detectors are compared: the air-core toroid experiment proposed by Guyot et al., and an upgraded version of the E665 double-diode apparatus now in place at FNAL. The relative costs of the detectors are considered. A list of detailed questions that need to be answered regarding the double-diode experiment has be compiled. 2 refs., 10 figs., 2 tabs

  3. The NESSiE way to searches for sterile neutrinos at FNAL

    Science.gov (United States)

    Stanco, L.; NESSiE Collaboration

    2016-04-01

    Neutrino physics is nowadays receiving more and more attention as a possible source of information for the long-standing problem of new physics beyond the Standard Model. The recent measurement of the mixing angle θ13 in the standard mixing oscillation scenario encourages us to pursue the still missing results on leptonic CP violation and absolute neutrino masses. However, puzzling measurements exist that deserve an exhaustive evaluation. The NESSiE Collaboration has been setup to undertake conclusive experiments to clarify the muon-neutrino disappearance measurements at small L/E, which will be able to put severe constraints to models with more than the three-standard neutrinos, or even to robustly measure the presence of a new kind of neutrino oscillation for the first time. To this aim the use of the current FNAL-Booster neutrino beam for a Short-Baseline experiment has been carefully evaluated. Its recent proposal refers to the use of magnetic spectrometers at two different sites, Near and Far ones. Their positions have been extensively studied, together with the possible performances of two OPERA-like spectrometers. The proposal is constrained by availability of existing hardware and a time-schedule compatible with the undergoing project of a multi-site Liquid-Argon detectors at FNAL. The experiment to be possibly setup at Booster will allow to definitively clarify the current νμ disappearance tension with νe appearance and disappearance at the eV mass scale.

  4. ANL stochastic-cooling experiments using the FNAL 200-MeV cooling ring

    International Nuclear Information System (INIS)

    Hogrefe, R.L.; Kellogg, K.D.; Konecny, R.S.; Kramer, S.L.; Simpson, J.D.; Suddeth, D.E.; Hardek, T.W.

    1981-01-01

    Studies of stochastic momentum cooling are being conducted on the FNAL 200-MeV Storage Ring. The specific goal of the activity is to establish confidence in the theory and simulation methods used to describe the cooling process, and to develop techniques and devices suitable for use in the antiproton-accumulation scheme now planned for construction at FNAL. A summary of the activity, including hardware design, results of experiments, comparison with theory, and implications for the antiproton accumulator are presented

  5. The NESSiE way to searches for sterile neutrinos at FNAL

    CERN Document Server

    Stanco, L.; Benettoni, M.; Bernardini, P.; Brugnera, R.; Calabrese, M.; Cecchetti, A.; Cecchini, S.; Chernyavskiy, M.; Creti, P.; Dal Corso, F.; Dalkarov, O.; Del Prete, A.; De Robertis, G.; De Serio, M.; Esposti, L.Degli; Di Ferdinando, D.; Dusini, S.; Dzhatdoev, T.; Fanin, C.; Fini, R.A.; Fiore, G.; Garfagnini, A.; Golovanov, S.; Guerzoni, M.; Klicek, B.; Jakovcic, K.; Laurenti, G.; Lippi, I.; Loddo, F.; Longhin, A.; Malenica, M.; Mancarella, G.; Mandrioli, G.; Margiotta, A.; Marsella, G.; Mauri, N.; Medinaceli, E.; Mengucci, A.; Mingazheva, R.; Morgunova, O.; Muciaccia, M.T.; Orecchini, D.; Paoloni, A.; Papadia, G.; Paparella, L.; Pasqualini, L.; Pastore, A.; Patrizii, L.; Polukhina, N.; Pozzato, M.; Roda, M.; Roganova, T.; Rosa, G.; Sahnoun, Z.; Simone, S.; Sirignano, C.; Sirri, G.; Spurio, M.; Stanko, L.; Starkov, N.; Stipcevic, M.; Surdo, A.; Tenti, M.; Togo, V.; Ventura, M.; Vladymyrov, M.; Kose, U.; Nessi, M.

    2016-01-01

    Neutrino physics is nowadays receiving more and more attention as a possible source of information for the long-standing problem of new physics beyond the Standard Model. The recent measurement of the mixing angle $\\theta_{13}$ in the standard mixing oscillation scenario encourages us to pursue the still missing results on leptonic CP violation and absolute neutrino masses. However, puzzling measurements exist that deserve an exhaustive evaluation. The NESSiE Collaboration has been setup to undertake conclusive experiments to clarify the muon-neutrino disappearance measurements at small $L/E$, which will be able to put severe constraints to models with more than the three-standard neutrinos, or even to robustly measure the presence of a new kind of neutrino oscillation for the first time. To this aim the use of the current FNAL-Booster neutrino beam for a Short-Baseline experiment has been carefully evaluated. Its recent proposal refers to the use of magnetic spectrometers at two different sites, Near and Far...

  6. ICARUS at FNAL

    CERN Document Server

    Antonello, M; Bellini, V.; Bilokon, H.; Boffelli, F.; Bonesini, M.; Calligarich, E.; Centro, S.; Cieslik, K.; Cline, D.B.; Cocco, A.G.; Curioni, A.; Dermenev, A.; Dolfini, R.; Falcone, A.; Farnese, C.; Fava, A.; Ferrari, A.; Gibin, D.; Gninenko, S.; Guber, F.; Guglielmi, A.; Haranczyk, M.; Holeczek, J.; Ivashkin, A.; Kirsanov, M.; Kisiel, J.; Kochanek, I.; Kurepin, A.; Lagoda, J.; Mammoliti, F.; Mania, S.; Mannocchi, G.; Matveev, V.; Menegolli, A.; Meng, G.; Mills, G.B.; Montanari, C.; Noto, F.; Otwinowski, S.; Palczewski, T.J.; Picchi, P.; Pietropaolo, F.; Plonski, P.; Potenza, R.; Rappoldi, A.; Raselli, G.L.; Rossella, M.; Rubbia, C.; Sala, P.; Scaramelli, A.; Segreto, E.; Stefan, D.; Stepaniak, J.; Sulej, R.; Sutera, C.M.; Tlisov, D.; Torti, M.; Van de Water, R.G.; Varanini, F.; Ventura, S.; Vignoli, C.; Wang, H.G.; Yang, X.; Zani, A.; Zaremba, K.

    2013-01-01

    The INFN and the ICARUS collaboration originally developed the technology of the LAr-TPC. Located the underground LNGS Hall-B, the ICARUS T600 detector has been performed over three years with remarkable detection efficiency featuring a smooth operation, high live time, and high reliability. About 3000 CNGS neutrino events have been collected and are being actively analyzed. ICARUS will now be moved to CERN for an extensive R&D program. The T600 detector will be overhauled and complemented with a similar T150 detector. These improvements are performed in collaboration with the LBNE experiment, of which several INFN Institutions are now members. As a novelty, a SC magnetic field of about 1 T will be introduced. During 2016 it is proposed to move the experiment to FNAL where short base line neutrino beams are available, complementing the approved MicroBooNe experiment which will start operation in 2014. The ICARUS detectors at FNAL will be an important addition since, in absence of anomalies, the signals of...

  7. Sterile searches with Liquid Argon at FNAL

    CERN Document Server

    Raselli, Gian Luca

    2017-01-01

    A new Short Baseline Neutrino (SBN) experiment is in preparation at FNAL to definitely prove or exclude the existence of non-standard neutrino oscillations into sterile states. The program foresees the deployment along the Booster Neutrino Beam (BNB) of three detectors, all based on the liquid-argon time projection chamber technique. This technology has been taken to full maturity with ICARUS T600, which will act as far detector after the completion of the overhauling at CERN and its transportation to FNAL. The program foresees the data taking for three years.

  8. Search for Sterile Neutrinos in the Muon Neutrino Disappearance Mode at FNAL

    CERN Document Server

    Anokhina, A.; Benettoni, M.; Bernardini, P.; Brugnera, R.; Calabrese, M.; Cecchetti, A.; Cecchini, S.; Chernyavskiy, M.; Dal Corso, F.; Dalkarov, O.; Prete, A.; De Robertis, G.; De Serio, M.; Di Ferdinando, D.; Dusini, S.; Dzhatdoev, T.; Fini, R.A.; Fiore, G.; Garfagnini, A.; Guerzoni, M.; Klicek, B.; Kose, U.; Jakovcic, K.; Laurenti, G.; Lippi, I.; Loddo, F.; Longhin, A.; Malenica, M.; Mancarella, G.; Mandrioli, G.; Margiotta, A.; Marsella, G.; Mauri, N.; Medinaceli, E.; Mingazheva, R.; Morgunova, O.; Muciaccia, M.T.; Nessi, M.; Orecchini, D.; Paoloni, A.; Papadia, G.; Paparella, L.; Pasqualini, L.; Pastore, A.; Patrizii, L.; Polukhina, N.; Pozzato, M.; Roda, M.; Roganova, T.; Rosa, G.; Sahnoun, Z.; Shchedrina, T.; Simone, S.; Sirignano, C.; Sirri, G.; Spurio, M.; Stanco, L.; Starkov, N.; Stipcevic, M.; Surdo, A.; Tenti, M.; Togo, V.; Vladymyrov, M.

    2017-01-01

    The NESSiE Collaboration has been setup to undertake a conclusive experiment to clarify the {\\em muon--neutrino disappearance} measurements at short baselines in order to put severe constraints to models with more than the three--standard neutrinos, or even to robustly establish the presence of a new kind of neutrino oscillation for the first time. To this aim the use of the current FNAL--Booster neutrino beam for a Short--Baseline experiment was carefully evaluated by considering the use of magnetic spectrometers at two sites, near and far ones. The detector locations were extensively studied, together with the achievable performances of two OPERA--like spectrometers. The study was constrained by the availability of existing hardware and a time--schedule compatible with the undergoing project of multi--site Liquid--Argon detectors at FNAL. \

  9. Search for sterile neutrinos in muon neutrino disappearance mode at FNAL

    International Nuclear Information System (INIS)

    Anokhina, A.; Dzhatdoev, T.; Morgunova, O.; Roganova, T.; Bagulya, A.; Chernyavskiy, M.; Dalkarov, O.; Mingazheva, R.; Shchedrina, T.; Starkov, N.; Vladymyrov, M.; Benettoni, M.; Dal Corso, F.; Dusini, S.; Lippi, I.; Longhin, A.; Bernardini, P.; Mancarella, G.; Marsella, G.; Brugnera, R.; Garfagnini, A.; Medinaceli, E.; Roda, M.; Sirignano, C.; Calabrese, M.; Fiore, G.; Surdo, A.; Cecchetti, A.; Orecchini, D.; Paoloni, A.; Cecchini, S.; Di Ferdinando, D.; Guerzoni, M.; Laurenti, G.; Mandrioli, G.; Mauri, N.; Patrizii, L.; Pozzato, M.; Sahnoun, Z.; Sirri, G.; Togo, V.; Del Prete, A.; Papadia, G.; De Robertis, G.; Fini, R.A.; Loddo, F.; Pastore, A.; De Serio, M.; Paparella, L.; Simone, S.; Klicek, B.; Jakovcic, K.; Malenica, M.; Stipcevic, M.; Kose, U.; Nessi, M.; Margiotta, A.; Pasqualini, L.; Spurio, M.; Muciaccia, M.T.; Polukhina, N.; Rosa, G.; Stanco, L.; Tenti, M.

    2017-01-01

    The NESSiE Collaboration has been setup to undertake a conclusive experiment to clarify the muon-neutrino disappearance measurements at short baselines in order to put severe constraints to models with more than the three-standard neutrinos. To this aim the current FNAL-Booster neutrino beam for a Short-Baseline experiment was carefully evaluated by considering the use of magnetic spectrometers at two sites, near and far ones. The detector locations were studied, together with the achievable performances of two OPERA-like spectrometers. The study was constrained by the availability of existing hardware and a time-schedule compatible with the undergoing project of multi-site Liquid-Argon detectors at FNAL. The settled physics case and the kind of proposed experiment on the Booster neutrino beam would definitively clarify the existing tension between the ν μ disappearance and the ν e appearance/disappearance at the eV mass scale. In the context of neutrino oscillations the measurement of ν μ disappearance is a robust and fast approach to either reject or discover new neutrino states at the eV mass scale. We discuss an experimental program able to extend by more than one order of magnitude (for neutrino disappearance) and by almost one order of magnitude (for antineutrino disappearance) the present range of sensitivity for the mixing angle between standard and sterile neutrinos. These extensions are larger than those achieved in any other proposal presented so far. (orig.)

  10. Search for sterile neutrinos in muon neutrino disappearance mode at FNAL

    Science.gov (United States)

    Anokhina, A.; Bagulya, A.; Benettoni, M.; Bernardini, P.; Brugnera, R.; Calabrese, M.; Cecchetti, A.; Cecchini, S.; Chernyavskiy, M.; Dal Corso, F.; Dalkarov, O.; Del Prete, A.; De Robertis, G.; De Serio, M.; Di Ferdinando, D.; Dusini, S.; Dzhatdoev, T.; Fini, R. A.; Fiore, G.; Garfagnini, A.; Guerzoni, M.; Klicek, B.; Kose, U.; Jakovcic, K.; Laurenti, G.; Lippi, I.; Loddo, F.; Longhin, A.; Malenica, M.; Mancarella, G.; Mandrioli, G.; Margiotta, A.; Marsella, G.; Mauri, N.; Medinaceli, E.; Mingazheva, R.; Morgunova, O.; Muciaccia, M. T.; Nessi, M.; Orecchini, D.; Paoloni, A.; Papadia, G.; Paparella, L.; Pasqualini, L.; Pastore, A.; Patrizii, L.; Polukhina, N.; Pozzato, M.; Roda, M.; Roganova, T.; Rosa, G.; Sahnoun, Z.; Shchedrina, T.; Simone, S.; Sirignano, C.; Sirri, G.; Spurio, M.; Stanco, L.; Starkov, N.; Stipcevic, M.; Surdo, A.; Tenti, M.; Togo, V.; Vladymyrov, M.

    2017-01-01

    The NESSiE Collaboration has been setup to undertake a conclusive experiment to clarify the muon-neutrino disappearance measurements at short baselines in order to put severe constraints to models with more than the three-standard neutrinos. To this aim the current FNAL-Booster neutrino beam for a Short-Baseline experiment was carefully evaluated by considering the use of magnetic spectrometers at two sites, near and far ones. The detector locations were studied, together with the achievable performances of two OPERA-like spectrometers. The study was constrained by the availability of existing hardware and a time-schedule compatible with the undergoing project of multi-site Liquid-Argon detectors at FNAL. The settled physics case and the kind of proposed experiment on the Booster neutrino beam would definitively clarify the existing tension between the ν _{μ } disappearance and the ν e appearance/disappearance at the eV mass scale. In the context of neutrino oscillations the measurement of ν _{μ } disappearance is a robust and fast approach to either reject or discover new neutrino states at the eV mass scale. We discuss an experimental program able to extend by more than one order of magnitude (for neutrino disappearance) and by almost one order of magnitude (for antineutrino disappearance) the present range of sensitivity for the mixing angle between standard and sterile neutrinos. These extensions are larger than those achieved in any other proposal presented so far.

  11. Search for sterile neutrinos in muon neutrino disappearance mode at FNAL

    Energy Technology Data Exchange (ETDEWEB)

    Anokhina, A.; Dzhatdoev, T.; Morgunova, O.; Roganova, T. [Lomonosov Moscow State University (MSU SINP), Moscow (Russian Federation); Bagulya, A.; Chernyavskiy, M.; Dalkarov, O.; Mingazheva, R.; Shchedrina, T.; Starkov, N.; Vladymyrov, M. [Lebedev Physical Institute of Russian Academy of Sciences, Moscow (Russian Federation); Benettoni, M.; Dal Corso, F.; Dusini, S.; Lippi, I.; Longhin, A. [INFN, Sezione di Padova, Padua (Italy); Bernardini, P.; Mancarella, G.; Marsella, G. [Universita del Salento, Dipartimento di Matematica e Fisica, Lecce (Italy); INFN, Sezione di Lecce, Lecce (Italy); Brugnera, R.; Garfagnini, A.; Medinaceli, E.; Roda, M.; Sirignano, C. [INFN, Sezione di Padova, Padua (Italy); Universita di Padova, Dipartimento di Fisica e Astronomia, Padua (Italy); Calabrese, M.; Fiore, G.; Surdo, A. [INFN, Sezione di Lecce, Lecce (Italy); Cecchetti, A.; Orecchini, D.; Paoloni, A. [INFN, Laboratori Nazionali di Frascati, Frascati, RM (Italy); Cecchini, S.; Di Ferdinando, D.; Guerzoni, M.; Laurenti, G.; Mandrioli, G.; Mauri, N.; Patrizii, L.; Pozzato, M.; Sahnoun, Z.; Sirri, G.; Togo, V. [INFN, Sezione di Bologna, Bologna (Italy); Del Prete, A.; Papadia, G. [INFN, Sezione di Lecce, Lecce (Italy); Universita del Salento, Dipartimento di Ingegneria dell' Innovazione, Lecce (Italy); De Robertis, G.; Fini, R.A.; Loddo, F.; Pastore, A. [INFN, Sezione di Bari, Bari (Italy); De Serio, M.; Paparella, L.; Simone, S. [INFN, Sezione di Bari, Bari (Italy); Universita di Bari, Dipartimento di Fisica, Bari (Italy); Klicek, B.; Jakovcic, K.; Malenica, M.; Stipcevic, M. [Rudjer Boskovic Institute, Zagreb (Croatia); Kose, U.; Nessi, M. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Margiotta, A.; Pasqualini, L.; Spurio, M. [INFN, Sezione di Bologna, Bologna (Italy); Universita di Bologna, Dipartimento di Fisica e Astronomia, Bologna (Italy); Muciaccia, M.T. [Universita di Bari, Dipartimento di Fisica, Bari (Italy); Polukhina, N. [Lebedev Physical Institute of Russian Academy of Sciences, Moscow (Russian Federation); National Research Nuclear University MEPhI, Moscow (Russian Federation); Rosa, G. [INFN, Sezione di Roma, Rome (Italy); Stanco, L. [INFN, Sezione di Padova, Padua (Italy); Tenti, M. [Universita di Bologna, Dipartimento di Fisica e Astronomia, Bologna (Italy); NFN-CNAF, Bologna (Italy)

    2017-01-15

    The NESSiE Collaboration has been setup to undertake a conclusive experiment to clarify the muon-neutrino disappearance measurements at short baselines in order to put severe constraints to models with more than the three-standard neutrinos. To this aim the current FNAL-Booster neutrino beam for a Short-Baseline experiment was carefully evaluated by considering the use of magnetic spectrometers at two sites, near and far ones. The detector locations were studied, together with the achievable performances of two OPERA-like spectrometers. The study was constrained by the availability of existing hardware and a time-schedule compatible with the undergoing project of multi-site Liquid-Argon detectors at FNAL. The settled physics case and the kind of proposed experiment on the Booster neutrino beam would definitively clarify the existing tension between the ν{sub μ} disappearance and the ν{sub e} appearance/disappearance at the eV mass scale. In the context of neutrino oscillations the measurement of ν{sub μ} disappearance is a robust and fast approach to either reject or discover new neutrino states at the eV mass scale. We discuss an experimental program able to extend by more than one order of magnitude (for neutrino disappearance) and by almost one order of magnitude (for antineutrino disappearance) the present range of sensitivity for the mixing angle between standard and sterile neutrinos. These extensions are larger than those achieved in any other proposal presented so far. (orig.)

  12. DØ Collaboration at FNAL, USA

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. DØ Collaboration at FNAL, USA. Articles written in Pramana – Journal of Physics. Volume 62 Issue 3 March 2004 pp 561-563 Experimental Particle Physics. Search for narrow-width t t ¯ resonances in p p ¯ collisons at ( s ) = 1.8 TeV · Supriya Jain DØ Collaboration at FNAL, ...

  13. Why a NESSiE-like experiment at SBL is needed?

    OpenAIRE

    Pasqualini, Laura

    2015-01-01

    The NESSiE experiment is designed to perform an accurate measurement of muon-neutrino disappearance at small L/E, in order to severely constrain models with more than three-standard neutrinos, or even determine for the first time the presence of a new kind of neutrino oscillation. NESSiE is a Short-Baseline experiment with magnetic spectrometers at two different sites on the FNAL-Booster neutrino beam. The experiment would allow to definitively solve the existing tension of the muon-neutrino ...

  14. Prospects for the measurement of muon-neutrino disappearance at the FNAL-Booster

    CERN Document Server

    Anokhina, A; Benettoni, M; Bernardini, P; Brugnera, R; Calabrese, M; Cecchetti, A; Cecchini, S; Chernyavskiy, M; Creti, P; Corso, F Dal; Dalkarov, O; Del Prete, A; De Robertis, G; De Serio, M; Esposti, L Degli; Di Ferdinando, D; Dusini, S; Dzhatdoev, T; Fanin, C; Fini, R A; Fiore, G; Garfagnini, A; Golovanov, S; Guerzoni, M; Klicek, B; Kose, U; Jakovcic, K; Laurent, G; Lippi, I; Loddo, F; Longhin, A; Malenica, M; Mancarella, G; Mandrioli, G; Margiotta, A; Marsella, G; Mauri, N; Medinaceli, E; Mengucci, A; Mingazheva, R; Morgunova, O; Muciaccia, M T; Nessi, M; Orecchini, D; Paoloni, A; Papadia, G; Paparella, L; Pasqualini, L; Pastore, A; Patrizii, L; Polukhina, N; Pozzato, M; Roda, M; Roganova, T; Rosa, G; Sahnoun, Z; Simone, S; Sirignano, C; Sirri, G; Spurio, M; Stanco, L; Starkov, N; Stipcevic, M; Surdo, A; Tenti, M; Togo, V; Ventura, M; Vladymyrov, M

    2014-01-01

    Neutrino physics is nowadays receiving more and more attention as a possible source of information for the long-standing problem of new physics beyond the Standard Model. The recent measurement of the mixing angle $\\theta_{13}$ in the standard mixing oscillation scenario encourages us to pursue the still missing results on leptonic CP violation and absolute neutrino masses. However, puzzling measurements exist that deserve an exhaustive evaluation. The NESSiE Collaboration has been setup to undertake conclusive experiments to clarify the muon-neutrino disappearance measurements at small $L/E$, which will be able to put severe constraints to models with more than the three-standard neutrinos, or even to robustly measure the presence of a new kind of neutrino oscillation for the first time. To this aim the use of the current FNAL-Booster neutrino beam for a Short-Baseline experiment has been carefully evaluated. This proposal refers to the use of magnetic spectrometers at two different sites, Near and Far. Thei...

  15. Study of requirements and performances of the electromagnetic calorimeter for the Mu2e experiment at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Soleti, S. [Sapienza Univ. of Rome (Italy)

    2015-06-15

    In this thesis we discuss the simulation and tests carried out for the optimization and design of the electromagnetic calorimeter for the Mu2e (Muon to electron conversion) experiment, which is a proposed experiment part of the Muon Campus hosted at Fermi National Accelerator Laboratory (FNAL) in Batavia, United States.

  16. FNAL central email systems

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Jack; Lilianstrom, Al; Pasetes, Ray; Hill, Kevin; /Fermilab

    2004-10-01

    The FNAL Email System is the primary point of entry for email destined for an employee or user at Fermilab. This centrally supported system is designed for reliability and availability. It uses multiple layers of protection to help ensure that: (1) SPAM messages are tagged properly; (2) All mail is inspected for viruses; and (3) Valid mail gets delivered. This system employs numerous redundant subsystems to accomplish these tasks.

  17. Charmonium formation in p anti p annihilation by experiment E760

    International Nuclear Information System (INIS)

    Armstrong, T.A.; Bettoni, D.; Bharadwaj, V.; Biino, C.; Borreani, G.; Broemmelsiek, D.; Buzzo, A.; Calabrese, R.; Ceccucci, A.; Cester, R.; Church, M.; Dalpiaz, P.; Dalpiaz, P.F.; Dibenedetto, R.; Dimitroyannis, D.; Fabbri, M.G.; Fast, J.; Gianoli, A.; Ginsburg, C.M.; Gollwitzer, K.; Hahn, A.; Hasan, M.; Hsueh, S.; Lewis, R.; Luppi, E.; Macri, M.; Majewska, A.M.; Mandelkern, M.; Marchetto, F.; Marinelli, M.; Marques, J.; Marsh, W.; Martini, M.; Masuzawa, M.; Menichetti, E.; Migliori, A.; Mussa, R.; Pallavicini, M.; Palestini, S.; Pastrone, N.; Patrignani, C.; Peoples, J. Jr.; Pesando, L.; Petrucci, F.; Pia, M.G.; Pordes, S.; Rapidis, P.; Ray, R.; Reid, J.; Rinaudo, G.; Roccuzzo, B.; Rosen, J.; Santroni, A.; Sarmiento, M.; Savrie, M.; Scalisi, A.; Schultz, J.; Seth, K.K.; Smith, A.; Smith, G.A.; Sozzi, M.; Trokenheim, S.; Weber, M.F.; Werkema, S.; Zhang, Y.; Zhao, J.; Zioulas, G.

    1993-01-01

    Experiment E760, at the FNAL anti p Accumulator, is dedicated to the study of charmonium formation in p anti p annihilation. New measurements of the total width and mass of narrow ( anti cc) states and of the partial width of the χ 2 state to γγ are presented. The first evidence for the h c ( 1 P 1 ) singlet state is discussed in detail. (orig.)

  18. Dicty_cDB: SLB690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available r Dp87... 45 9e-04 AC117267_7( AC117267 |pid:none) Dictyostelium discoideum chromosom... 40 0.037 AY574051_1( AY574051 |pid:none) Ict...SL (Link to library) SLB690 (Link to dictyBase) - - - Contig-U16325-1 SLB690Z (Link... to Original site) - - SLB690Z 481 - - - - Show SLB690 Library SL (Link to library) Clone ID SLB690 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict...t alignments: (bits) Value N ( AF066071 ) Dictyostelium discoideum SP85 (pspB) gene, comple... 831 0.0 1 ( AC117075 ) Dict

  19. Operation of the DC current transformer intensity monitors at FNAL during run II

    Energy Technology Data Exchange (ETDEWEB)

    Crisp, J.; Fellenz, B.; Heikkinen, D.; Ibrahim, M.A.; Meyer, T.; Vogel, G.; /Fermilab

    2012-01-01

    Circulating beam intensity measurements at FNAL are provided by five DC current transformers (DCCT), one per machine. With the exception of the DCCT in the Recycler, all DCCT systems were designed and built at FNAL. This paper presents an overview of both DCCT systems, including the sensor, the electronics, and the front-end instrumentation software, as well as their performance during Run II.

  20. Diffractively Produced Charm Final States in 800-GeV/c pp Collisions

    Science.gov (United States)

    Wang, M. H.; Berisso, M. C.; Christian, D. C.; Félix, J.; Gara, A.; Gottschalk, E.; Gutiérrez, G.; Hartouni, E. P.; Knapp, B. C.; Kreisler, M. N.; Lee, S.; Markianos, K.; Moreno, G.; Reyes, M. A.; Sosa, M.; Wehmann, A.; Wesson, D.

    2001-08-01

    We report the first observation of diffractively produced open charm in 800-GeV/c pp collisions of the type pp-->pD*X. We measure cross sections of σdiff(D*+) = (0.185+/-0.044+/-0.054) μb and σdiff(D*-) = (0.174+/-0.034+/-0.029) μb. Our measurements are based on 4.3×109 events recorded by FNAL E690 in the fixed-target run of 1991. We compare our results with previous fixed-target charm experiments.

  1. Overview of recent studies and design changes for the FNAL magnetron ion source

    Science.gov (United States)

    Bollinger, D. S.; Sosa, A.

    2017-08-01

    This paper presents several studies and design changes that will eventually be implemented to the Fermi National Accelerator Laboratory (FNAL) magnetron ion source. The topics include tungsten cathode insert, solenoid gas valves, current controlled arc pulser, cesium boiler redesign, gas mixtures of hydrogen and nitrogen, and duty factor reduction. The studies were performed on the FNAL test stand described in [1], with the aim to improve source lifetime, stability, and reducing the amount of tuning needed.

  2. Overview of Recent Studies and Design Changes for the FNAL Magnetron Ion Source

    Energy Technology Data Exchange (ETDEWEB)

    Bollinger, D. S. [Fermilab; Sosa, A. [Fermilab

    2016-09-06

    This paper will cover several studies and design changes that will eventually be implemented to the Fermi National Accelerator Laboratory (FNAL) magnetron ion source. The topics include tungsten cathode insert, solenoid gas valves, current controlled arc pulser, cesium boiler redesign, gas mixtures of hydrogen and nitrogen, and duty factor reduction. The studies were performed on the FNAL test stand described in [1], with the aim to improve source lifetime, stability, and reducing the amount of tuning needed.

  3. Electron-Cloud Build-up in the FNAL Main Injector

    International Nuclear Information System (INIS)

    Furman, M.A.

    2007-01-01

    We present a summary on ongoing simulation results for the electron-cloud buildup in the context of the proposed FNAL Main Injector (MI) intensity upgrade [1] in a fieldfree region at the location of the RFA electron detector [2]. By combining our simulated results for the electron flux at the vacuum chamber wall with the corresponding measurements obtained with the RFA we infer that the peak secondary electron yield (SEY) (delta) max is ∼> 1.4, and the average electron density is n e ∼> 10 10 m -3 at transition energy for the specific fill pattern and beam intensities defined below. The sensitivity of our results to several variables remains to be explored in order to reach more definitive results. Effects from the electron cloud on the beam are being investigated separately [3

  4. EFFECTS OF IRRADIATION ON THERMAL CONDUCTIVITY OF ALLOY 690 AT LOW NEUTRON FLUENCE

    Directory of Open Access Journals (Sweden)

    WOO SEOG RYU

    2013-04-01

    Full Text Available Alloy 690 has been selected as a steam generator tubing material for SMART owing to a near immunity to primary water stress corrosion cracking. The steam generators of SMART are faced with a neutron flux due to the integrated arrangement inside a reactor vessel, and thus it is important to know the irradiation effects of the thermal conductivity of Alloy 690. Alloy 690 was irradiated at HANARO to fluences of (0.7−28 × 1019n/cm2 (E>0.1MeV at 250°C, and its thermal conductivity was measured using the laser-flash equipment in the IMEF. The thermal conductivity of Alloy 690 was dependent on temperature, and it was a good fit to the Smith-Palmer equation, which modified the Wiedemann-Franz law. The irradiation at 250°C did not degrade the thermal conductivity of Alloy 690, and even showed a small increase (1% at fluences of (0.7∼28 × 1019n/cm2 (E>0.1MeV.

  5. 13 CFR 108.690 - Examinations.

    Science.gov (United States)

    2010-01-01

    ....690 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NEW MARKETS VENTURE CAPITAL (âNMVCâ) PROGRAM Recordkeeping, Reporting, and Examination Requirements for NMVC Companies Examinations of Nmvc Companies by Sba for Regulatory Compliance § 108.690 Examinations. All NMVC companies must submit to annual...

  6. On-line measurement with automatic emulsion analysis system and off-line data processing (E531 neutrino experiment)

    International Nuclear Information System (INIS)

    Miyanishi, Motoaki

    1984-01-01

    The automatic emulsion analysis system developed by Nagoya cosmic ray observation group was practically used for the experiment (FNAL-E531) on determining the lifetime of charm particles for the first time in the world, and achieved a great successful result. The system consists of four large precise coordinate-measuring stages capable of conducting simultaneous measurement and multiple (currently four) DOMS (digitized on-line microscope), supported with one mini-computer (ECLIPS S/130). The purpose of E531 experiment was the determination of charm particle lifetime. The experiment was carried out at FNAL, USA, and by the irradiation of wide band ν sub(μ) beam equivalent to 7 x 10 18 of 350 GeV/c protons. The detector was a hybrid system of emulsions and a counter spectrometer. The scan of neutrino reaction, the scan of charm particles, and charm event measurement were analyzed in emulsions, and the on-line programs for-respective analyses were created. Nagoya group has found 726 neutrino reactions in the first run, obtained 37 charm particle candidates, and found 1442 neutrino reactions in the second run, and obtained 56 charm particle candidates. The capability of the automatic emulsion analysis system in terms of the time equired for analysis is in total 3.5 hours per event; 15 minutes for C.S. scan, 15 minutes for coupling to module, 20 minutes for tracing to vertex, 1 hour for neutrino reaction measurement, 10 minutes for offline data processing and 1.5 hours for charm particle scanning. (Wakatsuki, Y.)

  7. 20 CFR 410.690 - Withdrawal of charges.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Withdrawal of charges. 410.690 Section 410.690 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969... Review, Finality of Decisions, and Representation of Parties § 410.690 Withdrawal of charges. If an...

  8. Model-independent search for new physics at D0 experiment

    Indian Academy of Sciences (India)

    2012-11-11

    Nov 11, 2012 ... at D0 experiment. MD NAIMUDDIN. Department of Physics, University of Delhi, Delhi 110 007, India. E-mail: nayeem@fnal.gov. Abstract. Finding the .... a similar analysis performed at the CMS experiment. The preliminary results of the CMS analysis was also shown at the Lepton–Photon 2011. Conference.

  9. Recent operation of the FNAL magnetron H- ion source

    Science.gov (United States)

    Karns, P. R.; Bollinger, D. S.; Sosa, A.

    2017-08-01

    This paper will detail changes in the operational paradigm of the Fermi National Accelerator Laboratory (FNAL) magnetron H- ion source due to upgrades in the accelerator system. Prior to November of 2012 the H- ions for High Energy Physics (HEP) experiments were extracted at ˜18 keV vertically downward into a 90 degree bending magnet and accelerated through a Cockcroft-Walton accelerating column to 750 keV. Following the upgrade in the fall of 2012 the H- ions are now directly extracted from a magnetron at 35 keV and accelerated to 750 keV by a Radio Frequency Quadrupole (RFQ). This change in extraction energy as well as the orientation of the ion source required not only a redesign of the ion source, but an updated understanding of its operation at these new values. Discussed in detail are the changes to the ion source timing, arc discharge current, hydrogen gas pressure, and cesium delivery system that were needed to maintain consistent operation at >99% uptime for HEP, with an increased ion source lifetime of over 9 months.

  10. Specific Heat Capacity of Alloy 690 for Simulating Neutron Irradiation

    International Nuclear Information System (INIS)

    Park, Dae Gyu; Kim, Hee Moon; Song, Woong Sub; Baik, Seung Je; Joo, Young Sun; Ahn, Sang Bok; Park, Jin Seok; Lee, Won Jae; Ryu, Woo Seok

    2011-01-01

    The KAERI(Korea Atomic Energy Research Institute) is developing new type of nuclear reactor, so called 'SMART'(System Integrated Modular Advanced Reactor) which has many features of small power and system integrated modular type. Alloy 690 was selected as the candidate material for the heat exchanger tube of the steam generator of SMART. The SMART R and D is now facing the stage of engineering verification and approval of standard design to apply to DEMO reactors. Therefore, the material performance under the relevant environment is required to be evaluated. The important material performance issues are mechanical properties i.e. (fracture toughness, tensile and hardness) and thermal properties i.e. (thermal diffusivity, specific heat capacity and thermal conductivity) for which the engineering database is necessary to design a steam generator. However, the neutron post irradiation characteristics of the alloy 690 are barely known. As a result, PIE(Post Irradiation Examination) of thermal properties are planed and performed successfully. But specific heat capacity measurement is not performed because of not having proper test system for irradiated materials. Therefore in order to verify the effect of neutron irradiation for alloy 690, simulation method is adopted. In general, high energy neutron bombardment in material bring about lattice defects i.e. void, pore and dislocation. Dominant factor to impact to heat capacity is mainly dislocation in material. Therefore, simulation of neutron irradiation is devised by material rolling method in order to make artificial dislocation in alloy 690 as same effect of neutron irradiation. After preparing test specimens, heat capacity measurements are performed and results are compared with rolled materials and un-rolled materials to verify the effect of neutron irradiation simulation. Main interest of simulation is that heat capacity value is changed by neutron irradiation

  11. Electrodes for stochastic cooling of the FNAL antiproton source

    International Nuclear Information System (INIS)

    Voelker, F.

    1982-11-01

    AN electrode array for stochastic cooling is being developed for use on the FNAL antiproton source. With minor power handling modifications, the same electrodes can function as pickups or as kickers. When used as pickups, a large array is needed to increase the signal-to-noise ratio. Each electrode is one element of a pair of directional coupler loops that are mounted flush with the upper and lower walls of the beam chamber. The loops, fabricated from flat metal plates, are supported by specially shaped legs

  12. Crack growth rate in the HAZ of alloy 690TT/152

    International Nuclear Information System (INIS)

    Gomez-Briceno, D.; Lapena, J.; Garcia-Redondo, M.; Castro, L.; Perosanz, F.J.; Ahluwalia, K.; Hickling, J.

    2011-01-01

    Crack growth rate (CGR) experiments to obtain data for the HAZ of nickel base alloys using fracture mechanics specimens are a challenge, primarily due to the difficulties of positioning the tip of the notch (or pre-crack) in the desired location within the complex region adjacent to the fusion line that is altered in several ways by the welding process. This paper describes an experimental program carried out to determine the CGR in the HAZ of an Alloy 690 test weld made using Alloy 152. Compact tension (CT) specimens have been tested in simulated PWR primary water at temperatures of 340 and 360 C under cyclic and constant loading (both with and without periodic partial unloading). For the Alloy 690 HAZ tested here, transgranular crack propagation (primarily due to environmentally assisted fatigue) with isolated intergranular secondary cracks was observed and there was no increase of the crack growth rate in comparison with that for Alloy 690 base metal. In both cases, the CGR values at constant load were very low (4*10 -9 mm/s down to effectively zero) and generally comparable with the data found in the literature for intergranular cracking of thermally treated or solution annealed Alloy 690 in simulated primary water. The scarce CGR data for the HAZ of Alloy 690 available to date do not suggest a significant increase in the PWSCC susceptibility of this resistant alloy, but further testing is still required given the expected variability in actual production welds. (authors)

  13. THE US LONG BASELINE NEUTRINO EXPERIMENT STUDY.

    Energy Technology Data Exchange (ETDEWEB)

    BISHAI,M.

    2007-08-06

    The US Long Baseline Neutrino Experiment Study was commissioned jointly by Brookhaven National Laboratory (BNL)and Fermi National Accelerator Laboratory (FNAL) to investigate the potential for future U.S. based long baseline neutrino oscillation experiments using MW class conventional neutrino beams that can be produced at FNAL. The experimental baselines are based on two possible detector locations: (1) off-axis to the existing FNAL NuMI beamline at baselines of 700 to 810 km and (2) NSF's proposed future Deep Underground Science and Engineering Laboratory (DUSEL) at baselines greater than 1000km. Two detector technologies are considered: a megaton class Water Cherenkov detector deployed deep underground at a DUSEL site, or a 100kT Liquid Argon Time-Projection Chamber (TPC) deployed on the surface at any of the proposed sites. The physics sensitivities of the proposed experiments are summarized. We find that conventional horn focused wide-band neutrino beam options from FNAL aimed at a massive detector with a baseline of > 1000km have the best sensitivity to CP violation and the neutrino mass hierarchy for values of the mixing angle {theta}{sub 13} down to 2{sup o}.

  14. 10 CFR 603.690 - Requirements for Federally-owned property.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Requirements for Federally-owned property. 603.690 Section 603.690 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems Property § 603.690...

  15. Experimental results on charmonium from E760 (FNAL)

    International Nuclear Information System (INIS)

    Armstrong, T.A.; Hasan, M.A.; Lewis, R.A.; Majewska, A.M.; Reid, J.D.; Smith, G.A.; Zhang, Y.; Bettoni, D.; Borreani, G.; Calabrese, R.; Dalpiaz, P.; Dalpiaz, P.F.; Fabbri, M.; Luppi, E.; Martini, M.; Petrucci, F.; Savrie, M.; Bharadwaj, V.; Church, M.D.; Hahn, A.A.; Hsueh, S.Y.; Marsh, W.; Peoples, J. Jr.; Pordes, S.; Rapidis, P.A.; Werkema, S.J.; Biino, C.; Ceccucci, A.; Cester, R.; Marchetto, F.; Menichetti, E.; Migliori, A.; Mussa, R.; Palestini, S.; Pastrone, N.; Pesando, L.; Rinaudo, G.; Tecchio, L.; Broemmelsiek, D.R.; Fast, J.E.; Gee, M.; Gollwitzer, K.E.; Mandelkern, M.A.; Marques, J.L.; Schultz, J.; Weber, M.F.; Zioulas, G.; Buzzo, A.; Dameri, M.; Ferroni, S.; Macri, M.; Marinelli, M.; Patrignani, C.; Pia, M.G.; Santroni, A.; Tommasini, S.; Zito, M.; Dimitroyannis, D.; Ginsburg, C.M.; Masuzawa, M.; Rosen, J.L.; Sarmiento, M.; Seth, K.K.; Trokenheim, S.; Zhao, J.L.; Ray, R.E.

    1992-01-01

    E760 is a fixed target experiment dedicated to the study of charmonium spectroscopy in anti pp annihilations. Results on X 1 and X 2 resonance parameters from 1990 data taking are presented, consisting of precise measurement of mass, total width and partial width to anti pp. A preliminary result is presented on the first determination of Ψ'width from line shape analysis. (orig.)

  16. High cycle fatigue properties of inconel 690

    International Nuclear Information System (INIS)

    Lee, Young Ho; Lee, Byong Whi; Kim, In Sup; Park, Chi Yong

    1997-01-01

    Inconel 690 is presently used as sleeve material and a replacement alloy in degraded steam generators, as well as the material for new steam generators. But Inconel 690 has low thermal conductivity which are 3-8% less than that of Inconel 600 at operating temperature. For the same power output, conduction area must be increased. As a result, more fluid induced vibration can cause a fatigue damage of Inconel 690. High cycle fatigue ruptures occurred in the U-bend regions of North Anna Unit 1 and Mihama Unit 2 steam generators. At this study, the effect of temperature on fatigue crack growth rate in Inconel 690 steam generator tube was investigated at various temperature in air environment. With increasing temperature, fatigue crack growth rate increased and grain size effect decreased. Chromium carbides which have large size and semi-continuous distribution in the grain boundaries decreased fatigue crack growth rate

  17. The Corrosion Rate Measurement of Inconel 690 on High Temperature andPressure by Using CMS100

    International Nuclear Information System (INIS)

    Sriyono; Febrianto

    2000-01-01

    The corrosion rate measurement of Inconel 690 on high temperature andpressure had been done. By using an Autoclave, pressure and temperature canbe simulated. The environment of this experiment is 0.1 ppm of chloridesolution, which permit to dissolved in secondary cooling of steam generator.The corrosion rate measurement was done on temperature between 150 o C and230 o C with step 10 o C. Pressure experiment is the pressure, which occurredin Autoclave. Corrosion rate is measured by CMS100. From the Tafel analysis,corrosion rate of Inconel 690 linearity increased from 6.548 x 10 -5 mpy to4.331 x 10 -4 mpy. It concludes that Inconel 690 is resist on corrosionenvironment, so it's most using on the fabrication of steam generator tubeson the advanced power plant. (author)

  18. Cross Section Measurements In The Main Injector Particle Production (FNAL-E907) Experiment At 58 GEV Energy

    International Nuclear Information System (INIS)

    Gunaydin, Yusuf Oguzhan

    2009-01-01

    Cross-sections are presented for 58 GeV π, K, and p on a wide range of nuclear targets. These cross-sections are essential for determining the neutrino flux in measurements of neutrino cross-sections and oscillations. The E907 Main Injector Particle Production (MIPP) experiment at Fermilab is a fixed target experiment for measuring hadronic particle production using primary 120 GeV/c protons and secondary π, K, and p beams. The particle identification is made by dE/dx in a time projection chamber, and by time-of-flight, differential Cherenkov and ring imaging Cherenkov detectors, which together cover a wide range of momentum from 0.1 GeV/c up to 120 GeV/c. MIPP targets span the periodic table, from hydrogen to uranium, including beryllium and carbon. The MIPP has collected ∼ 0.26 x 10 6 events of 58 GeV/c secondary particles produced by protons from the main injector striking a carbon target.

  19. National Science Foundation Assistant Director for Mathematics and Physical Sciences Tony Chan (USA) visiting CMS experiment on 23rd May 2007 with Spokesperson T. Virdee, Deputy Spokesperson R. Cousins, Advisor to CERN Director-General J. Ellis, US CMS Research Program Deputy Manager D. Marlow and FNAL D. Green

    CERN Multimedia

    Maximilien Brice

    2007-01-01

    National Science Foundation Assistant Director for Mathematics and Physical Sciences Tony Chan (USA) visiting CMS experiment on 23rd May 2007 with Spokesperson T. Virdee, Deputy Spokesperson R. Cousins, Advisor to CERN Director-General J. Ellis, US CMS Research Program Deputy Manager D. Marlow and FNAL D. Green

  20. Galvanic Corrosion between Alloy 690 and Magnetite in Alkaline Aqueous Solutions

    Directory of Open Access Journals (Sweden)

    Soon-Hyeok Jeon

    2015-12-01

    Full Text Available The galvanic corrosion behavior of Alloy 690 coupled with magnetite has been investigated in an alkaline solution at 30 °C and 60 °C using a potentiodynamic polarization method and a zero resistance ammeter. The positive current values were recorded in the galvanic couple and the corrosion potential of Alloy 690 was relatively lower. These results indicate that Alloy 690 behaves as the anode of the pair. The galvanic coupling between Alloy 690 and magnetite increased the corrosion rate of Alloy 690. The temperature increase led to an increase in the extent of galvanic effect and a decrease in the stability of passive film. Galvanic effect between Alloy 690 and magnetite is proposed as an additional factor accelerating the corrosion rate of Alloy 690 steam generator tubing in secondary water.

  1. 34 CFR 690.10 - Administrative cost allowance to participating schools.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Administrative cost allowance to participating schools. 690.10 Section 690.10 Education Regulations of the Offices of the Department of Education (Continued... General Definitions § 690.10 Administrative cost allowance to participating schools. (a) Subject to...

  2. Electrochemical characterization of oxide film formed at high temperature on Alloy 690

    Energy Technology Data Exchange (ETDEWEB)

    Abraham, Geogy J., E-mail: gja@barc.gov.in [Materials Science Division, BARC, Mumbai 400 085 (India); Bhambroo, Rajan [Deptt. of Metallurgical Engg. and Mat. Sci., IIT Bombay, Mumbai 400 076 (India); Kain, V. [Materials Science Division, BARC, Mumbai 400 085 (India); Shekhar, R. [CCCM, BARC, Hyderabad 500 062 (India); Dey, G.K. [Materials Science Division, BARC, Mumbai 400 085 (India); Raja, V.S. [Deptt. of Metallurgical Engg. and Mat. Sci., IIT Bombay, Mumbai 400 076 (India)

    2012-02-15

    Highlights: Black-Right-Pointing-Pointer GD-QMS studies of high temperature oxide film formed on Alloy 690. Black-Right-Pointing-Pointer Defect density reduced with increase in temperature. Black-Right-Pointing-Pointer Electrochemical behaviour of oxide film correlated to the Cr-content in oxide. - Abstract: High temperature passivation studies on Alloy 690 were carried out in lithiated water at 250 Degree-Sign C, 275 Degree-Sign C and 300 Degree-Sign C for 72 h. The passive films were characterized by glow discharge-quadrupole mass spectroscopy (GD-QMS) for compositional variation across the depth and micro laser Raman spectroscopy for oxide composition on the surface. The defect density in the oxide films was established from the Mott-Schottky analysis using electrochemical impedance spectroscopy. Electrochemical experiments at room temperature in chloride medium revealed best passivity behaviour by the oxide film formed at 300 Degree-Sign C for 72 h. The electrochemical studies were correlated to the chromium (and oxygen) content of the oxide films. Autoclaving at 300 Degree-Sign C resulted in the best passive film formation on Alloy 690 in lithiated water.

  3. Comparative Thermal Aging Effects on PM-HIP and Forged Inconel 690

    Science.gov (United States)

    Bullens, Alexander L.; Bautista, Esteban; Jaye, Elizabeth H.; Vas, Nathaniel L.; Cain, Nathan B.; Mao, Keyou; Gandy, David W.; Wharry, Janelle P.

    2018-03-01

    This study compares thermal aging effects in Inconel 690 (IN690) produced by forging and powder metallurgy with hot isostatic pressing (PM-HIP). Isothermal aging is carried out over 400-800°C for up to 1000 h and then metallography and nanoindentation are utilized to relate grain microstructure with hardness and yield strength. The PM-HIP IN690 maintains a constant grain size through all aging conditions, while the forged IN690 exhibits limited grain growth at the highest aging temperature and longest aging time. The PM-HIP IN690 exhibits comparable mechanical integrity as the forged material throughout aging: hardness and yield strength are unchanged with 100 h aging, but increase after 1000 h aging at all temperatures. In both the PM-HIP and forged IN690, the Hall-Petch relationship for Ni-based superalloys predicts yield strength for 0-100 h aged specimens, but underestimates yield strength in the 1000 h aged specimens because of thermally induced precipitation.

  4. Quench Performance and Field Quality of FNAL Twin-Aperture 11 T Nb$_{3}$Sn Dipole Model for LHC Upgrades

    CERN Document Server

    Stoynev, S; Apollinari, G; Auchmann, B; Barzi, E; Izquierdo Bermudez, S; Bossert, R; Chlachidze, G; DiMarco, J; Karppinen, M; Nobrega, F; Novitski, I; Rossi, F; Savary, F; Smekens, D; Strauss, T; Turrioni, D; Velev, G; Zlobin, A V

    2017-01-01

    A 2 m long single-aperture dipole demonstrator and two 1 m long single-aperture models based on Nb$_{3}$Sn superconductor have been built and tested at FNAL. The two 1 m long collared coils were then assembled in a twin-aperture Nb$_{3}$Sn dipole demonstrator compatible with the LHC main dipole and tested in two thermal cycles. This paper summarizes the quench performance of the FNAL twin-aperture Nb$_{3}$Sn 11 T dipole in the temperature range of 1.9-4.5 K. The results of magnetic measurements for one of the two apertures are also presented. Test results are compared to the performance of coils in a single-aperture configuration. A summary of quench propagation studies in both apertures is given.

  5. Color transparency after the NE18 and E665 experiments: Outlook and perspectives at CEBAF

    Energy Technology Data Exchange (ETDEWEB)

    Nemchik, J. [Inst. of Experimental Physicals, Kosice (Czechoslovakia); Nikolaev, N.N.; Zakharov, B.G. [L.D. Landau Inst. for Theoretical Physics, Moscow (Russian Federation)

    1994-04-01

    CEBAF is a high-luminocity factory of virtual photons with variable virtuality Q{sup 2} and transverse size. This makes CEBAF, in particular after the energy upgrade to (8-12)GeV, an ideal facility for uncovering new phenomena, and opening new windows, at the interface of the perturbative and nonperturbative QCD. The authors discuss color transparency as the case for a broad program on electroproduction of vector mesons {rho}{sup 0}, {omega}{sup 0}, {phi}{sup 0} and their radial excitations {rho}{prime}, {omega}{prime}, {phi}{prime} at CEBAF. They also comment on the second generation of experiments on color transparency in {sup 4}He(e, e{prime}p) scattering, which are also feasible at CEBAF. In 1994, they can make more reliable projections into future because their understanding of the onset of color transparency has greatly been augmented by two experiments completed in 1993: (i) no effect of CT was seen in the SLAC NE18 experiment on A(e, e{prime}p) scattering at virtualities of the exchanged photon Q{sup 2} {approx_lt} 7 GeV{sup 2}, (ii) strong signal of CT was observed in the FNAL E665 experiment on exclusive {rho}{sup 0}-meson production in deep inelastic scattering in the same range of Q{sup 2}. They discuss the impact of these observations on the CEBAF experimental program. They argue they both are good news, both were anticipated theoretically, and both rule in the correct QCD mechanism of the onset of CT.

  6. Influence of Rust Permeability on Corrosion of E690 Steel in Industrial and Non-industrial Marine Splash Zones

    Science.gov (United States)

    Chen, Mindong; Pang, Kun; Liu, Zhiyong; Wu, Junsheng; Li, Xiaogang

    2018-05-01

    The corrosion behaviour of E690 steel in industrial and non-industrial marine splash environments was studied by environmental testing, morphology analysis, electrochemical measurements, and scanning Kelvin probe microscopy. Chloride and sulphide anions were found to diffuse across the rust layer following the evaporation of seawater splashed on the steel's surface. The cation-selective permeability of the rust layer resulted in an anion concentration gradient across the rust layer, which was more significant in the presence of sulphur dioxide. In addition, sulphur dioxide enhanced the formation of α-FeOOH, which led to the formation of distinct anode and cathode areas at the rust/steel interface.

  7. Studies of E-Cloud Build up for the FNAL Main Injector and for the LHC

    International Nuclear Information System (INIS)

    Furman, M.A.

    2006-01-01

    We present a summary of recent simulation studies of the electron-cloud (EC) build-up for the FNAL MI and for the LHC. In the first case we pay particular attention to the dependence on bunch intensity N b at injection energy assuming the nominal bunch spacing t b = 19 ns, and we focus on the dipole magnets and field-free regions. The saturated value of the average EC density shows a clear threshold in N b beyond which the beam will be approximately neutralized on average. For the case of the LHC we limit our discussion to arc dipoles at collision energy, and bunch spacings t b = 25 ns or t b = 75 ns. The main variables exercised in this study are N b and the peak value of the secondary emission yield (SEY) (delta) max . For t b = 25 ns we conclude that the EC power deposition is comfortably below the available cooling capacity of the cryogenic system if (delta) max is below ∼ 1.2 at nominal N b . For t b = 75 ns, the EC power deposition is insignificant. As a byproduct of this exercise, we reach a detailed understanding of the significant role played by the backscattered secondary electrons. This article summarizes the results, an slightly extends the discussions, presented in Refs. 1 and 2

  8. Effects of microstructure and mechanical properties of alloys 600 an 690 on secondary side SCC

    International Nuclear Information System (INIS)

    Vaillant, F.; Buisine, D.; Prieux, B.; Fournel, J.C.; Gelpi, A.

    1996-03-01

    Modeling for secondary side cracking is needed to understand the behaviour of alloy 600 in plants. They require a comprehensive understanding of the various influences of the material properties on Stress Corrosion Cracking (SCC), based on field experience and laboratory data. In an attempt to predict the materials effects on SCC behaviour of new steam generators, laboratory corrosion data of alloy 690 were overviewed. French field experience with steam generators equipped with drilled tube support plates (TSPs) has demonstrated that the lower the yield stress (YS) and the carbon content, the higher the susceptibility t secondary side cracking of mill-annealed (MA) alloy 600. Also heat treated (700 deg. C x 16 h) tubing has been shown to have a much better resistance, but this excellent resistance could not be attributed only to the material properties. In laboratory environments, particularly in caustics, results have confirmed several of the above mentioned key findings on alloy 600: in caustic environments and under constant loading, tubes fabricated from MA alloy 600 with low YS have exhibited the worst resistance to initiation; YS was found to be the most accurate parameter to account for the behaviour of MA alloy 600. A heat treatment at 700 deg. C appeared to reduce the propagation rates of cracks in alloy 600. The best IGSCC resistance of alloy 690 was obtained for tubes with intergranular precipitation of carbides. TT (700 deg. C) significantly improved the propagation resistance of alloy 690; in acidic and neutral sulfate environments, IGSCC of alloy 600 was not strongly dependent on the microstructure in the MA condition, but sensitization was detrimental. When alloy 600 and particularly alloy 690 were thermally treated at 700 deg. C x 16 h, the resistance to IGSCC was significantly improved. Tests performed on alloy 690 have shown a better resistance to IGSCC initiation and propagation than alloy 600, in NaOH and acidic sulfate environments. (authors

  9. IGSCC growth behaviors of Alloy 690 in hydrogenated high temperature water

    Energy Technology Data Exchange (ETDEWEB)

    Arioka, K.; Yamada, T.; Miyamoto, T.; Terachi, T. [INSS, (Japan)

    2011-07-01

    The rate of growth of stress corrosion cracking (SCC) was measured for cold worked and thermally treated and solution treated Alloy 690 (UNS N06690, CW TT690, CW ST690) in hydrogenated pressurized water reactor (PWR) primary water under static load condition. Three important patterns were observed: First, Intergranular stress corrosion cracking (IGSCC) was observed on both TT and ST690 even in static load condition if materials were heavily cold worked although the rate of SCC growth was much slower than that of CW mill annealed Alloy 600. Furthermore much rapid SCC growth was recognized in 20% CW TT690 than that of 20% CW ST690. This is quite different result in the literature in high temperature caustic solution. Second, in order to assess the role of creep, rates of creep crack growth were measured in air, argon, and hydrogen gas environments using 20% CW TT690, and 20% CW MA600 in the range of temperatures between 360 and 460 C; intergranular creep cracking (IG creep cracking) was observed on the test materials even in air. Similar slope of 1/T-type temperature dependencies on IGSCC and IG creep crack growth were observed on 20% CW TT690. Similar fracture morphologies and similar 1/T-type temperature dependencies suggest that creep is important in the growth of IGSCC of CW TT690 in high temperature water. Third, cavities and pores were observed at grain boundaries near tips of SCC and creep although the size of the cavities and pores of SCC were much smaller than that of creep cracks. Also the population and size of cavities seem to decrease with decreasing test temperature. These results suggest that the difference in the size and population of cavities might be related with the difference in crack growth rate. And the cavities seem to be formed result from collapse of vacancies at grain boundaries as the crack embryo. This result suggests that diffusion of condensation of vacancies in high stressed fields occurs in high temperature water and gas environments

  10. BiBTeX styl pro ČSN ISO 690 a ČSN ISO 690-2

    OpenAIRE

    Pyšný, Radek

    2009-01-01

    Tato práce popisuje průběh vytváření bibliografického stylu pro nástroj BibTeX, pomocí něhož lze v LaTeXu sázet bibliografické citace v souladu s normou ČSN ISO 690. V úvodu práce je proveden rozbor ČSN ISO 690. Následuje popis spolupráce mezi systémem LaTeX a nástrojem BibTeX. Podstatná část práce je věnována popisu struktury souborů, které BibTeX potřebuje pro svou funkci, tj. bibliografická databáze a bibliografický styl. Závěr této práce je věnovaný popisu vlastností vytvořeného bibliogra...

  11. 40 CFR 1065.690 - Buoyancy correction for PM sample media.

    Science.gov (United States)

    2010-07-01

    ... mass, use a sample media density of 920 kg/m3. (3) For PTFE membrane (film) media with an integral... media. 1065.690 Section 1065.690 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Buoyancy correction for PM sample media. (a) General. Correct PM sample media for their buoyancy in air if...

  12. Neutrino oscillations on the way to long-baseline experiments

    CERN Document Server

    Ryabov, V A

    2003-01-01

    The motivations and physical objectives of experiments in the search for nu /sub mu / to nu /sub e/, nu /sub tau / oscillations in long- baseline accelerator neutrino beams are reviewed. Neutrino beams, detectors, and methods for detecting oscillations (detection of the disappearance of nu /sub mu /, and the appearance of nu /sub e/ and nu /sub tau /) in the current K2K (KEK to Super Kamiokande) experiment and in the MINOS (FNAL to Soudan) and OPERA (CERN to Gran Sasso) near-future experiments are discussed. Possibilities of measuring the oscillation parameters in these experiments are considered in connection with new data obtained in CHOOZ and Palo Verde reactor experiments, the solar neutrino deficit and nu /sub mu // nu /sub e/ anomaly of atmospheric neutrinos, which are observed in large-scale underground detectors, and the excess of nu /sub e/ events in the LSND experiment. Neutrino-oscillation scenarios used in models with three and four (including sterile) types of neutrino, as well as the possibility...

  13. Secondary emission detectors for fixed target experiments at Fermilab

    International Nuclear Information System (INIS)

    Drucker, R.; Ford, R.; Tassotto, G.

    1998-02-01

    A description of a Secondary Emission Electron Detector (SEED) is given. The SEEDs provide accurate profiles and positions at small wire spacing (125-500 mm) in a high energy, high rate environment that exceeds the capabilities of traditional segmented wire ion chambers (SWICs). This device has been designed and constructed to monitor beam position and profile of two fixed target beamlines, namely, KTeV (FNAL E-799, E-832) with an average beam sigma at target of 0.22 mm and NuTeV (FNAL E-815) with a sigma = 0.6 mm. KTeV took beam at an intensity of up to 5E12 800 GeV protons over a 20 sec spill and NuTeV received 1E13 800 GeV protons in five pings/spill

  14. An Experimental High Energy Physics Program: Task D

    International Nuclear Information System (INIS)

    Barnes, V.E.; Carmony, D.D.; Garfinkel, A.F.; Gutay, L.J.

    1992-01-01

    This report discusses: The CDF for bar p-p Collisions at FNAL; The L3 Detector for e + e - Collisions at CERN; The SCD Detector for pp Collisions at the SSCL (calorimeters); The SDC Detector for pp Collisions at the SSCL (muon detector); The CO experiment for bar p-p Collisions at FNAL; and Accelerator Physics at Fermilab

  15. Main Injector Particle Production Experiment Status

    International Nuclear Information System (INIS)

    Lebedev, Andre

    2007-01-01

    MIPP (FNAL-E907) is a large acceptance spectrometer to measure hadronic particle production - TPC and wire chambers to measure track parameters - TPC dE/dx, ToF, differential Cherenkov and ring imaging Cherenkov give π/K/p separation up to 100 GeV/c

  16. Effect of Residual Strain on PWSCC Initiation of Alloy 690 in Primary Water of PWR

    International Nuclear Information System (INIS)

    Lee, Eun-Hee; Kim, Sung-Woo; Eom, Ki-Hyeon; Hwang, Seong-Sik

    2016-01-01

    The object of this study is to attempt to correlate the susceptibility to crack initiation of Alloy 690 with the levels of cold work in simulated primary water. Experiments were conducted in high-temperature water to accelerate the cracking behavior and to determine the severity of crack initiation as a function of level of cold work for Alloy 690. Cracking susceptibility was determined by measuring the crack length per unit area and crack density. SCC initiation susceptibility of Alloy 690 increased with increase of the residual strain induced by the prior cold-rolling process. The 20% cold-rolled specimen exhibited mostly IG cracks, while the 30% and 40% cold-rolled specimens revealed significant amounts of IG and TG cracks. Most cracks were observed near the smallest cross-section area of the tapered specimen, where the maximum stress was applied, indicating that the SCC initiation susceptibility was strongly dependent on the applied stress. In order to find the correlation between SCC initiation susceptibility and residual strain induced by cold work, more analyses need to be performed in terms of the crack length per unit area and the crack density, as a strong indicative for SCC initiation susceptibility

  17. Analysis of local dislocation densities in cold-rolled alloy 690 using transmission electron microscopy

    International Nuclear Information System (INIS)

    Ahn, Tae-Young; Kim, Sung Woo; Hwang, Seong Sik

    2016-01-01

    Service failure of alloy 690 in NPP has not been reported. However, some research groups reported that primary water stress corrosion cracking (PWSCC) occurred in severely cold-rolled alloy 690. Transgranular craking was also reported in coll-rolled alloy 690 with a banded structure. In order to understand the effect of cold rolling on the cracking of alloy 690, many research groups have focused on the local strain and the cracked carbide induced by cold-rolling, by using electron backscatter diffraction (EBSD). Transmission electron microscopy (TEM) has been widely used to characterize structural materials because this technique has superior spatial resolution and allows for the analysis of crystallographic and chemical information. The aim of the present study is to understand the mechanism of the abnormally high crack growth rate (CGR) in cold-rolled alloy 690 with a banded structure. The local dislocation density was measured by TEM to confirm the effects of local strain on the stress corrosion cracking (SCC) of alloy 690 with a banded structure. The effects of intragranular carbides on the SCC were also evaluated in this study. The local dislocation densities were directly measured using TEM to understand the effect of local strain on the SCC of Ni-based alloy 690 with a banded structure. The dislocation densities in the interior of the grains sharply increased in highly cold-rolled specimens due to intragranular carbide, which acted as a dislocation source

  18. Underwater laser beam welding of Alloy 690

    International Nuclear Information System (INIS)

    Hino, Takehisa; Tamura, Masataka; Kono, Wataru; Kawano, Shohei; Yoda, Masaki

    2009-01-01

    Stress Corrosion Clacking (SCC) has been reported at Alloy 600 welds between nozzles and safe-end in Pressurized Water Reactor (PWR) plant. Alloy 690, which has higher chromium content than Alloy 600, has been applied for cladding on Alloy 600 welds for repairing damaged SCC area. Toshiba has developed Underwater Laser Beam Welding technique. This method can be conducted without draining, so that the repairing period and the radiation exposure during the repair can be dramatically decreased. In some old PWRs, high-sulfur stainless steel is used as the materials for this section. It has a high susceptibility of weld cracks. Therefore, the optimum welding condition of Alloy 690 on the high-sulfur stainless steel was investigated with our Underwater Laser Beam Welding unit. Good cladding layer, without any crack, porosity or lack of fusion, could be obtained. (author)

  19. Stress corrosion cracking growth rate of TT alloy 690 and its weld joint in simulated PWR primary water

    International Nuclear Information System (INIS)

    Yonezawa, T.

    2015-01-01

    Recently, some researchers reported that the SCC growth rate (SCCGR) of cold worked thermally treated (TT) Alloy 690 was significantly different in heat by heat. But, author has hypothesized that these high SCCGRs in cold worked TT Alloy 690 could be due to the metallurgical characteristics of these heats. In order to confirm this hypothesis, this study has been started in the author's laboratory, and the following 4 new evidences were obtained. First, microcracks of carbides and voids were observed in eutectic M 23 C 6 GB carbides (primary carbides) for cold rolled laboratory heat after as cast or lightly forged condition or for chemical composition simulated Bettis'TT Alloy 690 heat, after cold rolling, before SCC test. However, microcracks in primary carbides along grain boundaries and voids were rarely detected in the cold rolled commercial heat of TT Alloy 690 used for CRDM penetrations. Secondly, the SCCGR observed in TT Alloy 690 was different in each hot working process and each heat. Comparing the SCCGRs for all heats of cold worked TT Alloy 690, the SCCGR decreased with increasing of Vickers hardness. However, in same heats of cold worked TT Alloy 690, the SCCGR increased with increasing of Vickers hardness. Thirdly, the SCCGR in cold rolled TT Alloy 690 should be integrated by the effect of hardness or cold working ratio and by the effect of existing ratio of primary M23C6 carbides with cracks and Voids due to chemical composition and the fabrication process of TT Alloy 690. Fourthly, it is argued that the high SCCGRs in highly cold rolled TT Alloy 690 are not representative of the practical situation with TT Alloy 690 in service for CRDM adapter nozzles etc. The high SCCGR of highly cold rolled TT Alloy 690 is not thought to be an accurate tool in predicting the possibility of cracking of TT Alloy 690 for CRDM adapter nozzles. (author)

  20. Ductile Fracture Behaviour of Hot Isostatically Pressed Inconel 690 Superalloy

    Science.gov (United States)

    Cooper, A. J.; Brayshaw, W. J.; Sherry, A. H.

    2018-04-01

    Herein we assess the differences in Charpy impact behavior between Hot Isostatically Pressed and forged Inconel 690 alloy over the temperature range of 300 °C to - 196 °C. The impact toughness of forged 690 exhibited a relatively small temperature dependence, with a maximum difference of ca. 40 J measured between 300 °C and - 196 °C, whereas the HIP'd alloy exhibited a difference of approximately double that of the forged alloy over the same temperature range. We have conducted Charpy impact testing, tensile testing, and metallographic analyses on the as-received materials as well as fractography of the failed Charpy specimens in order to understand the mechanisms that cause the observed differences in material fracture properties. The work supports a recent series of studies which assess differences in fundamental fracture behavior between Hot Isostatically Pressed and forged austenitic stainless steel materials of equivalent grades, and the results obtained in this study are compared to those of the previous stainless steel investigations to paint a more general picture of the comparisons between HIP vs forged material fracture behavior. Inconel 690 was selected in this study since previous studies were unable to completely omit the effects of strain-induced martensitic transformation at the tip of the Chary V-notch from the fracture mechanism; Inconel 690 is unable to undergo strain-induced martensitic transformation due to the alloy's high nickel content, thereby providing a sister study with the omission of any martensitic transformation effects on ductile fracture behavior.

  1. Current experiments in elementary-particle physics

    International Nuclear Information System (INIS)

    Wohl, C.G.; Armstrong, F.E.; Rittenberg, A.

    1983-03-01

    Microfiche are included which contain summaries of 479 experiments in elementary particle physics. Experiments are included at the following laboratories: Brookhaven (BNL); CERN; CESR; DESY; Fermilab (FNAL); Institute for Nuclear Studies (INS); KEK; LAMPF; Serpukhov (SERP); SIN; SLAC; and TRIUMF. Also, summaries of proton decay experiments are included. A list of experiments and titles is included; and a beam-target-momentum index and a spokesperson index are given. Properties of beams at the facilities are tabulated

  2. Study of New FNAL-NICADD Extruded Scintillator as Active Media of Large EMCal of ALICE at LHC

    CERN Document Server

    Grachov, Oleg A.; Pla-Dalmau, A.; Bross, A.; Rykalin, V.

    2006-01-01

    The current conceptual design of proposed Large EMCal of ALICE at LHC is based largely on the scintillating mega-tile/fiber technology implemented in CDF Endplug upgrade project and in both barrel and endcap electromagnetic calorimeters of the STAR. The cost of scintillating material leads us to the choice of extruded polystyrene based scintillator, which is available in new FNAL-NICADD facility. Result of optical measurements, such as light yield and light yield variation, show that it is possible to use this material as active media of Large EMCal of ALICE at LHC.

  3. SCC behavior of alloy 690 from a CDRM mock-up

    International Nuclear Information System (INIS)

    Lapena, J.; Sol Garcia-Redondo, M. del; Perosanz, F.J.; Saez, A.; Gomez-Briceno, D.; Castelao, C.

    2015-01-01

    Stress corrosion cracking (SCC) response of Alloy 690 when the material has been subjected to nonuniform cold working is of interest to understand the behavior of the weld heat affected zone (HAZ) of Alloy 690 in which localised plastic strain exists due to weld shrinkage. This has a special interest in the case of control-rod-drive mechanisms (CRDM) of vessel head. To simulate these conditions during last years many crack growth rate (CGR) data were obtained in deformed material by cold work (rolling, forging or tensile straining), up to 40% of cold working. However, it is unclear to what extent this simulation procedure reproduces the conditions of the material in a CRDM. A research project is being carried out in order to obtain CGR data in realistic situations existing in operating power plants, by the use of CT specimens extracted from CRDMs. This presentation shows the characterization and some results of crack growth rate data on Alloy 690 TT base metal/HAZ/weld metal using specimens made from a CRDM mock-up. It has been fabricated following the usual procedures used for the RPV head fabrication for the Spanish PWR NPP. (authors)

  4. A Study on Fretting Behavior in Room Temperature for Inconel Alloy 690

    Science.gov (United States)

    Kwon, Jae Do; Chai, Young Suck; Bae, Yong Tak; Choi, Sung Jong

    The initial crack under fretting condition occurs at lower stress amplitude and lower cycles of cyclic loading than that under plain fatigue condition. The fretting damage, for example, can be observed in fossil and nuclear power plant, aircraft, automobile and petroleum chemical plants etc. INCONEL alloy 690 is a high-chromium nickel alloy having excellent resistance to many corrosive aqueous media and high-temperature atmospheres. This alloy is used extensively in the industries of nuclear power, chemicals, heat-treatment and electronics. In this paper, the effect of fretting damage on fatigue behavior for INCONEL alloy 690 was studied. Also, various kinds of tests on mechanical properties such as hardness, tension and plain fatigue tests are performed. Fretting fatigue tests were carried out with flat-flat contact configuration using a bridge type contact pad and plate type specimen. Through these experiments, it is found that the fretting fatigue strength decreased about 43% compared to the plain fatigue strength. In fretting fatigue, the wear debris is observed on the contact surface, and the oblique micro-cracks are initiated at an earlier stage. These results can be used as the basic data in a structural integrity evaluation of heat and corrosion resistant alloy considering fretting damages.

  5. A Study on Corrosion and Fretting Wear Resistance of Alloy 690 Tubes

    Energy Technology Data Exchange (ETDEWEB)

    Won, Ju Jin; Min, Su Jung; Kim, Myeong Su; Kim, Kyu Tae [Dongguk Univ., Gyeongju (Korea, Republic of)

    2013-10-15

    In this article, the effects of such failures have on the materials of alloy 690 are assessed. The corroded volume variation and mass decreased continuously with time. However, the oxide volume changes in an irregular pattern since the oxide formed on the alloy 690 metal may be detached due to the flake formation. The amount of the fretting wear increased with time. It can be seen that the wear rate increased with time and reduced at the later time. The test results show that the ductility decreased as corrosion increases. Alloy 690 is broadly used as a material of nuclear power plant's steam generator tubes because of its excellent mechanical strength, corrosion properties, wear properties and stability at a high temperature. However, the tubes for nuclear power plant's steam generators become a major threat for lifetime management and efficient operation of nuclear power plant due to various corrosion and fretting wear failures caused by flow-induced vibration (FIV) that occurs between tubes.

  6. Current experiments in elementary particle physics. Revision

    International Nuclear Information System (INIS)

    Galic, H.; Armstrong, F.E.; von Przewoski, B.

    1994-08-01

    This report contains summaries of 568 current and recent experiments in elementary particle physics. Experiments that finished taking data before 1988 are excluded. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, INS (Tokyo), ITEP (Moscow), IUCF (Bloomington), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several underground and underwater experiments. Instructions are given for remote searching of the computer database (maintained under the SLAC/SPIRES system) that contains the summaries

  7. Current Experiments in Particle Physics. 1996 Edition.

    Energy Technology Data Exchange (ETDEWEB)

    Galic, Hrvoje

    2003-06-27

    This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries.

  8. Current experiments in elementary particle physics. Revision

    Energy Technology Data Exchange (ETDEWEB)

    Galic, H. [Stanford Linear Accelerator Center, Menlo Park, CA (United States); Armstrong, F.E. [Lawrence Berkeley Lab., CA (United States); von Przewoski, B. [Indiana Univ. Cyclotron Facility, Bloomington, IN (United States)] [and others

    1994-08-01

    This report contains summaries of 568 current and recent experiments in elementary particle physics. Experiments that finished taking data before 1988 are excluded. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, INS (Tokyo), ITEP (Moscow), IUCF (Bloomington), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several underground and underwater experiments. Instructions are given for remote searching of the computer database (maintained under the SLAC/SPIRES system) that contains the summaries.

  9. Effect of microstructure on crack growth rate of alloy 690 in primary water

    International Nuclear Information System (INIS)

    Sakakibara, Y.; Hirano, T.; Nakayama, G.

    2015-01-01

    It was reported that the chemical composition and fabrication process of alloy 690 were important for the resistance to SCC in primary water. In this paper, we evaluated crack growth rate (CGR) of commercial thick plates (WT, XT) and forgings (FT, FM) made by some material manufacturers. Specimen WT showed the highest CGR in the thick plates. WT had coarse grain and film-like carbides which were assumed as eutectic M 23 C 6 . Forged alloy 690 MA and TT (FM and FT) showed no CGR. One of alloy 690 plates (XT) was cold rolled by 30% of reduction in our laboratory to investigate the effect of the orientation of the specimen on CGR. The specimens in the S-L and the S-T orientation showed higher CGRs than those in the T-L and the L-S orientation. (authors)

  10. Low cycle fatigue of Alloy 690 and welds in a simulated PWR primary water environment

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Jongdae; Cho, Pyungyeon; Jang, Changheui [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Cho, Pyungyeon [Khalifa Univ., Abu Dhabi (United Arab Emirates); Kim, Tae Soon; Lee, Yong Sung [Korea Hydro and Nuclear Power Co., Daejeon (Korea, Republic of)

    2013-05-15

    In this study, environmental fatigue tests for these materials were performed and the new prediction model of fatigue life of Alloy 690 and weld in primary water condition was proposed. To evaluate the fatigue life of Alloy 690 and 52M in a PWR environment, low cycle fatigue tests were performed and revised fatigue life prediction models and environmental factor were proposed. With the revised Fen model for Alloy 690 and 52M, the reliability of the fatigue life prediction has been improved. The reduction of low cycle fatigue life of metallic materials in the primary coolant water environments has been the subject of debate between the utility and regulator since 1980s. It became the significant licensing problem since the issue of RG-1.207 by U. S. NRC. The statistical model for the environmental factor, Fen, specified in RG-1.207 was based on the extensive test results accumulated by the ANL and Japanese national program. Of the materials, the limited fatigue life data of Ni-Cr-Fe alloys were used to develop the Fen for the alloys. Furthermore, test data for Alloy 690 and its weld are limited. Considering that Alloy 690 will be extensively used in the new nuclear power plants, additional effort to validate or improve current Fen model is required.

  11. Current experiments in particle physics - particle data group

    Energy Technology Data Exchange (ETDEWEB)

    Galic, H. [Stanford Univ., CA (United States). Stanford Linear Accelerator Center; Lehar, F. [Centre d`Etudes Nucleaires de Saclay, Gif-sur-Yvette (France); Kettle, P.R. [Paul Scherrer Institute, Villigen (Switzerland)] [and others

    1996-09-01

    This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries.

  12. Current experiments in particle physics - particle data group

    International Nuclear Information System (INIS)

    Galic, H.; Kettle, P.R.

    1996-09-01

    This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries

  13. The suppression of dissolution for alloy 690 in high temperature and high pressure water with chromium ion implantation

    International Nuclear Information System (INIS)

    Shibata, Toshio; Fujimoto, Shinji; Ohtani, Saburou; Watanabe, Masanori; Hirao, Kyozo; Okumoto, Masaru; Shibaike, Hiroyuki.

    1994-01-01

    As the material of heat exchanger tubes for PWRs, the nickel alloys such as alloy 690 and alloy 600 have been used, but 58 Ni and 60 Co contained as an impurity elute in primary cooling water, and are radioactivated, in this way, they become the cause of radiation exposure. By increasing chromium concentration, the corrosion resistance of nickel alloys is improved, and for modern heat exchangers, the alloy 690, of which the chromium content is increased up to 30%, has been adopted, and excellent results have been obtained. In this research, aiming at the further reduction of radiation exposure, by increasing the chromium concentration in surface layer using ion implantation technology, the change of the corrosion behavior of alloy 690 in high temperature, high pressure water was investigated. The chemical composition of the alloy 690 used, and the making of plate specimens are shown. The polarization behavior of alloy 690 in 0.1 mol/l sulfuric acid deaerated at normal temperature is reported, and the effect of suppressing dissolution was remarkable in the specimens with much implantation. The electrochemical behavior of alloy 690 in simulated cooling water was investigated. Immobile case has high chromium content and is thin. (K.I.)

  14. Observation of 690 MV m-1 Electron Accelerating Gradient with a Laser-Driven Dielectric Microstructure

    Energy Technology Data Exchange (ETDEWEB)

    Wootton, K.P.; Wu, Z.; /SLAC; Cowan, B.M.; /Tech-X, Boulder; Hanuka, A.; /SLAC /Technion; Makasyuk, I.V.; /SLAC; Peralta, E.A.; Soong, K.; Byer, R.L.; /Stanford U.; England, R.J.; /SLAC

    2016-06-27

    Acceleration of electrons using laser-driven dielectric microstructures is a promising technology for the miniaturization of particle accelerators. In this work, experimental results are presented of relativistic electron acceleration with 690±100 MVm-1 gradient. This is a record-high accelerating gradient for a dielectric microstructure accelerator, nearly doubling the previous record gradient. To reach higher acceleration gradients the present experiment employs 90 fs duration laser pulses.

  15. Ecloud Build-Up Simulations for the FNAL MI for a Mixed Fill Pattern: Dependence on Peak SEY and Pulse Intensity During the Ramp

    International Nuclear Information System (INIS)

    Furman, M.A.

    2010-01-01

    We present simulation results of the build-up of the electron-cloud density n e in three regions of the FNAL Main Injector (MI) for a beam fill pattern made up of 5 double booster batches followed by a 6th single batch. We vary the pulse intensity in the range N t = (2-5) x 10 13 , and the beam kinetic energy in the range E k = 8-120 GeV. We assume a secondary electron emission model qualitatively corresponding to TiN, except that we let the peak value of the secondary electron yield (SEY) (delta) max vary as a free parameter in a fairly broad range. Our main conclusions are: (1) At fixed N t there is a clear threshold behavior of n e as a function of (delta) max in the range ∼ 1.1-1.3. (2) At fixed (delta) max , there is a threshold behavior of n e as a function of N t provided (delta) max is sufficiently high; the threshold value of N t is a function of the characteristics of the region being simulated. (3) The dependence on E k is weak except possibly at transition energy. Most of these results were informally presented to the relevant MI personnel in April 2010.

  16. Norma ISO 690:2010 [Doctorado. 2015

    OpenAIRE

    Biblioteca Universitaria

    2015-01-01

    Mediante el estudio de este tema aprenderás a gestionar adecuadamente tu bibliografía adquiriendo una serie de competencias que te permitirán: - Actuar de manera responsable, ética y legal en el uso de la información empleada para realizar un trabajo académico. - Identificar el estilo de cita más adecuado para cada disciplina científica. - Identificar correctamente y elaborar las referencias bibliográficas correspondientes a distintos tipos de documentos, de acuerdo con la norma ISO 690:2010....

  17. Norma ISO 690:2010 [Doctorado. 2017

    OpenAIRE

    Biblioteca Universitaria

    2017-01-01

    Mediante el estudio de este tema aprenderás a gestionar adecuadamente tu bibliografía adquiriendo una serie de competencias que te permitirán: - Actuar de manera responsable, ética y legal en el uso de la información empleada para realizar un trabajo académico. - Identificar el estilo de cita más adecuado para cada disciplina científica. - Identificar correctamente y elaborar las referencias bibliográficas correspondientes a distintos tipos de documentos, de acuerdo con la norma ISO 690:2010....

  18. Norma ISO 690:2010 [Doctorado. 2014

    OpenAIRE

    Biblioteca Universitaria

    2014-01-01

    Mediante el estudio de este tema aprenderás a gestionar adecuadamente tu bibliografía adquiriendo una serie de competencias que te permitirán: - Actuar de manera responsable, ética y legal en el uso de la información empleada para realizar un trabajo académico. - Identificar el estilo de cita más adecuado para cada disciplina científica. - Identificar correctamente y elaborar las referencias bibliográficas correspondientes a distintos tipos de documentos, de acuerdo con la norma ISO 690:2010....

  19. La cita documental : elementos y ejemplos de referencias en los estilos de la MLA y de la APA. Documentos electrónicos ISO 690-2

    OpenAIRE

    Kolesas, Mabel; De-Volder, Carolina

    2008-01-01

    How to quote. Abridged style manual for writers of printed documents according to the Modern Language Association (MLA), the American Psychological Association (APA) and ISO 690-2 standards for E-documents.

  20. Ductility dip cracking susceptibility of Inconel Filler Metal 52 and Inconel Alloy 690

    International Nuclear Information System (INIS)

    Kikel, J.M.; Parker, D.M.

    1998-01-01

    Alloy 690 and Filler Metal 52 have become the materials of choice for commercial nuclear steam generator applications in recent years. Filler Metal 52 exhibits improved resistance to weld solidification and weld-metal liquation cracking as compared to other nickel-based filler metals. However, recently published work indicates that Filler Metal 52 is susceptible to ductility dip cracking (DDC) in highly restrained applications. Susceptibility to fusion zone DDC was evaluated using the transverse varestraint test method, while heat affected zone (HAZ) DDC susceptibility was evaluated using a newly developed spot-on-spot varestraint test method. Alloy 690 and Filler Metal 52 cracking susceptibility was compared to the DDC susceptibility of Alloy 600, Filler Metal 52, and Filler Metal 625. In addition, the effect of grain size and orientation on cracking susceptibility was also included in this study. Alloy 690, Filler Metal 82, Filler Metal 52, and Filler Metal 625 were found more susceptible to fusion zone DDC than Alloy 600. Filler Metal 52 and Alloy 690 were found more susceptible to HAZ DDC when compared to wrought Alloy 600, Filler Metal 82 and Filler Metal 625. Filler Metal 52 exhibited the greatest susceptibility to HAZ DDC of all the weld metals evaluated. The base materials were found much more resistant to HAZ DDC in the wrought condition than when autogenously welded. A smaller grain size was found to offer greater resistance to DDC. For weld metal where grain size is difficult to control, a change in grain orientation was found to improve resistance to DDC

  1. The temperature dependence of the tensile properties of thermally treated Alloy 690 tubing

    International Nuclear Information System (INIS)

    Harrod, D.L.; Gold, R.E.; Larsson, B.; Bjoerkman, G.

    1992-01-01

    Tensile tests were run in air on full tube cross-sections of 22.23 mm OD by 1.27 mm wall thickness Alloy 690 steam generator production tubes from ten (10) heats of material at eight (8) temperatures between room temperature and 760 degrees C. The tubing was manufactured to specification requirements consistent with the EPRI guidelines for Alloy 690 tubing. The room temperature stress-strain curves are described quite well by the Voce equation. Ductile fracture by dimpled rupture was observed at all test temperatures. The elevated temperature tensile properties are compared with design data given in the ASME Code

  2. Ecloud Build-Up Simulations for the FNAL MI for a Mixed Fill Pattern: Dependence on Peak SEY and Pulse Intensity During the Ramp

    Energy Technology Data Exchange (ETDEWEB)

    Furman, M. A.

    2010-12-11

    We present simulation results of the build-up of the electron-cloud density n{sub e} in three regions of the FNAL Main Injector (MI) for a beam fill pattern made up of 5 double booster batches followed by a 6th single batch. We vary the pulse intensity in the range N{sub t} = (2-5) x 10{sup 13}, and the beam kinetic energy in the range E{sub k} = 8-120 GeV. We assume a secondary electron emission model qualitatively corresponding to TiN, except that we let the peak value of the secondary electron yield (SEY) {delta}{sub max} vary as a free parameter in a fairly broad range. Our main conclusions are: (1) At fixed N{sub t} there is a clear threshold behavior of n{sub e} as a function of {delta}{sub max} in the range {approx} 1.1-1.3. (2) At fixed {delta}{sub max}, there is a threshold behavior of n{sub e} as a function of N{sub t} provided {delta}{sub max} is sufficiently high; the threshold value of N{sub t} is a function of the characteristics of the region being simulated. (3) The dependence on E{sub k} is weak except possibly at transition energy. Most of these results were informally presented to the relevant MI personnel in April 2010.

  3. Characteristics of Film Formed on Alloy 600 and Alloy 690 in Water Containing lead

    International Nuclear Information System (INIS)

    Hwang Seong Sik; Lee, Deok Hyun; Kim, Hong Pyo; Kim, Joung Soo; Kim, Ju Yup

    1999-01-01

    Anodic polarization behaviors of Alloy 600 and Alloy 690 have been studied as a function of lead content in the solution of pH 4 and 10 at 90 .deg. C. As the amount of lead in the solution increased, critical current densities and passive current densities of Alloy 600 and Alloy 690 increased, while the breakdown potential of the alloys decreased. The high critical current density in the high lead solution was thought to come from the combination of an enhanced dissolution of constituents on the surface of the alloys by the lead and an anodic dissolution of metallic lead deposited on the surface of the specimens. The morphology of lead precipitated on the specimen after the anodic scan changed with the pH of solution: small irregular particles were precipitated on the surface of the specimen in the solution of pH 4, while the high density of regular sized particles was formed on it in the solution of pH 10.Pb was observed to enhance Cr depletion from the outer surface of Alloy 600 and Alloy 690 and also to increase the ratio of O 2- /OH - in the surface film formed in the high lead solution. The SCC resistance of Alloy 600 and Alloy 690 may have decreased due to the poor quality of the passive film formed and the enhanced oxygen evolution in the solution containing lead

  4. Environmentally assisted fatigue evaluation model of alloy 690 steam generator tube in high temperature water

    International Nuclear Information System (INIS)

    Tan Jibo; Wu Xinqiang; Han Enhou; Wang Xiang; Liu Xiaoqiang; Xu Xuelian

    2015-01-01

    Nickel-based alloy 690 has been widely used as steam generator tube in light water reactor (LWR) nuclear power plants, which may suffer from corrosion fatigue during long-term service. Many researches and operating experience indicated that the effect of LWR environment could significantly reduce the fatigue life of structural materials. However. such an environmental degradation effect was not fully addressed in the current ASME code design fatigue curves. Therefore, the Regulatory Guide 1.207 issued by US NRC required a new NPP have to incorporate the environment effects into fatigue analyses. In the last few decades, researchers in USA and Japan systematically investigated the corrosion fatigue behavior of nuclear-grade structural materials in LWR environment. Then, ANL model and JSME model were proposed, which incorporated environmental effects, including temperature, dissolved oxygen (DO) and strain rate for the nickel-based alloys. Due to lack of experiment data on domestic materials, there is no related environmental fatigue design model in China. In the present work, based on the corrosion fatigue tests of a kind of boat-shaped specimen in borated and lithiated high temperature water, the corrosion fatigue behavior and environmentally assisted cracking mechanism of domestic Alloy 690 steam generator tube have been investigate. An IMR model for the nickel-based alloy was proposed. The environmental fatigue life correction factor (F en ) was established, which addressed the environmental factors, including temperature, strain rate and dissolved oxygen. The method to evaluate environmental fatigue damage of structural materials in NPPs was proposed. (authors)

  5. Effect of surface cold work on corrosion of Alloy 690TT in high temperature high pressure water

    International Nuclear Information System (INIS)

    Wang, J.; Zhang, Z.; Han, E.-H.; Ke, W.

    2009-01-01

    This paper aims to investigate the effect of surface cold work on corrosion of Alloy 690TT. The Alloy 690TT was mechanical ground and electro polished respectively and immersed in primary water at DO = 2 ppm and DH = 2.5ppm respectively. The microstructure of surface and the compositions and morphology of the surface film on Alloy 690TT after immersion test were studied using scanning electron microscopy (SEM), transmission electron microscopy (TEM), Auger electron spectroscopy (AES) and focused ion beam (FIB). The results showed that feather-like oxide with decorated polyhedral oxide formed on ground surface and needle-like oxide with decorated polyhedral oxide formed on electro-polished surface. (author)

  6. Primary water stress corrosion cracking resistance of alloy 690 heat affected zones of butt welds

    International Nuclear Information System (INIS)

    Fournier, L.; Calonne, O.; Toloczko, M.B.; Bruemmer, S.M.; Massoud, J.P.; Lemaire, E.; Gerard, R.; Somville, F.; Richnau, A.; Lagerstrom, J.

    2015-01-01

    A wide V-groove butt weld was fabricated from Alloy 690 plates using Alloy 152 filler material, maximum allowable heat input, and very stiff strong-backs. Alloy 690 heat affected zones (HAZ) was characterized in terms of microstructure and plastic strains induced by weld shrinkage. Crack initiation tests were carried out in pure hydrogenated steam at 400 C. degrees for 4000 h. Crack growth rate tests were performed in simulated PWR primary water at a temperature of 360 C. degrees. A maximum plastic strain around 5% was measured in the vicinity of the fusion line, which decreased almost linearly with the distance from the fusion line. Crack initiation tests on Alloy 690 HAZ specimens as well as on 30% cold-rolled Alloy 690 specimens were performed in pure hydrogenated steam at 400 C. degrees (partial pressure of hydrogen = 0.7 bar) for a total of 4000 h using cylindrical notched tensile specimens, reverse U-bends and flat micro-tensile specimens. No crack initiation was detected. Stress corrosion propagation rates revealed extremely low SCC (Stress Corrosion Cracking) growth rates both in the base metal and in the HAZ region whose magnitudes are of no engineering significance. Overall, the results indicated limited plastic strain induced by weld shrinkage in butt weld HAZ, and to no particular susceptibility of primary water stress corrosion cracking. (authors)

  7. Object based data access at the D0 experiment

    International Nuclear Information System (INIS)

    Fuess, S.

    1995-11-01

    The D OE Experiment at Fermilab is currently participating in the FNAL Computing Division's ''Computing for Analysis Project'' (CAP) to investigate object based data storage and access. Following a short description of the CAP system architecture, the D OE data model is explored. A brief discussion of the method of operation of the CAP system leads into a concluding section

  8. Indiana University High Energy Physics, Task A

    Energy Technology Data Exchange (ETDEWEB)

    Brabson, B.; Crittenden, R.; Dzierba, A.; Hanson, G.; Martin, H.; Marshall, T.; Mir, R.; Mouthuy, T.; Ogren, H.; Rust, D.; Teige, S.; Zieminska, D.; Zieminski, A.

    1991-01-01

    This report discusses research in High Energy Physics under the following experiments: Meson spectroscopy at BNL; dimuon production at FNAL; the DO collider experiment at FNAL; the Mark II experiment at SLC and PEP; the OPAL experiment at CERN; and the superconducting supercollider.

  9. Indiana University High Energy Physics, Task A

    International Nuclear Information System (INIS)

    Brabson, B.; Crittenden, R.; Dzierba, A.; Hanson, G.; Martin, H.; Marshall, T.; Mir, R.; Mouthuy, T.; Ogren, H.; Rust, D.; Teige, S.; Zieminska, D.; Zieminski, A.

    1991-01-01

    This report discusses research in High Energy Physics under the following experiments: Meson spectroscopy at BNL; dimuon production at FNAL; the DO collider experiment at FNAL; the Mark II experiment at SLC and PEP; the OPAL experiment at CERN; and the superconducting supercollider

  10. {rho}{sup 0}-{gamma} mixing in the neutral channel pion form factor F{sub {pi}}{sup (e)}(s) and its role in comparing e{sup +}e{sup -} with {tau} spectral functions

    Energy Technology Data Exchange (ETDEWEB)

    Jegerlehner, Fred [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Humboldt Univ. Berlin (Germany). Inst. fuer Physik; Szafron, Robert [Uniwersytet Slaski, Katowice (Poland). Inst. Fizyki

    2011-01-15

    We study the effect of {rho}{sup 0}-{gamma} mixing in e{sup +}e{sup -}{yields}{pi}{sup +}{pi}{sup -} and its relevance for the comparison of the square modulus of the pion form-factor vertical stroke F{sub {pi}}{sup (e)}(s) vertical stroke {sup 2}, as measured in e{sup +}e{sup -} annihilation experiments, and vertical stroke F{sub {pi}}{sup ({tau})}(s) vertical stroke {sup 2} the corresponding quantity obtained after accounting for known isospin breaking effects by an isospin rotation from the {tau}-decay spectra. After correcting the {tau} data for the missing {rho}-{gamma} mixing contribution, besides the other known isospin symmetry violating corrections, the {pi}{pi} I=1 part of the hadronic vacuum polarization contribution to the muon g - 2 are fully compatible between {tau} based and e{sup +}e{sup -} based evaluations. {tau} data thus confirm result obtained with e{sup +}e{sup -} data. Our evaluation of the leading order vacuum polarization contribution, based on all e{sup +}e{sup -} data including more recent BaBar and KLOE data, yields a{sub {mu}}{sup had,LO}[e]=690.75(4.72) x 10{sup -10} (e{sup +}e{sup -} based), while including {tau} data we find a{sub {mu}}{sup had,LO}[e, {tau}]=690.96(4.65) x 10{sup -10} (e{sup +}e{sup -} + {tau} based). This backs the {proportional_to}3{sigma} deviation between a{sub {mu}}{sup experiment} and a{sub {mu}}{sup theory}. For the {tau} di-pion branching fraction we find B{sub {pi}}{sub {pi}{sup 0}}{sup CVC} = 25.20 {+-} 0.0.17 {+-} 0.28 from e{sup +}e{sup -}+CVC, while B{sub {pi}}{sub {pi}{sup 0}}0 = 25.34 {+-} 0.0.06 {+-} 0.08 is evaluated directly from the {tau} spectra. (orig.)

  11. Progressive degradation of alloy 690 and the development of a significant improvement in alloy 800CR

    International Nuclear Information System (INIS)

    Staehle, Roger W.; Arioka, Koji; Tapping, Robert

    2015-01-01

    The present most widely used alloys for tubing in steam generators and structural materials in water cooled reactors are Alloy 690 and Alloy 800. However, both alloys, while improved over Alloy 600 may not meet the needs of longer range applications in the range of 80-100 years. Alloy 690 sustains damage resulting from the formation of cavities at grain boundaries which eventually cover about 50% of the area of the grain boundaries with the remainder covering being covered with carbides. The cavities seem to nucleate on the carbides leaving the grain boundaries a structure of cavities and carbides. Such a structure will lead the Alloy 690 to fail completely. Normal Alloy 800 does not produce such cavities and probably retains a large amount of its corrosion resistance but does sustain progressive SCC at low rate. A new alloy, 800CR, has been developed in a collaboration among Arioka, Tapping, and Staehle. This alloy is based on a Cr composition of 23.5-27% with the remainder retaining the previous Alloy 800 composition. 800CR sustains a crack velocity about 100 times less than Alloy 690 and a negligible rate of initiation. The 800CR, alloy is now seeking a patent. (authors)

  12. IGA resistance of TT Alloy 690 and concentration behavior of Broached Egg Crate tube support configuration

    International Nuclear Information System (INIS)

    Suzuki, S.; Kusakabe, T.; Yamamoto, H.; Arioka, K.; Ochi, T.

    1992-01-01

    In order to improve the reliability of the Steam Generator (SG), TT Alloy 690 and BEC (Broached Egg Crate) type tube support plate has been developed. Some tests are carried out to heighten the reliability for these improvements all the more and the following results are obtained. (1) SERT test (Slow Extension Rate Test) made clear that TT690 has less IGA susceptibility in comparison with MA600. (2) The alkaline susceptibility on the occurrence of IGA/SCC on TT690 and MA600 obtained by SERT corresponds to that obtained by Model Boiler test. (3) By model boiler test, superior concentration behaviors for BEC type tube support plate configuration have been recognized in comparison with Drill type. This result is obtained by the joint research of the five utilities (Kansai Epco, Hokkaido Epco, Shikoku Epco, Kyushu Epco, JAPCO) and MHI

  13. 78 FR 42526 - Compliance Policy Guide Sec. 690.800 Salmonella

    Science.gov (United States)

    2013-07-16

    ... food for animals. It does not create or confer any rights for or on any person and does not operate to...] Compliance Policy Guide Sec. 690.800 Salmonella in Food for Animals; Availability AGENCY: Food and Drug... Animals'' (the CPG). The CPG provides guidance to FDA staff on Salmonella-contaminated food for animals...

  14. 47 CFR 74.690 - Transition of the 1990-2025 MHz band from the Broadcast Auxiliary Service to emerging technologies.

    Science.gov (United States)

    2010-10-01

    ... Broadcast Auxiliary Service to emerging technologies. 74.690 Section 74.690 Telecommunication FEDERAL... of the 1990-2025 MHz band from the Broadcast Auxiliary Service to emerging technologies. (a) New... licensed emerging technology services will maintain primary status in the band until the Existing Licensee...

  15. Compilation of current high-energy-physics experiments

    International Nuclear Information System (INIS)

    Wohl, C.G.; Kelly, R.L.; Armstrong, F.E.

    1980-04-01

    This is the third edition of a compilation of current high energy physics experiments. It is a collaborative effort of the Berkeley Particle Data Group, the SLAC library, and ten participating laboratories: Argonne (ANL), Brookhaven (BNL), CERN, DESY, Fermilab (FNAL), the Institute for Nuclear Study, Tokyo (INS), KEK, Rutherford (RHEL), Serpukhov (SERP), and SLAC. The compilation includes summaries of all high energy physics experiments at the above laboratories that (1) were approved (and not subsequently withdrawn) before about January 1980, and (2) had not completed taking of data by 1 January 1976

  16. Prevention of microcracking by REM addition to alloy 690 filler metal in laser clad welds

    International Nuclear Information System (INIS)

    Okauchi, Hironori; Saida, Kazuyoshi; Nishimoto, Kazutoshi

    2011-01-01

    Effect of REM addition to alloy 690 filler metal on microcracking prevention was verified in laser clad welding. Laser clad welding on alloy 132 weld metal or type 316L stainless steel was conducted using the five different filler metals of alloy 690 varying the La content. Ductility-dip crack occurred in laser clad welding when La-free alloy 690 filler metal was applied. Solidification and liquation cracks occurred contrarily in the laser cladding weld metal when the 0.07mass%La containing filler metal was applied. In case of laser clad welding on alloy 132 weld metal and type 316L stainless steel, the ductility-dip cracking susceptibility decreased, and solidification/liquation cracking susceptibilities increased with increasing the La content in the weld metal. The relation among the microcracking susceptibility, the (P+S) and La contents in every weld pass of the laser clad welding was investigated. Ductility-dip cracks occurred in the compositional range (atomic ratio) of La/(P+S) 0.99(on alloy 132 weld metal), >0.90 (on type 316L stainless steel), while any cracks did not occur at La/(P+S) being between 0.21-0.99 (on alloy 132 weld metal) 0.10-0.90 (on type 316L stainless steel). Laser clad welding test on type 316L stainless steel using alloy 690 filler metal containing the optimum La content verified that any microcracks did not occurred in the laser clad welding metal. (author)

  17. Indiana University High Energy Physics, Task A

    International Nuclear Information System (INIS)

    Brabson, B.; Crittenden, R.; Dzierba, A.

    1993-01-01

    This report discusses research at Indians University on the following high energy physics experiments: A search for mesons with unusual quantum numbers; hadronic states produced in association with high-mass dimuons; FNAL E740 (D0); superconducting super collider; and OPAL experiment at CERN

  18. Construction and performance of a cylindrical scintillating fiber detector for experiment 835 at FNAL

    International Nuclear Information System (INIS)

    Ambrogiani, M.; Baldini, W.; Bettoni, D.

    1996-01-01

    A tracking detector made of scintillating fibers has been built for the Fermilab experiment E835. The tracker is being used for a high resolution measurement of the polar angle θ and to provide a first level trigger, exploiting the fast response and very good time resolution of the signal from the fibers. The small amount of light from the fibers is detected by solid state devices (VLPC: Visible Light Photon Counters), with very high quantum efficiency. This paper reports about the construction of the tracker and gives the first results on the detector performance: light yield/mip, efficiency, signal homogeneity and time resolution

  19. Simulating Porous Magnetite Layer Deposited on Alloy 690TT Steam Generator Tubes.

    Science.gov (United States)

    Jeon, Soon-Hyeok; Son, Yeong-Ho; Choi, Won-Ik; Song, Geun Dong; Hur, Do Haeng

    2018-01-02

    In nuclear power plants, the main corrosion product that is deposited on the outside of steam generator tubes is porous magnetite. The objective of this study was to simulate porous magnetite that is deposited on thermally treated (TT) Alloy 690 steam generator tubes. A magnetite layer was electrodeposited on an Alloy 690TT substrate in an Fe(III)-triethanolamine solution. After electrodeposition, the dense magnetite layer was immersed to simulate porous magnetite deposits in alkaline solution for 50 days at room temperature. The dense morphology of the magnetite layer was changed to a porous structure by reductive dissolution reaction. The simulated porous magnetite layer was compared with flakes of steam generator tubes, which were collected from the secondary water system of a real nuclear power plant during sludge lancing. Possible nuclear research applications using simulated porous magnetite specimens are also proposed.

  20. Application of the S690QL class steels in responsible welded structures

    Directory of Open Access Journals (Sweden)

    Dušan Arsić

    2013-12-01

    Full Text Available In this paper are considered the most important properties of a special class of high strength steels S690QL, which can be classified into the group of special low alloyed steels. The high strength steels belong into a group of high quality steels. They possess exceptional mechanical properties, especially tensile strength and toughness. Those favorable properties are being achieved by application of special procedures of thermo-mechanical processing and simultaneous alloying with adequate elements. The advantages that the S690QL steels have with respect to other steels are being presented here. However, possibilities for application of those steels in responsible welded structures are limited due to their only relatively good weldability.  The special procedures for improving it are discussed here, primarily preheating, controlled heat input during welding and additional heat treatment of the welded joint.

  1. 75 FR 66769 - Draft Compliance Policy Guide Sec. 690.800 Salmonella

    Science.gov (United States)

    2010-10-29

    ...] Draft Compliance Policy Guide Sec. 690.800 Salmonella in Animal Feed; Availability; Extension of Comment... that are adulterated due to the presence of Salmonella. The Agency is taking this action in response to... action against animal feed or feed ingredients that are adulterated due to the presence of Salmonella...

  2. Bringing Federated Identity to Grid Computing

    Energy Technology Data Exchange (ETDEWEB)

    Teheran, Jeny [Fermilab

    2016-03-04

    The Fermi National Accelerator Laboratory (FNAL) is facing the challenge of providing scientific data access and grid submission to scientific collaborations that span the globe but are hosted at FNAL. Users in these collaborations are currently required to register as an FNAL user and obtain FNAL credentials to access grid resources to perform their scientific computations. These requirements burden researchers with managing additional authentication credentials, and put additional load on FNAL for managing user identities. Our design integrates the existing InCommon federated identity infrastructure, CILogon Basic CA, and MyProxy with the FNAL grid submission system to provide secure access for users from diverse experiments and collab orations without requiring each user to have authentication credentials from FNAL. The design automates the handling of certificates so users do not need to manage them manually. Although the initial implementation is for FNAL's grid submission system, the design and the core of the implementation are general and could be applied to other distributed computing systems.

  3. Alloy 690 in PWR type reactors; Aleaciones base niquel en condiciones de primario de los reactores tipo PWR

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Briceno, D.; Serrano, M.

    2005-07-01

    Alloy 690, used as replacement of Alloy 600 for vessel head penetration (VHP) nozzles in PWR, coexists in the primary loop with other components of Alloy 600. Alloy 690 shows an excellent resistance to primary water stress corrosion cracking, while Alloy 600 is very susceptible to this degradation mechanisms. This article analyse comparatively the PWSCC behaviour of both Ni-based alloys and associated weld metals 52/152 and 82/182. (Author)

  4. Theoretical and experimental studies of elementary physics. Annual technical progress report, November 1, 1992--October 31, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Bodek, A.; Ferbel, T.; Melissinos, A.C.; Slattery, P.; Tipton, P.; Das, A.; Hagen, C.R.; Rajeev, S.G.; Okubo, S.; Orr, L.

    1993-05-01

    The various components of the high-energy physics research program at the University of Rochester are presented. (I)Fixed-target experimentation at FNAL includes studies of direct photon production by p and {pi} on H, Be, and Cu, and hybrid mesons and other physics issues in Coulomb excitation at high energies. (II)The status of the GEM (Gammas, Electrons, and Muons) Experiment at the SSC is given. (III)The D-Zero experiment at FNAL is reviewed. (IV)Deep inelastic lepton--nucleon scattering experiments are summarized: electron scattering experiments at SLAC, FNAL neutrino quad triplet runs, FNAL neutrino sign selected experiments, and SDC cosmic ray test and test beam calibration. (V)Studies of nonlinear QED at SLAC concentrated on a study of QED at critical field strength in intense laser--high-energy electron collisions. (VI)Development work on the Collider Detector at Fermilab (CDF) emphasized the CDF silicon vertex detector, the end plug calorimeter, and the SDC tile/fiber calorimetry. (VII)The theoretical physics effort is sketched.

  5. Theoretical and experimental studies of elementary physics

    International Nuclear Information System (INIS)

    Bodek, A.; Ferbel, T.; Melissinos, A.C.; Slattery, P.; Tipton, P.; Das, A.; Hagen, C.R.; Rajeev, S.G.; Okubo, S.; Orr, L.

    1993-01-01

    The various components of the high-energy physics research program at the University of Rochester are presented. (I)Fixed-target experimentation at FNAL includes studies of direct photon production by p and π on H, Be, and Cu, and hybrid mesons and other physics issues in Coulomb excitation at high energies. (II)The status of the GEM (Gammas, Electrons, and Muons) Experiment at the SSC is given. (III)The D-Zero experiment at FNAL is reviewed. (IV)Deep inelastic lepton--nucleon scattering experiments are summarized: electron scattering experiments at SLAC, FNAL neutrino quad triplet runs, FNAL neutrino sign selected experiments, and SDC cosmic ray test and test beam calibration. (V)Studies of nonlinear QED at SLAC concentrated on a study of QED at critical field strength in intense laser--high-energy electron collisions. (VI)Development work on the Collider Detector at Fermilab (CDF) emphasized the CDF silicon vertex detector, the end plug calorimeter, and the SDC tile/fiber calorimetry. (VII)The theoretical physics effort is sketched

  6. Physics, Computer Science and Mathematics Division. Annual report, January 1-December 31, 1980

    International Nuclear Information System (INIS)

    Birge, R.W.

    1981-12-01

    Research in the physics, computer science, and mathematics division is described for the year 1980. While the division's major effort remains in high energy particle physics, there is a continually growing program in computer science and applied mathematics. Experimental programs are reported in e + e - annihilation, muon and neutrino reactions at FNAL, search for effects of a right-handed gauge boson, limits on neutrino oscillations from muon-decay neutrinos, strong interaction experiments at FNAL, strong interaction experiments at BNL, particle data center, Barrelet moment analysis of πN scattering data, astrophysics and astronomy, earth sciences, and instrument development and engineering for high energy physics. In theoretical physics research, studies included particle physics and accelerator physics. Computer science and mathematics research included analytical and numerical methods, information analysis techniques, advanced computer concepts, and environmental and epidemiological studies

  7. Physics, Computer Science and Mathematics Division. Annual report, January 1-December 31, 1980

    Energy Technology Data Exchange (ETDEWEB)

    Birge, R.W.

    1981-12-01

    Research in the physics, computer science, and mathematics division is described for the year 1980. While the division's major effort remains in high energy particle physics, there is a continually growing program in computer science and applied mathematics. Experimental programs are reported in e/sup +/e/sup -/ annihilation, muon and neutrino reactions at FNAL, search for effects of a right-handed gauge boson, limits on neutrino oscillations from muon-decay neutrinos, strong interaction experiments at FNAL, strong interaction experiments at BNL, particle data center, Barrelet moment analysis of ..pi..N scattering data, astrophysics and astronomy, earth sciences, and instrument development and engineering for high energy physics. In theoretical physics research, studies included particle physics and accelerator physics. Computer science and mathematics research included analytical and numerical methods, information analysis techniques, advanced computer concepts, and environmental and epidemiological studies. (GHT)

  8. Development of graded Ni-YSZ composite coating on Alloy 690 by Pulsed Laser Deposition technique to reduce hazardous metallic nuclear waste inventory.

    Science.gov (United States)

    Sengupta, Pranesh; Rogalla, Detlef; Becker, Hans Werner; Dey, Gautam Kumar; Chakraborty, Sumit

    2011-08-15

    Alloy 690 based 'nuclear waste vitrification furnace' components degrade prematurely due to molten glass-alloy interactions at high temperatures and thereby increase the volume of metallic nuclear waste. In order to reduce the waste inventory, compositionally graded Ni-YSZ (Y(2)O(3) stabilized ZrO(2)) composite coating has been developed on Alloy 690 using Pulsed Laser Deposition technique. Five different thin-films starting with Ni80YSZ20 (Ni 80 wt%+YSZ 20 wt%), through Ni60YSZ40 (Ni 60 wt%+YSZ 40 wt%), Ni40YSZ60 (Ni 40 wt%+YSZ 60 wt%), Ni20YSZ80 (Ni 20 wt%+YSZ 80 wt%) and Ni0YSZ100 (Ni 0 wt%+YSZ 100 wt%), were deposited successively on Alloy 690 coupons. Detailed analyses of the thin-films identify them as homogeneous, uniform, pore free and crystalline in nature. A comparative study of coated and uncoated Alloy 690 coupons, exposed to sodium borosilicate melt at 1000°C for 1-6h suggests that the graded composite coating could substantially reduced the chemical interactions between Alloy 690 and borosilicate melt. Copyright © 2011 Elsevier B.V. All rights reserved.

  9. Corrosion Control of Alloy 690 by Shot Peening and Electropolishing under Simulated Primary Water Condition of PWRs

    Directory of Open Access Journals (Sweden)

    Kyung Mo Kim

    2015-01-01

    Full Text Available This work clarifies the effect of surface modifications on the corrosion rate of Alloy 690, a nickel-based alloy for steam generator tubes, under the simulated test conditions of the primary water chemistry in nuclear power plants. The surface stress was modified by the shot peening and electropolishing methods. The shot peening treatment was applied using ceramic beads with different intensities by varying the air pressure and projection angle. The corrosion rate was evaluated by gravimetric analysis and the surface was analyzed by scanning electron microscopy (SEM. The corrosion rate of Alloy 690 was evaluated from the influence of the stress state on the metal surface. Based on the observation of the surface after the corrosion test, the oxide composition and its structure were affected by the surface modifications. The corrosion behavior of Alloy 690 was distinguished by the shot peening intensity on the surface, and additional electropolishing was effective at reducing the dissolution of nickel ions from the metal surface.

  10. Progress report of a research program in experimental high-energy physics, 1 January 1983-31 December 1983

    International Nuclear Information System (INIS)

    Widgoff, M.; Shapiro, A.M.

    1983-01-01

    An experimental program to study the interactions of hadrons and photons is being carried out using hybrid systems which include bubble chambers as visible targets as well as counter spectrometers for particle detection, measurement and identification. Experiments are now being carried out at Fermilab and SLAC, and an experiment on neutrino interactions has been approved for the Tevatron at Fermilab. We have been analyzing the film of our one-million-picture 1982 exposure for the study of π/sup +-/, K + and p interactions in hydrogen and in magnesium, silver and gold, at a beam momentum of 200 Gev/c (FNAL Experiments E-565 and E-570). Preliminary results confirm the positive charge excess observed among relativistic particles in our test run of 1981. During the past year analysis has continued on the data of SLAC experiments BC 72/73, investigating the interactions with hydrogen of 20 GeV polarized photons. Results have been obtained and published on the photoproduction of charm and on the lifetimes of charmed particles. Analysis is also in progress on production of vector mesons and strange particles. The study of charm photoproduction and decay is being extended in SLAC experiment BC 75. An initial run of over 600,000 pictures was obtained in the SLAC Hybrid Facility in Spring 1983 with substantially improved resolution in the bubble chamber. Extensive work continues on the analysis of our earlier FNAL experiments on π/sup +-/p, K + p, and pp interactions at 147 GeV/c (FNAL Experiment E-299). Preparations are in progress for our approved Tevatron II experiment designed to study neutrino interactions and particularly the production of tau neutrinos, using a neutrino beam produced by beam dump techniques and employing a hybrid system with a new one-meter holographic bubble chamber

  11. Microstructure Evolution and Mechanical Properties of Underwater Dry and Local Dry Cavity Welded Joints of 690 MPa Grade High Strength Steel.

    Science.gov (United States)

    Shi, Yonghua; Sun, Kun; Cui, Shuwan; Zeng, Min; Yi, Jianglong; Shen, Xiaoqin; Yi, Yaoyong

    2018-01-22

    Q690E high strength low alloy (HSLA) steel plays an important role in offshore structures. In addition, underwater local cavity welding (ULCW) technique was widely used to repair important offshore constructions. However, the high cooling rate of ULCW joints results in bad welding quality compared with underwater dry welding (UDW) joints. Q690E high strength low alloy steels were welded by multi-pass UDW and ULCW techniques, to study the microstructural evolution and mechanical properties of underwater welded joints. The microstructure and fracture morphology of welded joints were observed by scanning electron microscope and optical microscope. The elemental distribution in the microstructure was determined with an Electron Probe Microanalyzer. The results indicated that the microstructure of both two welded joints was similar. However, martensite and martensite-austenite components were significantly different with different underwater welding methods such that the micro-hardness of the HAZ and FZ in the ULCW specimen was higher than that of the corresponding regions in UDW joint. The yield strength and ultimate tensile strength of the ULCW specimen are 109 MPa lower and 77 MPa lower, respectively, than those of the UDW joint. The impact toughness of the UDW joint was superior to those of the ULCW joint.

  12. Microstructure Evolution and Mechanical Properties of Underwater Dry and Local Dry Cavity Welded Joints of 690 MPa Grade High Strength Steel

    Science.gov (United States)

    Sun, Kun; Cui, Shuwan; Zeng, Min; Yi, Jianglong; Shen, Xiaoqin; Yi, Yaoyong

    2018-01-01

    Q690E high strength low alloy (HSLA) steel plays an important role in offshore structures. In addition, underwater local cavity welding (ULCW) technique was widely used to repair important offshore constructions. However, the high cooling rate of ULCW joints results in bad welding quality compared with underwater dry welding (UDW) joints. Q690E high strength low alloy steels were welded by multi-pass UDW and ULCW techniques, to study the microstructural evolution and mechanical properties of underwater welded joints. The microstructure and fracture morphology of welded joints were observed by scanning electron microscope and optical microscope. The elemental distribution in the microstructure was determined with an Electron Probe Microanalyzer. The results indicated that the microstructure of both two welded joints was similar. However, martensite and martensite-austenite components were significantly different with different underwater welding methods such that the micro-hardness of the HAZ and FZ in the ULCW specimen was higher than that of the corresponding regions in UDW joint. The yield strength and ultimate tensile strength of the ULCW specimen are 109 MPa lower and 77 MPa lower, respectively, than those of the UDW joint. The impact toughness of the UDW joint was superior to those of the ULCW joint. PMID:29361743

  13. Co přináší třetí vydání mezinárodní normy ISO 690:2010

    OpenAIRE

    Bratková, Eva

    2010-01-01

    The review evaluates the structure and content of new, 3rd edition of the International Standard ISO 690:2010 which gives guidelines for the preparation of bibliographic references and citations to information resources. The text of new edition of the International Standard is compared with texts of the 2nd edition of the International Standard ISO 690:1987 and the 1st edition of the International Standard ISO 690-2:1997. Text of review contains some critical notes to content of published Int...

  14. Using the Tevatron Electron Lens (TEL) as a Wire and other TEL Studies at FNAL

    CERN Document Server

    Zimmermann, Frank; Sen, T; Shiltsev, V D; Zhang, X L; CERN. Geneva. AB Department

    2004-01-01

    During a visit to FNAL, on March 1, 2004, we performed a two-dimensional grid scan - with 1-mm step size - of the TEL transverse position in the vicinity of the proton and pbar beams, while three bunches of either beam were excited by the TEL on every turn. The measured tune shifts of protons and pbars are compatible with expectation. The proton Schottky 'emittance' is strongly dependent on the TEL position, possibly due to a coherent interaction between protons and electrons. The relative position of protons, pbars and TEL can be determined in three different ways: from the TEL BPM readings, from the tune variation with TEL position, and from the loss-rate variation with the TEL position. The results are consistent at least within 1 or 2 mm, possibly better. Tunes and losses do not necessarily yield identical values for the beam position. Significant proton losses occurred when the TEL approached the proton beam. These losses decreased with the third power of the distance. They were the result of a longitudi...

  15. Impact Fretting Wear Behavior of Alloy 690 Tubes in Dry and Deionized Water Conditions

    Institute of Scientific and Technical Information of China (English)

    Zhen-Bing Cai; Jin-Fang Peng; Hao Qian; Li-Chen Tang; Min-Hao Zhu

    2017-01-01

    The impact fretting wear has largely occurred at nuclear power device induced by the flow-induced vibration,and it will take potential hazards to the service of the equipment.However,the present study focuses on the tangential fretting wear of alloy 690 tubes.Research on impact fretting wear of alloy 690 tubes is limited and the related research is imminent.Therefore,impact fretting wear behavior of alloy 690 tubes against 304 stainless steels is investigated.Deionized water is used to simulate the flow environment of the equipment,and the dry environment is used for comparison.Varied analytical techniques are employed to characterize the wear and tribochemical behavior during impact fretting wear.Characterization results indicate that cracks occur at high impact load in both water and dry equipment;however,the water as a medium can significantly delay the cracking time.The crack propagation behavior shows a jagged shape in the water,but crack extended disorderly in dry equipment because the water changed the stress distribution and retarded the friction heat during the wear process.The SEM and XPS analysis shows that the main failure mechanisms of the tube under impact fretting are fatigue wear and friction oxidation.The effect of medium(water) on fretting wear is revealed,which plays a potential and promising role in the service of nuclear power device and other flow equipments.

  16. Commissioning and Operation of the FNAL Front end Injection Line and Ion Sources.

    Energy Technology Data Exchange (ETDEWEB)

    Karns, Patrick R. [Indiana Univ., Bloomington, IN (United States)

    2015-09-01

    This thesis documents the efforts made in commissioning and operating the RFQ Injection Line (RIL) as a replacement for the Cockcroft Walton front end. The Low Energy Beam Transport (LEBT) was assembled and tested with multiwire position and emittance monitor measurements. The Radio Frequency Quadrupole (RFQ) commissioning was completed with the same measurements as well as output beam energy measurements that showed it initially accelerated beam only to 700 keV, which was 50 keV lower than the design energy. Working with the manufacturer solutions were found and instituted to continue testing. The Medium Energy Beam Transport (MEBT) was then connected as the RIL was installed as the new front end of Linac. Testing gave way to operation when the new front end was used as the source of all High Energy Physics (HEP) beam for Fermi National Accelerator Laboratory (FNAL). The magnetron ion source that provides the H- beam for the front end required several changes and eventual upgrades to operate well; such as new source operating points for vacuum pressure and cesium admixture, and new materials for critical source components. Further research was conducted on the cathode geometry and nitrogen doping of the hydrogen gas as well as using solid state switches for the extractor system high voltage.

  17. Current Experiments in Particle Physics (September 1996)

    Energy Technology Data Exchange (ETDEWEB)

    Galic, H.; Lehar, F.; Klyukhin, V.I.; Ryabov, Yu.G.; Bilak, S.V.; Illarionova, N.S.; Khachaturov, B.A.; Strokovsky, E.A.; Hoffman, C.M.; Kettle, P.-R.; Olin, A.; Armstrong, F.E.

    1996-09-01

    This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries. This report contains full summaries of 180 approved current and recent experiments in elementary particle physics. The focus of the report is on selected experiments which directly contribute to our better understanding of elementary particles and their properties such as masses, widths or lifetimes, and branching fractions.

  18. Relationship between Microstructure and Ductility Dip Cracking resistance of Alloy 600/690 weld metals

    Energy Technology Data Exchange (ETDEWEB)

    Ryu, Jae Yong; Lee, Chang Hee [Hanyang University, Seoul (Korea, Republic of); Kim, Min Chul; Lee, Ho Jin; Kim, Keoung Ho [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Park, Kwang Soo; Shim, Deog Nam [Doosan HEAVY Industries and Construction, Seoul (Korea, Republic of)

    2009-10-15

    Ni-Cr-Fe alloys are used extensively in nuclear power systems for their resistance to general corrosion, localized corrosion, and environmentally assisted cracking. However, concerns with stress corrosion cracking of moderate chromium (14.22 wt-%) alloys such as Alloy 600 and its filler metals(FMs) (E-182 and EN82) have driven the application of higher chromium (28.30 wt-%) alloys like Alloy 690. While Alloy 690 and its FMs show outstanding resistance to environmentally assisted cracking in most water-reactor environments, these alloys are prone to welding defects, most notably to ductility dip cracking(DDC). The DDC occurs at temperatures between 0.5 and 0.8 of their melting temperature. This ductility drop may result in intergranular elevated temperature cracking often referred to as DDC. The DDC may occur during the high temperature processing of these alloys or during welding if the imposed strain exhausts the available ductility within this temperature range. Several alloy systems including Ni-base alloys, Ni.Cu alloys, Cu alloys, stainless steels and steels, have been reported to be susceptible to DDC. A complete understanding of the DDC mechanism does not exist, which makes DDC control in actual production conditions a very difficult task. In this study, the DDC resistance was evaluated with different FMs which have different chemical composition. The microstructural features of FMs such as precipitation behavior and grain boundaries morphology were observed, and it were correlated with the DDC susceptibility. The hot ductility test and strainto- fracture test was used to evaluate the DDC susceptibility at high temperature.

  19. Relationship between Microstructure and Ductility Dip Cracking resistance of Alloy 600/690 weld metals

    International Nuclear Information System (INIS)

    Ryu, Jae Yong; Lee, Chang Hee; Kim, Min Chul; Lee, Ho Jin; Kim, Keoung Ho; Park, Kwang Soo; Shim, Deog Nam

    2009-01-01

    Ni-Cr-Fe alloys are used extensively in nuclear power systems for their resistance to general corrosion, localized corrosion, and environmentally assisted cracking. However, concerns with stress corrosion cracking of moderate chromium (14.22 wt-%) alloys such as Alloy 600 and its filler metals(FMs) (E-182 and EN82) have driven the application of higher chromium (28.30 wt-%) alloys like Alloy 690. While Alloy 690 and its FMs show outstanding resistance to environmentally assisted cracking in most water-reactor environments, these alloys are prone to welding defects, most notably to ductility dip cracking(DDC). The DDC occurs at temperatures between 0.5 and 0.8 of their melting temperature. This ductility drop may result in intergranular elevated temperature cracking often referred to as DDC. The DDC may occur during the high temperature processing of these alloys or during welding if the imposed strain exhausts the available ductility within this temperature range. Several alloy systems including Ni-base alloys, Ni.Cu alloys, Cu alloys, stainless steels and steels, have been reported to be susceptible to DDC. A complete understanding of the DDC mechanism does not exist, which makes DDC control in actual production conditions a very difficult task. In this study, the DDC resistance was evaluated with different FMs which have different chemical composition. The microstructural features of FMs such as precipitation behavior and grain boundaries morphology were observed, and it were correlated with the DDC susceptibility. The hot ductility test and strainto- fracture test was used to evaluate the DDC susceptibility at high temperature

  20. Reactor θ{sub 13} Results and Recent Results from FNAL Neutrino Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, R.A., E-mail: randy.johnson@uc.edu [Physics Department, University of Cincinnati, Cincinnati, OH 45221-0011 (United States)

    2014-08-15

    The past year has been very exciting for neutrino physics. The last mixing angle, θ{sub 13}, has been measured by a number of experiments and is quite large. These experiments will, hopefully, continue reducing systematic and statistical errors in anticipation of statistically significant CP violation experiments. At Fermilab, MiniBooNE has finished its data run and has new results for electron antineutrino excesses; MINOS has done a combined fit for their ν{sub μ} disappearance measurements for neutrinos and antineutrinos (which are now consistent) and presented results for a sterile neutrino search; and Minerνa has presented its first cross section results.

  1. Experimental high energy physics. Progress report, 1 January 1985-31 December 1985

    International Nuclear Information System (INIS)

    Widgoff, M.

    1985-01-01

    An experimental program to study the interactions of hadrons, photons, and neutrinos is being carried out using hybrid systems which include bubble chambers as visible targets and counter spectrometers for particle detection, identification, and momentum measurements. Experiments have been run in both positive and negative hadron beams at Fermilab and with polarized photons at SLAC. Experiments with neutrino beams at Tevatron II at Fermilab are in progress and in preparation. In addition, we have joined in a collaboration to submit a Letter of Intent to build a detector for experiments at the new ep colliding beam accelerator HERA at DESY. We have been analyzing the film and counter data of our one-million-picture exposure for the study of π + , K + and p interactions in hydrogen and magnesium, silver and gold, at a beam momentum of 200 GeV/c (FNAL Experiments E-565 and E-570), as well as continuing the physics analysis of our earlier FNAL experiments on π + p, K + p and pp interactions at 147 GeV/c (FNAL Experiment E-299). During the past year analysis has continued on the data of SLAC experiments BC72/73/75, studying the interactions in hydrogen of 20 GeV polarized photons. Results have been obtained on photoproduction of charm and on the lifetimes of charmed particles, and on vector meson and strange particle production. Inclusive γp interactions are being studied in detail in this high statistics sample. The hybrid detector for neutrino studies at Tevatron II is operating at Fermilab, as a test for E636, the tau neutrino search to be run in a neutrino beam from a beam dump, and we are collecting data on muon neutrino interactions in the high Q 2 region made accessible for the first time by the Tevatron (E745). Brown built scintillator hodoscopes for the trigger system of the detector. Data including holographic photographs of the Tohoku one-meter bubble chamber are being obtained, and film analysis has begun

  2. Effect of Local Strain Distribution of Cold-Rolled Alloy 690 on Primary Water Stress Corrosion Crack Growth Behavior

    Directory of Open Access Journals (Sweden)

    Kim S.-W.

    2017-06-01

    Full Text Available This work aims to study the stress corrosion crack growth behavior of cold-rolled Alloy 690 in the primary water of a pressurized water reactor. Compared with Alloy 600, which shows typical intergranular cracking along high angle grain boundaries, the cold-rolled Alloy 690, with its heterogeneous microstructure, revealed an abnormal crack growth behavior in mixed mode, that is, in transgranular cracking near a banded region, and in intergranular cracking in a matrix region. From local strain distribution analysis based on local mis-orientation, measured along the crack path using the electron back scattered diffraction method, it was suggested that the abnormal behavior was attributable to a heterogeneity of local strain distribution. In the cold-rolled Alloy 690, the stress corrosion crack grew through a highly strained area formed by a prior cold-rolling process in a direction perpendicular to the maximum principal stress applied during a subsequent stress corrosion cracking test.

  3. The New (g-2) Experiment: A proposal to measure the muon anomalous magnetic moment to +-0.14 ppm precision

    Energy Technology Data Exchange (ETDEWEB)

    Carey, R. M.; Lynch, K. R.; Miller, J. P.; Roberts, B. L.; Morse, W. M.; Semertzides, Y. K.; Druzhinin, V. P.; Khazin, B. I.; Koop, I. A.; Logashenko, I. [et al.; Redin, S. I.

    2009-02-01

    We propose to measure the muon anomalous magnetic moment, a{sub {mu}}, to 0.14 ppm-a fourfold improvement over the 0.54 ppm precision obtained in the BNL experiment E821. The muon anomaly is a fundamental quantity and its precise determination will have lasting value. The current measurement was statistics limited, suggesting that greater precision can be obtained in a higher-rate, next-generation experiment. We outline a plan to use the unique FNAL complex of proton accelerators and rings to produce high-intensity bunches of muons, which will be directed into the relocated BNL muon storage ring. The physics goal of our experiment is a precision on the muon anomaly of 16 x 10{sup -11}, which will require 21 times the statistics of the BNL measurement, as well a factor of 3 reduction in the overall systematic error. Our goal is well matched to anticipated advances in the worldwide effort to determine the standard model (SM) value of the anomaly. The present comparison, {Delta}a{sub {mu}} (Expt: -SM) = (295 {+-} 81) x 10{sup -11}, is already suggestive of possible new physics contributions to the muon anomaly. Assuming that the current theory error of 51 x 10{sup -11} is reduced to 30 x 10{sup -11} on the time scale of the completion of our experiment, a future {Delta}a{sub {mu}} comparison would have a combined uncertainty of {approx} 34 x 10{sup -11}, which will be a sensitive and complementary benchmark for proposed standard model extensions. The experimental data will also be used to improve the muon EDM limit by up to a factor of 100 and make a higher-precision test of Lorentz and CPT violation. We describe in this Proposal why the FNAL complex provides a uniquely ideal facility for a next-generation (g-2) experiment. The experiment is compatible with the fixed-target neutrino program; indeed, it requires only the unused Booster batch cycles and can acquire the desired statistics in less than two years of running. The proton beam preparations are largely aligned

  4. Effect of carbide precipitation on the corrosion behavior of Inconel alloy 690

    International Nuclear Information System (INIS)

    Sarver, J.M.; Crum, J.R.; Mankins, W.L.

    1987-01-01

    Intergranular carbide precipitation reactions have been shown to affect the stress corrosion cracking (SCC) resistance of nickel-chromium-iron alloys in environments relative to nuclear steam generators. Carbon solubility curves, time-temperature-sensitization plots and other carbide precipitation data are presented for alloy 690 as an aid in developing heat treatments for improved SCC resistance

  5. Corrosion fatigue cracking behavior of Inconel 690 (TT) in secondary water of pressurized water reactors

    International Nuclear Information System (INIS)

    Xiao Jun; Chen Luyao; Qiu Shaoyu; Chen Yong; Lin Zhenxia; Fu Zhenghong

    2015-01-01

    Inconel 690 (TT) is one of the key materials for tubes of steam generators for pressurized water reactors, where it is susceptible to corrosion fatigue cracking. In this paper, the corrosion fatigue cracking behavior of Inconel 690 (TT) was investigated under small scale yielding conditions, in the simulated secondary water of pressurized water reactor. It was observed that the fatigue crack growth rate was accelerated by a maximum factor up to 3 in the simulated secondary water, comparing to that in room temperature air. In addition, it was found that the accelerating effect was influenced by out-of-plane cracking of corrosion fatigue cracks and also correlated with stress intensity factor range, maximum stress intensity factor and stress ratio. (authors)

  6. 32 CFR 37.690 - How are nonprofit participants to manage real property and equipment?

    Science.gov (United States)

    2010-07-01

    ... SECRETARY OF DEFENSE DoD GRANT AND AGREEMENT REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems Property § 37.690 How are nonprofit... institution of higher education or in a nonprofit organization whose primary purpose is conducting scientific...

  7. Power combiners/dividers for loop pickup and kicker arrays for FNAL stochastic cooling rings

    International Nuclear Information System (INIS)

    Johnson, J.K.; Nemetz, R.

    1985-05-01

    The anti-proton accumulator and debuncher at FNAL will use stochastic methods to ''cool'' the beam. Pairs of quarter-wavelength directional-coupler loops are used to detect and kick the beam. The loops are copper plates which are flush with the upper and lower wall of a rectangular beam pipe. The plates, when surrounded by a properly sized pocket, form a 100-ohm transmission-line directional coupler. As the beam passes, a signal which gives position and time information, is induced in the plates. But, because the signal levels are low (<.5 picowatts per pair), a power combiner (usually several primary combiners feeding a secondary combiner) is used to combine the outputs of many loops. Subsequently, the combined signal is amplified, filtered and then fed into a divider, (that is, a combiner operating in reverse). The divider distributes the signal into a different set of loops which modify (kick) the beam's position. Since the loop couplers are arranged linearly, in arrays of various lengths, combiners also provide a convenient method of reducing the number of vacuum feedthroughs and preamplifiers and their related costs in performance and dollars. In this note we describe various stripline combiner systems that add the outputs of 4, 8, 16 or 32 loops

  8. High power diode lasers emitting from 639 nm to 690 nm

    Science.gov (United States)

    Bao, L.; Grimshaw, M.; DeVito, M.; Kanskar, M.; Dong, W.; Guan, X.; Zhang, S.; Patterson, J.; Dickerson, P.; Kennedy, K.; Li, S.; Haden, J.; Martinsen, R.

    2014-03-01

    There is increasing market demand for high power reliable red lasers for display and cinema applications. Due to the fundamental material system limit at this wavelength range, red diode lasers have lower efficiency and are more temperature sensitive, compared to 790-980 nm diode lasers. In terms of reliability, red lasers are also more sensitive to catastrophic optical mirror damage (COMD) due to the higher photon energy. Thus developing higher power-reliable red lasers is very challenging. This paper will present nLIGHT's released red products from 639 nm to 690nm, with established high performance and long-term reliability. These single emitter diode lasers can work as stand-alone singleemitter units or efficiently integrate into our compact, passively-cooled Pearl™ fiber-coupled module architectures for higher output power and improved reliability. In order to further improve power and reliability, new chip optimizations have been focused on improving epitaxial design/growth, chip configuration/processing and optical facet passivation. Initial optimization has demonstrated promising results for 639 nm diode lasers to be reliably rated at 1.5 W and 690nm diode lasers to be reliably rated at 4.0 W. Accelerated life-test has started and further design optimization are underway.

  9. Effect of alloying elements on the stability of Ni2M in Alloy690 based upon thermodynamic calculation

    International Nuclear Information System (INIS)

    Horiuchi, Toshiaki; Kuwano, Kazuhiro; Satoh, Naohiro

    2012-01-01

    Some researchers recently point out that Ni based alloys used in nuclear power plants have the ordering tendency, which is a potential to decrease mechanical properties within the expected lifetime of the plants. In the present study, authors evaluated the effect of 8 alloying elements on the ordering tendency in Alloy690 based upon thermodynamic calculation by Thermo-Calc. It is clarified that the additive amount of Fe, Cr, Ti and Si, particularly Fe and Cr, was influential for the stability of Ni 2 M, while that of Mn, Cu, B and C had almost no effect for that. Authors therefore designed the Ni 2 M stabilized alloy by no addition of Fe in Alloy690. Ni 2 M is estimated to be stable even at 773 K in the Ni 2 M stabilized alloy. The influence by long range ordering or precipitating of Ni 2 M in Alloy690 for mechanical properties or SCC susceptibility is expected to be clarified by the sample obtained in the present study. (author)

  10. Compilation of current high energy physics experiments

    International Nuclear Information System (INIS)

    1978-09-01

    This compilation of current high-energy physics experiments is a collaborative effort of the Berkeley Particle Data Group, the SLAC library, and the nine participating laboratories: Argonne (ANL), Brookhaven (BNL), CERN, DESY, Fermilab (FNAL), KEK, Rutherford (RHEL), Serpukhov (SERP), and SLAC. Nominally, the compilation includes summaries of all high-energy physics experiments at the above laboratories that were approved (and not subsequently withdrawn) before about June 1978, and had not completed taking of data by 1 January 1975. The experimental summaries are supplemented with three indexes to the compilation, several vocabulary lists giving names or abbreviations used, and a short summary of the beams at each of the laboratories (except Rutherford). The summaries themselves are included on microfiche

  11. Microstructure Characterization of Fiber Laser Welds of S690QL High-Strength Steels

    Science.gov (United States)

    Li, Baoming; Xu, Peiquan; Lu, Fenggui; Gong, Hongying; Cui, Haichao; Liu, Chuangen

    2018-02-01

    The use of fiber laser welding to join S690QL steels has attracted interest in the field of construction and assembly. Herein, 13-mm-thick S690QL welded joints were obtained without filler materials using the fiber laser. The as-welded microstructures and the impact energies of the joints were characterized and measured using electron microscopy in conjunction with high-resolution transmission electron images, X-ray diffraction, and impact tests. The results indicated that a single-sided welding technique could be used to join S690QL steels up to a thickness of 12 mm (fail to fuse the joint in the root) when the laser power is equal to 12 kW (scan speed 1 m/min). Double-side welding technique allows better weld penetration and better control of heat distribution. Observation of the samples showed that the fusion zone exhibited bainitic and martensitic microstructures with increased amounts of martensites (Ms) compared with the base materials. Also, the grains in the fusion zone increased in coarseness as the heat input was increased. The fusion zone exhibited increased hardness (397 HV0.2) while exhibiting a simultaneous decrease in the impact toughness. The maximum impact energy value of 26 J was obtained from the single-side-welded sample, which is greater than those obtained from the double-side-welded samples (maximum of 18 J). Many more dislocations and plastic deformations were found in the fusion zone than the heat-affected zone in the joint, which hardened the joints and lowered the impact toughness. The microstructures characterized by FTEM-energy-dispersive X-ray spectrometer also exhibited laths of M, as well as stacking faults and dislocations featuring high-density, interfacial structure ledges that occur between the high-angle grain boundaries and the M and bainite.

  12. Thermal ageing and short-range ordering of Alloy 690 between 350 and 550 °C

    Energy Technology Data Exchange (ETDEWEB)

    Mouginot, Roman, E-mail: roman.mouginot@aalto.fi [Aalto University School of Engineering, Department of Mechanical Engineering, Otakaari 4, 02150 Espoo (Finland); Sarikka, Teemu [Aalto University School of Engineering, Department of Mechanical Engineering, Otakaari 4, 02150 Espoo (Finland); Heikkilä, Mikko [University of Helsinki, Laboratory of Inorganic Chemistry, A.I.Virtasen Aukio 1, 00560 Helsinki (Finland); Ivanchenko, Mykola; Ehrnstén, Ulla [VTT Technical Research Centre of Finland LTD, Kemistintie 3, 02150 Espoo (Finland); Kim, Young Suk; Kim, Sung Soo [Korea Atomic Energy Research Institute, Daedeok-Daero, 989-111, Yuseong, Daejeon, 34057 (Korea, Republic of); Hänninen, Hannu [Aalto University School of Engineering, Department of Mechanical Engineering, Otakaari 4, 02150 Espoo (Finland)

    2017-03-15

    Thermal ageing of Alloy 690 triggers an intergranular (IG) carbide precipitation and is known to promote an ordering reaction causing lattice contraction. It may affect the long-term primary water stress corrosion cracking (PWSCC) resistance of pressurized water reactor (PWR) components. Four conditions of Alloy 690 (solution annealed, cold-rolled and/or heat-treated) were aged between 350 and 550 °C for 10 000 h and characterized. Although no direct observation of ordering was made, variations in hardness and lattice parameter were attributed to the formation of short-range ordering (SRO) in all conditions with a peak level at 420 °C, consistent with the literature. Prior heat treatment induced ordering before thermal ageing. At higher temperatures, stress relaxation, recrystallization and α-Cr precipitation were observed in the cold-worked samples, while a disordering reaction was inferred in all samples based on a decrease in hardness. IG precipitation of M{sub 23}C{sub 6} carbides increased with increasing ageing temperature in all conditions, as well as diffusion-induced grain boundary migration (DIGM). - Highlights: • SRO was suggested in Alloy 690 with 9.18 wt% Fe after thermal ageing at 350, 420 and 475 °C. • Prior thermal treatment promoted SRO before ageing. • Cold work led to recrystallization and precipitation of α-Cr upon ageing at 550 °C. • Thermal ageing promoted IG precipitation of Cr-rich M{sub 23}C{sub 6} carbides and DIGM.

  13. Materials Reliability Program Resistance to Primary Water Stress Corrosion Cracking of Alloys 690, 52, and 152 in Pressurized Water Reactors (MRP-111)

    Energy Technology Data Exchange (ETDEWEB)

    Xu, H. [Framatome ANP, Inc., Lynchburg, VA (United States); Fyfitch, S. [Framatome ANP, Inc., Lynchburg, VA (United States); Scott, P. [Framatome ANP, SAS, Paris (France); Foucault, M. [Framatome ANP, SAS, Le Creusot (France); Kilian, R. [Framatome ANP, GmbH, Erlangen (Germany); Winters, M. [Framatome ANP, GmbH, Erlangen (Germany)

    2004-03-01

    Over the last thirty years, stress corrosion cracking in PWR primary water (PWSCC) has been observed in numerous Alloy 600 component items and associated welds, sometimes after relatively long incubation times. Repairs and replacements have generally utilized wrought Alloy 690 material and its compatible weld metals (Alloy 152 and Alloy 52), which have been shown to be very highly resistant to PWSCC in laboratory experiments and have been free from cracking in operating reactors over periods already up to nearly 15 years. It is nevertheless prudent for the PWR industry to attempt to quantify the longevity of these materials with respect to aging degradation by corrosion in order to provide a sound technical basis for the development of future inspection requirements for repaired or replaced component items. This document first reviews numerous laboratory tests, conducted over the last two decades, that were performed with wrought Alloy 690 and Alloy 52 or Alloy 152 weld materials under various test conditions pertinent to corrosion resistance in PWR environments. The main focus of the present review is on PWSCC, but secondary-side conditions are also briefly considered.

  14. Materials Reliability Program Resistance to Primary Water Stress Corrosion Cracking of Alloys 690, 52, and 152 in Pressurized Water Reactors (MRP-111)

    International Nuclear Information System (INIS)

    Xu, H.; Fyfitch, S.; Scott, P.; Foucault, M.; Kilian, R.; Winters, M.

    2004-01-01

    Over the last thirty years, stress corrosion cracking in PWR primary water (PWSCC) has been observed in numerous Alloy 600 component items and associated welds, sometimes after relatively long incubation times. Repairs and replacements have generally utilized wrought Alloy 690 material and its compatible weld metals (Alloy 152 and Alloy 52), which have been shown to be very highly resistant to PWSCC in laboratory experiments and have been free from cracking in operating reactors over periods already up to nearly 15 years. It is nevertheless prudent for the PWR industry to attempt to quantify the longevity of these materials with respect to aging degradation by corrosion in order to provide a sound technical basis for the development of future inspection requirements for repaired or replaced component items. This document first reviews numerous laboratory tests, conducted over the last two decades, that were performed with wrought Alloy 690 and Alloy 52 or Alloy 152 weld materials under various test conditions pertinent to corrosion resistance in PWR environments. The main focus of the present review is on PWSCC, but secondary-side conditions are also briefly considered

  15. Progress status for the Mu2e calorimeter system

    International Nuclear Information System (INIS)

    Pezzullo, Gianantonio; Cervelli, F; Budagov, J; Davydov, Yu; Glagolev, V; Carosi, R; Cheng, C; Echenard, B; Hitlin, D; Martini, M; Ongmonkolkul, P; Porter, F; Cordelli, M; Corradi, G; Giovannella, S; Happacher, F; Luca, A; Miscetti, S; Saputi, A; Murat, P

    2015-01-01

    The Mu2e experiment at FNAL aims to measure the charged-lepton flavor violating neutrinoless conversion of a negative muon into an electron. The conversion results in a monochromatic electron with an energy slightly below the muon rest mass (104.97 MeV). The calorimeter should confirm that the candidates reconstructed by the extremely precise tracker system are indeed conversion electrons while performing a powerful μ/e particle identification. Moreover, it should also provide a high level trigger for the experiment independently from the tracker system. The calorimeter should also be able to keep functionality in an environment where the background delivers a dose of ∼ 10 krad/year in the hottest area and to work in the presence of 1 T axial magnetic field. These requirements translate in the design of a calorimeter with large acceptance, good energy resolution O(5%) and a reasonable position (time) resolution of ∼ < 1 cm (<0.5ns). The baseline version of the calorimeter is composed by two disks of inner (outer) radius of 351 (660) mm filled by 1860 hexagonal BaF 2 crystals of 20 cm length. Each crystal is readout by two large area APD's. In this paper, we summarize the experimental tests done so far as well as the simulation studies in the Mu2e environment

  16. Influence of microstructure on grain boundary sliding of alloys 600 and 690

    International Nuclear Information System (INIS)

    Kergaravat, J.F.; Guetaz, L.; Baillin, X.; Robert, G.

    1995-01-01

    The influence of deformation and damage mechanisms, and more especially of the grain boundary sliding effect, on the stress corrosion of nickel base alloys used in nuclear industry (exchanger tubes), has been experimentally examined. The grain boundary sliding effect has been measured at 500 C and 320 C on several samples of alloy 690 and 600 (in the mill annealed and mill annealed heat treated conditions). (author). 4 figs., 1 tab

  17. J-resistance curves for Inconel 690 and Incoloy 800 nuclear steam generators tubes at room temperature and at 300 °C

    Energy Technology Data Exchange (ETDEWEB)

    Bergant, Marcos A., E-mail: marcos.bergant@cab.cnea.gov.ar [Gerencia CAREM, Centro Atómico Bariloche (CNEA), Av. Bustillo 9500, San Carlos de Bariloche 8400 (Argentina); Yawny, Alejandro A., E-mail: yawny@cab.cnea.gov.ar [División Física de Metales, Centro Atómico Bariloche (CNEA) / CONICET, Av. Bustillo 9500, San Carlos de Bariloche 8400 (Argentina); Perez Ipiña, Juan E., E-mail: juan.perezipina@fain.uncoma.edu.ar [Grupo Mecánica de Fractura, Universidad Nacional del Comahue / CONICET, Buenos Aires 1400, Neuquén 8300 (Argentina)

    2017-04-01

    The structural integrity of steam generator tubes is a relevant issue concerning nuclear plant safety. In the present work, J-resistance curves of Inconel 690 and Incoloy 800 nuclear steam generator tubes with circumferential and longitudinal through wall cracks were obtained at room temperature and 300 °C using recently developed non-standard specimens' geometries. It was found that Incoloy 800 tubes exhibited higher J-resistance curves than Inconel 690 for both crack orientations. For both materials, circumferential cracks resulted into higher fracture resistance than longitudinal cracks, indicating a certain degree of texture anisotropy introduced by the tube fabrication process. From a practical point of view, temperature effects have found to be negligible in all cases. The results obtained in the present work provide a general framework for further application to structural integrity assessments of cracked tubes in a variety of nuclear steam generator designs. - Highlights: •Non-standard fracture specimens were obtained from nuclear steam generator tubes. •Specimens with circumferential and longitudinal through-wall cracks were used. •Inconel 690 and Incoloy 800 steam generator tubes were tested at 24 and 300 °C. •Fracture toughness for circumferential cracks was higher than for longitudinal cracks. •Incoloy 800 showed higher fracture toughness than Inconel 690 steam generator tubes.

  18. A search for sterile neutrinos at the MINOS experiment

    Energy Technology Data Exchange (ETDEWEB)

    Pittam, Robert Neil [Univ. of Oxford (United Kingdom)

    2010-01-01

    MINOS is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory in Illinois, USA. The experiment was designed to study neutrino oscillation phenomena. The vμ beam produced by the NuMI beam facility at FNAL is used along with two functionally identical detectors. The Near Detector at FNAL and a Far Detector 735 km away in the Soudan Underground Laboratory in northern Minnesota. Comparison of the observed spectra of neutrinos at the two detectors provides the evidence for neutrino oscillations. This thesis presents work on the postulated phenomena of sterile neutrinos. Oscillations between active and sterile neutrinos will lead to a deficit in the expected rate of measured Neutral Current interactions at the Far Detector. A technique for selecting Neutral Current events utilizing an Artificial Neural Network is presented with resulting overall efficiency of 91.1% and purity of 66.0%. A method of predicting the expected Charged and Neutral Current energy spectra at the Far Detector given the data recorded at the Near Detector is presented. A model to search for oscillations between sterile and active neutrinos is developed. Sources of systematic uncertainty that can effect the results of the analysis are discussed. The analysis developed is applied to a Standard Model 3 flavour oscillation model as a cross check under the scenarios with and without ve appearance. The oscillation parameters measured by this model are Δm322 = (2.39-0.15+0.23) x 10-3 eV2 and θ23 = 0.727-0.11+0.22 for the no ve appearance result. An analysis of the resulting prediction reveals no evidence for active neutrino disappearance. The analysis is then performed using the 4 flavour neutrino oscillation model developed. Again this is done under the 2 scenarios of ve appearance and no ve appearance

  19. The NESSiE way to searches for sterile neutrinos at FNAL

    OpenAIRE

    Stanco, L.; Bagulya, A.; Benettoni, M.; Bernardini, P.; Brugnera, R.; Calabrese, M.; Cecchetti, A.; Cecchini, S.; Chernyavskiy, M.; Creti, P.; Dal Corso, F.; Dalkarov, O.; Del Prete, A.; De Robertis, G.; De Serio, M.

    2014-01-01

    Neutrino physics is nowadays receiving more and more attention as a possible source of information for the long-standing problem of new physics beyond the Standard Model. The recent measurement of the mixing angle $\\theta_{13}$ in the standard mixing oscillation scenario encourages us to pursue the still missing results on leptonic CP violation and absolute neutrino masses. However, puzzling measurements exist that deserve an exhaustive evaluation. The NESSiE Collaboration has been setup to u...

  20. The synergy of corrosion and fretting wear process on Inconel 690 in the high temperature high pressure water environment

    Science.gov (United States)

    Wang, Zihao; Xu, Jian; Li, Jie; Xin, Long; Lu, Yonghao; Shoji, Tetsuo; Takeda, Yoichi; Otsuka, Yuichi; Mutoh, Yoshiharu

    2018-04-01

    The synergistic effect of corrosion and fretting process of the steam generator (SG) tube was investigated by using a self-designed high temperature test rig in this paper. The experiments were performed at 100°C , 200°C and 288°C , respectively. The fretting corrosion damage was studied by optical microscopy (OM), scanning electron microscope (SEM), energy dispersive spectrometer (EDS), Raman spectroscopy and auger electron spectroscopy (AES). The results demonstrated that the corrosion process in high temperature high pressure (HTHP) water environment had a distinct interaction with the fretting process of Inconel 690. With the increment of temperature, the damage mechanism changed from a simple mechanical process to a mechanochemical process.

  1. Compilation of current high energy physics experiments - Sept. 1978

    Energy Technology Data Exchange (ETDEWEB)

    Addis, L.; Odian, A.; Row, G. M.; Ward, C. E. W.; Wanderer, P.; Armenteros, R.; Joos, P.; Groves, T. H.; Oyanagi, Y.; Arnison, G. T. J.; Antipov, Yu; Barinov, N.

    1978-09-01

    This compilation of current high-energy physics experiments is a collaborative effort of the Berkeley Particle Data Group, the SLAC library, and the nine participating laboratories: Argonne (ANL), Brookhaven (BNL), CERN, DESY, Fermilab (FNAL), KEK, Rutherford (RHEL), Serpukhov (SERP), and SLAC. Nominally, the compilation includes summaries of all high-energy physics experiments at the above laboratories that were approved (and not subsequently withdrawn) before about June 1978, and had not completed taking of data by 1 January 1975. The experimental summaries are supplemented with three indexes to the compilation, several vocabulary lists giving names or abbreviations used, and a short summary of the beams at each of the laboratories (except Rutherford). The summaries themselves are included on microfiche. (RWR)

  2. Effect of variable load on crack initiation microalloyed steel S 690-QL

    Directory of Open Access Journals (Sweden)

    M. Burzić

    2015-01-01

    Full Text Available The accumulation of damage in the form of initiation and growth of micro-cracks is the first stage of destruction that ends when the merger microcracks form macro cracks. Cracks formed in the cycle number N =104 - 105 are the result of low cycle fatigue. From the need to evaluate low cycle fatigue life was carried out to investigate the low cycle fatigue microalloyed high-strength steel S690QL in the heat-treated.

  3. Partially-reflected water-moderated square-piteched U(6.90)O2 fuel rod lattices with 0.67 fuel to water volume ratio (0.800 CM Pitch)

    Energy Technology Data Exchange (ETDEWEB)

    Harms, Gary A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-09-01

    The US Department of Energy (DOE) Nuclear Energy Research Initiative funded the design and construction of the Seven Percent Critical Experiment (7uPCX) at Sandia National Laboratories. The start-up of the experiment facility and the execution of the experiments described here were funded by the DOE Nuclear Criticality Safety Program. The 7uPCX is designed to investigate critical systems with fuel for light water reactors in the enrichment range above 5% 235U. The 7uPCX assembly is a water-moderated and -reflected array of aluminum-clad square-pitched U(6.90%)O2 fuel rods.

  4. PARTICIPATION IN HIGH ENERGY PHYSICS

    Energy Technology Data Exchange (ETDEWEB)

    White, Christopher

    2012-12-20

    This grant funded experimental and theoretical activities in elementary particles physics at the Illinois Institute of Technology (IIT). The experiments in which IIT faculty collaborated included the Daya Bay Reactor Neutrino Experiment, the MINOS experiment, the Double Chooz experiment, and FNAL E871 - HyperCP experiment. Funds were used to support summer salary for faculty, salary for postdocs, and general support for graduate and undergraduate students. Funds were also used for travel expenses related to these projects and general supplies.

  5. Structural, mechanical and tribocorrosion behaviour in artificial seawater of CrN/AlN nano-multilayer coatings on F690 steel substrates

    Science.gov (United States)

    Ma, Fuliang; Li, Jinlong; Zeng, Zhixiang; Gao, Yimin

    2018-01-01

    The CrN monolayer and CrN/AlN nano-multilayer coating were successfully fabricated by reactive magnetron sputtering on F690 steel. The results show that CrN monolayer exhibits a face centered cubic crystalline structure with (111) preferred orientation and CrN/AlN nano-multilayer coating has a (200) preferred orientation. This design of the nano-multilayer can interrupt the continuous growth of columnar crystals making the coating denser. The CrN/AlN nano-multilayer coating has a better wear resistance and corrosion resistance compared with the CrN monolayer coating. The tribocorrosion tests reveal that the evolution of potential and current density of F690 steel and CrN monolayer or CrN/AlN nano-multilayer coating see an opposite trend under the simultaneous action of wear and corrosion, which is attributed to that F690 steel is a non-passive material and PVD coatings is a passive material. The nano-multilayer structure has a good ;Pore Sealing Effect;, and the corrosive solution is difficult to pass through the coating to corrode the substrate.

  6. Influence of hydrogen on crack growth rate of alloy 690 CW in PWR conditions

    International Nuclear Information System (INIS)

    Garcia Redondo, M.S.; Perosanz, F.J.; Lapena, J.; Gomez-Briceno, D.

    2015-01-01

    The influence of hydrogen concentration is well established for Alloy 600 and other nickel base alloys as Alloy 182/ 82 weld metals and X-750. It is accepted that for these materials maximum crack growth rate peaks close to Ni/NiO phase boundary. The influence of the hydrogen on the CGR of Alloy 690 is not well established. Available results for Alloy 690 are scarce and not conclusive. Results obtained by CIEMAT, in conditions representative of the PWR operating plants, indicated an apparent crack growth rate increase by a 3 factor when the hydrogen concentration increased from 35 to 81 cm -3 of H 2 /kg H 2 O. In order to gain some insight into the influence of the hydrogen, a new test has been performed with 20 cm -3 H 2 /kg H 2 O at 360 Celsius degrees, concentration close to Ni/NiO phase boundary. The material used was extruded control rod drive mechanism (CRDM) tubes with homogeneous microstructure. Rolling and tensile straining was applied to the CRDM material to obtain 20% of cold work in order to simulate the strain condition expected in the Heat Affected Zone (HAZ). (authors)

  7. Influence of microstructure on stress corrosion cracking susceptibility of alloys 600 and 690 in primary water of pressurized water reactors

    International Nuclear Information System (INIS)

    Kergaravat, J.F.

    1996-01-01

    The mechanism(s) responsible for the stress corrosion cracking (SCC) of Alloy 600 steam generator tubes of pressurized water reactors remain misunderstood in spite of numerous studies on the subject. This failure mode presents several experimental similarities with intergranular creep fracture of austenitic stainless steels. As far as intergranular creep fracture is concerned, grain boundary sliding (GBS) was proved to favor failure. The aim of this work is to check the role played by GBS during SCC. It takes into account chemical (chromium content) and microstructural parameters (grain size, precipitation distribution and density). Therefore, to get a complete set of micro-structurally different samples, we have prepared solution annealed specimens (1100 deg C, 20 min., water quenched) from industrial tubes of Alloys 600 and 690. Each specimen was crept at 500 deg C (400 MPa), 430 deg C (425 MPa) and 360 deg C (475 MPa). Before testing, every sample were engraved with a 7 μm wide fiducial grid. This grid has allowed us to measure GBS after creep testing. GBS was observed for industrial and solution annealed samples for the three testing temperatures. GBS amplitude depends'on chromium content: for micro-structurally identical specimens, Alloy 600 exhibits more GB strain than Alloy 690. It also strongly depends on grain boundary precipitation characteristics: carbide free boundaries slide more easily. During in situ straining experiments performed in a transmission electronic microscope, GBS was evidenced at 320 deg C for Alloy 600 industrial samples. It consists in grain boundary dislocation motion in the interface plane. These dislocations originate from perfect dislocations gliding in the grain interior, encountering grain boundary and spreading in it. Metallic intergranular carbides provide strong obstacles to GBS so stress enhancements arise against them. These stress enhancements are released by micro-twin emission. Constant extension rate tensile tests were

  8. Corrosion of Alloy 690 process pot by sulfate containing high level radioactive waste at feed stage

    International Nuclear Information System (INIS)

    Sengupta, P.; Soudamini, N.; Kaushik, C.P.; Jagannath; Mishra, R.K.; Kale, G.B.; Raj, K.; Das, D.; Sharma, B.P.

    2008-01-01

    Prolonged exposure of Alloy 690 process pot to sulfate containing high level radioactive waste leads to (a) depletion of Cr from the alloy, (b) intergranular attack and (c) building up of Cr 2 O 3 -Ni 2 O 3 -Fe 2 O 3 mixed oxide surface layer containing Na and Cs sulfate precipitates. Time dependence of material loss from Alloy 690 is found to follow a linear relationship of the type Δw (material loss) = -7.05 + 0.05t. Corrosion rate calculated for 2400 h exposure is 3.66 mpy. Cr and Ni leach rates obtained for the same sample are 1.61 g m -2 d -1 and 2.52 g m -2 d -1 , respectively. Ni leach rates followed a linear time dependence relationship of the type dNL Ni /dt (leach rate) = -0.09 + 0.027t, whereas Cr leach rates obeyed a non-linear relationship of the type dNL Cr /dt (leach rate) = 0.241 + 0.027t - 1.33 x 10 -4 t 1/2

  9. The fabric for frontier experiments project at Fermilab

    International Nuclear Information System (INIS)

    Kirby, Michael

    2014-01-01

    The FabrIc for Frontier Experiments (FIFE) project is a new, far-reaching initiative within the Fermilab Scientific Computing Division to drive the future of computing services for experiments at FNAL and elsewhere. It is a collaborative effort between computing professionals and experiment scientists to produce an end-to-end, fully integrated set of services for computing on the grid and clouds, managing data, accessing databases, and collaborating within experiments. FIFE includes 1) easy to use job submission services for processing physics tasks on the Open Science Grid and elsewhere; 2) an extensive data management system for managing local and remote caches, cataloging, querying, moving, and tracking the use of data; 3) custom and generic database applications for calibrations, beam information, and other purposes; 4) collaboration tools including an electronic log book, speakers bureau database, and experiment membership database. All of these aspects will be discussed in detail. FIFE sets the direction of computing at Fermilab experiments now and in the future, and therefore is a major driver in the design of computing services worldwide.

  10. Shielding experiments by the JASMIN collaboration at Fermilab (II) - Radioactivity measurement induced by secondary particles from the anti-proton production target

    Energy Technology Data Exchange (ETDEWEB)

    Yashima, Hiroshi; /Kyoto U., KURRI; Matsuda, Norihiro; Kasugai, Yoshimi; /JAEA, Ibaraki; Matsumura, Hiroshi; Iwase, Hiroshi; /KEK, Tsukuba; Kinoshita, Norikazu; /KEK, Tsukuba /Tsukuba U.; Boehnlein, David; Lauten, Gary; Leveling, Anthony; Mokhov, Nikolai; Vaziri, Kamran; /Fermilab /Shimizu, Tokyo /JAEA, Ibaraki

    2011-01-01

    The JASMIN Collaboration has performed an experiment to conduct measurements of nuclear reaction rates around the anti-proton production (Pbar) target at the Fermi National Accelerator Laboratory (FNAL). At the Pbar target station, the target, consisting an Inconel 600 cylinder, was irradiated by a 120 GeV/c proton beam from the FNAL Main Injector. The beam intensity was 3.6 x 10{sub 12} protons per second. Samples of Al, Nb, Cu, and Au were placed near the target to investigate the spatial and energy distribution of secondary particles emitted from it. After irradiation, the induced activities of the samples were measured by studying their gamma ray spectra using HPGe detectors. The production rates of 30 nuclides induced in Al, Nb, Cu, Au samples were obtained. These rates increase for samples placed in a forward (small angle) position relative to the target. The angular dependence of these reaction rates becomes larger for increasing threshold energy. These experimental results are compared with Monte Carlo calculations. The calculated results generally agree with the experimental results to within a factor of 2 to 3.

  11. A straw chambers' tracker for the high rate experiment 835 at the Fermilab accumulator

    Science.gov (United States)

    Bagnasco, S.; Dughera, G.; Giraudo, G.; Govi, G.; Marchetto, F.; Menichetti, E.; Pastrone, N.; Rumerio, P.; Trapani, P. P.

    1998-02-01

    Two layers of proportional drift tubes (aluminum mylar straws) are staggered in two cylindrical light chambers to measure charged particles' azimuthal angle. To stand the high rates (˜10 kHz/ cm2) and minimize the pile-up of the high luminosity experiment 835 at FNAL, a fast ASIC Amplifier-Shaper-Discriminator (ASD-8B) was chosen. The front-end electronics, designed exclusively with SMD components, was mounted on the downstream end plug of each chamber to avoid oscillations and noise. Design, construction and operational performances of these detectors are presented.

  12. Research program in experimental high energy physics, Task B

    International Nuclear Information System (INIS)

    Widgoff, M.

    1990-01-01

    Two prototype tracking system modules of the LVD detector have been produced by the direct-mount method and tested. The direct-mount procedure was proposed by a subgroup (mainly US) of the LVD Collaboration. This method has the advantages over the previous (hood) design of greater signal-to-noise ratio, of providing spacing between the two streamer chamber layers of each tracking plane to improve track reconstruction and angular resoluation, economy and speed of production. The tests have shown very satisfactory performance, both of the mechanical aspects and of the read-out electronic which are principally Brown's responsibility. The Collaboration has agreed to proceed with production by this method. The full boot node data acquisition computer and one tower microvax, both provided by the Brown group, have been installed Hall A of Gran Sasso, where data acquisition development will proceed. FNAL Experiment E782, a study of the interactions of muons from the Tevatron, using an upgraded version of the E745 hybrid system, is now running at Fermilab. During the past year, film analysis of the 1987 run of E745, a study of the interactions of muon neutrinos, was essentially completed and a data summary tape is being produced. Also during the past year, analysis has continued both on the data of our experiments on interactions of hadrons with protons and heavier nuclei (FNAL E565, E570, E299, E154) and on the data of SLAC experiments BC72/73/75, studying the interactions in hydrogen of 20GeV/c photons

  13. Long-baseline neutrino oscillation experiments

    International Nuclear Information System (INIS)

    Crane, D.; Goodman, M.

    1994-01-01

    There is no unambiguous definition for long baseline neutrino oscillation experiments. The term is generally used for accelerator neutrino oscillation experiments which are sensitive to Δm 2 2 , and for which the detector is not on the accelerator site. The Snowmass N2L working group met to discuss the issues facing such experiments. The Fermilab Program Advisory Committee adopted several recommendations concerning the Fermilab neutrino program at their Aspen meeting immediately prior to the Snowmass Workshop. This heightened the attention for the proposals to use Fermilab for a long-baseline neutrino experiment at the workshop. The plan for a neutrino oscillation program at Brookhaven was also thoroughly discussed. Opportunities at CERN were considered, particularly the use of detectors at the Gran Sasso laboratory. The idea to build a neutrino beam from KEK towards Superkamiokande was not discussed at the Snowmass meeting, but there has been considerable development of this idea since then. Brookhaven and KEK would use low energy neutrino beams, while FNAL and CERN would plan have medium energy beams. This report will summarize a few topics common to LBL proposals and attempt to give a snapshot of where things stand in this fast developing field

  14. Exploring non standard physics in long-baseline neutrino oscillation experiments

    International Nuclear Information System (INIS)

    Chatterjee, Sabya Sachi

    2015-01-01

    After the recent discovery of large th ( 13), the focus has been shifted to address the remaining fundamental issues like neutrino mass ordering and CP-violation in leptonic sector. Future proposed Long-Baseline facilities like DUNE (1300 km baseline from FNAL to Homestake) and LBNO (2290 km baseline from CERN to Pyhasalmi) are well suited to address these issues at high confidence level. Not only to the standard framework, these experiments are highly capable to look for some new physics beyond the Standard Model scenario. In this work, we explore whether these high precision future facilities are sensitive to new U(1) global symmetries and upto which confidence level. (author)

  15. Updating the orbital ephemeris of the dipping source XB 1254-690 and the distance to the source

    Science.gov (United States)

    Gambino, Angelo F.; Iaria, Rosario; Di Salvo, Tiziana; Matranga, Marco; Burderi, Luciano; Pintore, Fabio; Riggio, Alessandro; Sanna, Andrea

    2017-09-01

    XB 1254-690 is a dipping low mass X-ray binary system hosting a neutron star and showing type I X-ray bursts. We aim at obtaining a more accurate orbital ephemeris and at constraining the orbital period derivative of the system for the first time. In addition, we want to better constrain the distance to the source in order to locate the system in a well defined evolutive scenario. We apply, for the first time, an orbital timing technique to XB 1254-690, using the arrival times of the dips present in the light curves that have been collected during 26 yr of X-ray pointed observations acquired from different space missions. We estimate the dip arrival times using a statistical method that weights the count-rate inside the dip with respect to the level of persistent emission outside the dip. We fit the obtained delays as a function of the orbital cycles both with a linear and a quadratic function. We infer the orbital ephemeris of XB 1254-690, improving the accuracy of the orbital period with respect to previous estimates. We infer a mass of M 2 = 0.42 ± 0.04 M ʘ for the donor star, in agreement with estimations already present in literature, assuming that the star is in thermal equilibrium while it transfers part of its mass via the inner Lagrangian point, and assuming a neutron star mass of 1.4 M ʘ. Using these assumptions, we also constrain the distance to the source, finding a value of 7.6 ± 0.8 kpc. Finally, we discuss the evolution of the system, suggesting that it is compatible with a conservative mass transfer driven by magnetic braking.

  16. A comparing study of alloy 600 and alloy 690 on resistance to intergranular stress corrosion cracking(IGSCC)

    International Nuclear Information System (INIS)

    Lee, Jae Hun

    1993-02-01

    In order to compare the effect of senitization on the intergranular stress corrosion cracking(IGSCC) between Alloy 600 and Alloy 690, these alloys have been sensitized for 1 to 100 hours at 700 .deg. C. The degree of sensitization(DOS) has evaluated by the ratio of Ir(the maximum current density at anodic scan) to Ia(the maximum current density at reverse scan) in the modified double loop EPR(electrochemical potentiokinetic reactivation) test in 0.01M H 2 SO 4 + 0.0001M KSCN at 25 .deg. C and at scan rate of 0.5mV/sec. The susceptibility to IGSCC has been measured in 0.01M Na 2 S 4 O 6 solution using CERT(constant extension rate tester) at strain rate of 1.0 x 10 -6 S -1 . With increasing sensitization time the DOS of Alloy 600 increases to the maximum value at 5 hours and decreases gradually due to the replenishment of Cr to the Cr-depleted grain boundaries. For Alloy 600 samples except those sensitized for less than 1 hour, the DOS measured by the modified EPR test parallel to susceptibility to IGSCC revealed by the ratio of strain to failure (εf, Na 2 S 4 O 6 /εf, Air). It appears that the susceptibility to IGSCC is closely associated with the depth in Cr-depleted concentration profile across grain boundary. For the sensitized Alloy 690 samples exhibited extremely low value of Ir/Ia less than 0.074% and also were immune to IGSCC. The good resistance of Alloy 690 to IGSCC is considered to be attributed to the higher Cr concentration to avoid serious Cr-depletion problems adjacent to grain boundary

  17. What do passwords and toothbrushes have in common?

    CERN Multimedia

    Computer Security Team

    2011-01-01

    Your password is your entry token into the digital world. eBay, Amazon, Facebook, Twitter, FNAL, DESY, and CERN - all ask you for a password to authenticate and prove that you are you. And vice versa. If I know your password, I can impersonate you and use your money to buy from eBay or Amazon, post nasty messages on your Twitter or Facebook profile, or misuse CERN's/DESY's/FNAL's computing facilities in your name!   CERN accounts have been compromised in the past and misused to send spam across the world. Are you keen to delete tens of thousands of return e-mails from your mailbox? It's no fun. Would you give me your UBS bankcard and its PIN number? Of course not! Please apply the same sensitivity to your digital credentials, i.e. passwords, SSH keys, certificates, CERN card, etc. Beware of attempts to "steal" your password. CERN's computing staff, including the Computer Security Team, will never ask for your password (nor will any other legitimate person at Facebook, FNAL, eBay...

  18. Microstructure, mechanical properties and microtexture of friction stir welded S690QL high yield steel

    Energy Technology Data Exchange (ETDEWEB)

    Paillard, Pascal [Institut des Matériaux Jean Rouxel, UMR 6205, Polytech Nantes, Site de la Chantrerie, BP 50609, 44306 Nantes cedex 3 (France); Bertrand, Emmanuel, E-mail: emmanuel.bertrand@univ-nantes.fr [Institut des Matériaux Jean Rouxel, UMR 6205, Polytech Nantes, Site de la Chantrerie, BP 50609, 44306 Nantes cedex 3 (France); Allart, Marion; Benoit, Alexandre [Institut de Recherche Technologique Jules Verne, Chemin du Chaffault, 44340 Bouguenais (France); Ruckert, Guillaume [DCNS Research, Technocampus Ocean, 5 rue de l' Halbrane, 44340 Bouguenais (France)

    2016-12-15

    Two try-out campaigns of friction stir welding (FSW) were performed with different friction parameters to join S690QL high yield strength steel. The welds were investigated at macroscopic and microscopic scales using optical and electronic microscopy and microhardness mapping. Welds of the second campaign exhibit microstructures and mechanical properties in accordance with requirements for service use. Microtexture measurements were carried out in different zones of welds by electron backscattered diffraction (EBSD). It is shown that that texture of the bottom of the weld is similar to that of the base metal, suggesting a diffusion bonding mechanism. Finally, the mechanical properties (tensile strength, resilience, bending) were established on the most promising welds. It is shown that it is possible to weld this high yield strength steel using FSW process with satisfactory geometric, microstructural and mechanical properties. - Highlights: •1000 mm ∗ 400 mm ∗ 8 mm S690QL steel plates are joined by friction stir welding (FSW). •Maximum hardness is reduced by optimization of process parameters. •Various microstructures are formed but no martensite after process optimization. •Texture is modified in mechanically affected zones of the weld. •Texture in the bottom of the weld is preserved, suggesting diffusion bonding.

  19. e-Learning Continuance Intention: Moderating Effects of User e-Learning Experience

    Science.gov (United States)

    Lin, Kan-Min

    2011-01-01

    This study explores the determinants of the e-learning continuance intention of users with different levels of e-learning experience and examines the moderating effects of e-learning experience on the relationships among the determinants. The research hypotheses are empirically validated using the responses received from a survey of 256 users. The…

  20. Contribution of the low cycle fatigue on ultra high purity Ni-Cr-Fe alloys and on Ni monocrystals to the understanding of the hydrogen role in stress corrosion cracking for the alloys 600 and 690

    International Nuclear Information System (INIS)

    Renaudot, N.

    1999-06-01

    We discuss the role of hydrogen in cracking of Ni base alloys used for pressurised water reactor (PWR) primary tubes (alloy 600 and 690). Cracking can be explained by a Stress Corrosion Cracking (SCC) phenomenon. For this purpose, Low cycle fatigue (R = - 1) under cathodic charging at room temperature is conducted to study hydrogen effects on propagation of cracks mechanically initiated by the formation of Persistent Slip Bands (PSB). Low cycle fatigue on Ultra High Purity specimens (Ni, alloy 600 and 690) reveals the very important hydrogen effect on crack propagation rate, whatever the Cr content in the Ni base alloy. If Cr seems to have an effect over-hydrogen penetration in specimens (by a protective film formation), it have no beneficial effect when hydrogen have diffused ahead of a crack tip. Propagation rates (transgranular or intergranular) are highly increased, no matter of the absence of impurities like sulphur. Then, in PWR, the difference in the behaviour of alloy 600 and 690 could be due to a slower microcrack propagation rate for alloy 690. Protective films could play an important role in this difference, which is to study. Low cycle fatigue on Ni single crystals oriented for single slip shows, for the first time on bulk specimen, a macroscopic softening which can be explained. by hydrogen-dislocation interactions. Moreover, a simple quantitative model based on these interactions results in the same softening as the one observed experimentally. These results allow to validate experimentally one of the most important steps in the 'Corrosion Enhanced Plasticity (CEP) model', i.e. the softening ahead of a stress corrosion crack tip by hydrogen dislocation interactions. This is of importance because this model can explain cracking in numerous FCC materials-environment couple. (author)

  1. Remote Monitoring of the Polarized Target's Control for E1039

    Science.gov (United States)

    Fox, David; SeaQuest Collaboration

    2017-09-01

    The 1039 experiment at FNAL will further our understanding of spin structure by measuring the contribution that sea quarks orbital angular momentum provide to overall nucleon spin. It is accepted that the valence-quarks of nucleons only provide 30% of the total nucleon spin. To study the nucleon's sea quark contribution, E1039 will use the Drell-Yan process by colliding 120 GeV un-polarized beam protons with polarized ammonia targets of hydrogen and deuterium. The asymmetric spin distributions of resulting dimuons will be measured. These asymmetries are sensitive, among other effects, to the orbital angular momentum contribution of the sea quarks. The polarized target requires a multi-stage vacuum pump located near the target. Since access to its present controls will not be possible during running, remote control and monitoring upgrades were required. A secondary control panel was purchased and tested. Information from the programmable logic controller (PLC) must be fed into our data stream to enable remote monitoring and to signal possible alarm conditions. This solution and the program created using explicit TCP/IP messaging to extract data tags from the PLC and log it within our databases will be presented. Supported by U.S. D.O.E. Medium Energy Nuclear Physics under Grant DE-FG02-03ER41243.

  2. E-Learning Experiences of Hong Kong Students

    OpenAIRE

    J. Lam; R. Chan

    2013-01-01

    The adoption of e-learning in Hong Kong has been increasing rapidly in the past decade. To understand the e-learning experiences of the students, the School of Professional and Continuing Education of The University of Hong Kong conducted a survey. The survey aimed to collect students- experiences in using learning management system, their perceived e-learning advantages, barriers in e-learning and preferences in new e-learning development. A questionnaire with 84 questio...

  3. Secondary side IGA/IGSCC of SG alloys 600, 690 and 800 : R and D program in EDF Laboratories

    International Nuclear Information System (INIS)

    Vaillant, F.; DeBouvier, O.; Bouchacourt, M.; Stutzmann, A.; Lemaire, P.

    1998-01-01

    Many steam generators (SGs) equipped with 'mill-annealed' (MA) Alloy 600 tubings suffer significant secondary side corrosion. Until now, no degradation has been observed with either Alloy 600 TT or Alloy 690 for new SGs. The understanding of IGA/SCC of Alloy 600 MA in plants and the development of predictive models have become an important challenge to assess the life span and to reduce the maintenance costs of SGs. As degradation occurs in crevice environments which are varied and little known, EDF has undertaken an important program to improve the knowledge of crevice environments which lead to cracking. Corrosion tests are performed on Alloys 600 MA (also on 600 TT) in various environments in order to reproduce the deposits and the cracking observed on pulled tubes in laboratory conditions. Other corrosion tests are conducted in environments containing some pollutants identified by analyses of secondary water after hideout-return (sulfates) or oxidizing compounds : the influences of pH and potential are evaluated on Alloy 600 (MA or TT) and also on Alloys 690 and 800. A comprehensive model is proposed using IGA/SCC results of Alloy 600 in caustic environments. The thermomechanical parameters of the tubes and the field environmental conditions, introduced in the model, confirm some important features of SGs tubings. The model will be improved to include other detrimental environments. It will provide a useful tool to predict the life span (then steam generator replacements) and to optimize the maintenance policy of SGs still equipped with Alloys 600 MA and particularly with 600 TT (frequency and best locations of inspections). Margins will also be assessed for new SGs equipped with Alloy 690, and a comparison will be performed with Alloy 800. (author)

  4. Measurements of Neutrino Charged Current Interactions at SciBooNE

    Energy Technology Data Exchange (ETDEWEB)

    Nakajima, Yasuhiro [Department of Physics, Kyoto University, Kyoto 606-8502 (Japan)], E-mail: nakajima@scphys.kyoto-u.ac.jp

    2009-08-15

    The SciBooNE experiment (FNAL-E954) is designed to measure neutrino-nucleous cross sections in the one GeV region. Additionally, SciBooNE serves as a near detector for MiniBooNE by measuring the neutrino flux. In this paper, we describe two analyses using neutrino charged current interactions at SciBooNE: a neutrino spectrum measurement and a search for charged current coherent pion production.

  5. Precursor evolution and SCC initiation of cold-worked alloy 690 in simulated PWR primary water

    Energy Technology Data Exchange (ETDEWEB)

    Zhai, Ziqing; Kruska, Karen; Toloczko, Mychailo B.; Bruemmer, Stephen M.

    2017-03-27

    Stress corrosion crack initiation of two thermally-treated, cold-worked (CW) alloy 690 materials was investigated in 360oC simulated PWR primary water using constant load tensile (CLT) tests and blunt notch compact tension (BNCT) tests equipped with direct current potential drop (DCPD) for in-situ detection of cracking. SCC initiation was not detected by DCPD for the 21% and 31%CW CLT specimens loaded at their yield stress after ~9,220 h, however intergranular (IG) precursor damage and isolated surface cracks were observed on the specimens. The two 31%CW BNCT specimens loaded at moderate stress intensity after several cyclic loading ramps showed DCPD-indicated crack initiation after 10,400h exposure at constant stress intensity, which resulted from significant growth of IG cracks. The 21%CW BNCT specimens only exhibited isolated small IG surface cracks and showed no apparent DCPD change throughout the test. Interestingly, post-test cross-section examinations revealed many grain boundary (GB) nano-cavities in the bulk of all the CLT and BNCT specimens particularly for the 31%CW materials. Cavities were also found along GBs extending to the surface suggesting an important role in crack nucleation. This paper provides an overview of the evolution of GB cavities and will discuss their effects on crack initiation in CW alloy 690.

  6. PLUSS-A weldless leaktight sleeve for alloy 600/690 steam generator tubes

    International Nuclear Information System (INIS)

    Potz, F.; Bohmann, W.

    1998-01-01

    The ABB PLUSS sleeving represents a new SG tube repair technique qualified and approved to replace in the future most of the plugging as well as welded sleeving. Basically the advantages of an innovative combination of both alloys 600/690 and 800 are taken into consideration. The upper sleeve/SG tube-joint is hydraulically expanded stressing the SG tube only within the elastic range. The lower joint is hard rolled. The installation processes are simple and reproducible, fast, computerized and individually recorded. The operating temperature range of the sleeved SG-tube is effectively reduced so that any further corrosion is impeded. Both, sleeve and SG tube are fully inspectable by ECT. (author)

  7. Electronic Collaboration Logbook

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    At FNAL, we developed an Electronic Collaboration Logbook (ECL) application which is used by about 20 different collaborations, experiments and groups at FNAL. ECL is the latest iteration of the project formerly known as Control Room Logbook (CRL). We have been working on mobile (IOS and Android) clients for ECL. We will present history, current status and future plans of the project, as well as design, implementation and support solutions made by the project.

  8. Progress report of a research program in experimental high energy physics

    International Nuclear Information System (INIS)

    Widgoff, M.

    1991-01-01

    The LVD Collaboration has made major progress during the past year in constructing the basic modules of the detector and installing them in five-tower LVD structure. Each of these modules consists of a portatank containing eight liquid scintillation counters (each 1.0m x 1.0m x 1.5m, viewed by three photomultipliers) totalling 9.6 tons of liquid scintillator and 6.7 tons of steel. Each portatank is covered on its bottom and one side by two layers of limited streamer tubes which form the tracking system of the detector. About half of the first tower has now been installed and initial data-taking with the entire tower is expected to being during the Fall of 1991. Data acquisition hardware and software are in place for this. The data-taking run of FNAL Experiment E782, a study of the interactions of 200 GeV muons in a hybrid system with the Tohoku Freon bubble chamber as visible target, was completed in August 1990. Film analysis is now in progress. The results will be readily comparable to those obtained in FNAL Experiment E745, a study of the interactions of muon neutrinos in a similar system. The film analysis of E745 has been completed, and some preliminary results are presented on the production of strange particles, based on the combined data of both the 1985 and 1987 runs of this experiment

  9. Instrukce k citování literatury dostupné v prostředí WWW na vysokých školách v ČR. Analýza a hodnocení na základě standardu ČSN ISO 690 a ČSN ISO 690-2

    OpenAIRE

    Kubálková, Petra

    2006-01-01

    Bakalárská práce se zameruje na popis a utrídení textu instrukcí k citování literatury lokalizovaných na WWW serverech vysokých škol v CR. V úvodní cásti práce jsou strucne popsány pojmy informacní etika a citacní etika a vysvetlen vztah bibliografických citací k Autorskému zákonu Ceské republiky. Zvláštní pozornost je venována platným normám pro bibliografické citování (CSN ISO 690 a CSN ISO 690-2), které jsou podrobne analyzovány v druhé kapitole. Tretí kapitola nabízí rozbor reprezentantu ...

  10. Study of a transition radiation detector for the DO experiment at FNAL

    International Nuclear Information System (INIS)

    Feinstein, F.

    1988-06-01

    The DZero experiment will study proton-antiproton collisions at 1.8 TeV in the center of mass produced at Fermi National Accelerator Laboratory (USA). The main features of the detector are an excellent hermetical calorimeter and a very good identification of muons and electrons. The Transition Radiation Detector contributes to electron/jet discrimination. Transition radiation is emitted when a charge particle crosses the interface between two media of different refraction indices. A N foils radiator produces about N/137 soft X rays when the Lorentz factor gamma of the particle is greater than a threshold of the order of 1000. The radiated energy saturates when gamma goes to infinity. These properties allow to separate electrons from pions until 140 GeV. This study presents the results of a test on a 5 GeV electron and pion beam of a prototype of chamber and of three radiators made of lithium foils, polypropylene foils, and polyethylene fibers. The detector response to pions and electrons is compared to theoretical predictions. Different statistical methods of electron/pion separation are compared on the experimental data. A method has been performed using likelihood functions which obtains a pion rejection greater than 50 for an electron efficiency of 90%. The performances are compared to those of other TRDs [fr

  11. Optimal welding technology of high strength steel S690QL

    Directory of Open Access Journals (Sweden)

    Dusan Arsic

    2015-02-01

    Full Text Available In this paper is presented the detailed procedure for defining the optimal technology for welding the structures made of the high strength steel S690QL. That steel belongs into a group of steels with exceptional mechanical properties. The most prominent properties are the high tensile strength and impact toughness, at room and at elevated temperatures, as well. However, this steel has a negative characteristic - proneness to appearance of cold cracks.  That impedes welding and makes as an imperative to study different aspects of this steel's properties as well as those of eventual filler metal. Selection and defining of the optimal welding technology of this high strength steel is done for the purpose of preserving the favorable mechanical properties once the welded joint is realized; properties of the welded metal and the melting zone, as well as in the heat affected zone, which is the most critical zone of the welded joint.

  12. The corrosion rate measurement of Inconel 690 on high temperature and pressure by using CMS100

    International Nuclear Information System (INIS)

    Sriyono; Satmoko, Ari; Febrianto; Hidayati, N R; Arifal; Sumarno, Ady; Handoyo, Ismu; Prasetjo, Joko

    1999-01-01

    The corrosion rate measurement of Inconel 690 on high temperature and pressure had been done. By using an Autoclave, and temperature can be simulated. For reducing the pressure on Autoclave so its can be measure by Corrosion Measurement System 100(CMS100), the electrodes placement had designed and fabrication on the cover of Autoclave. The electrodes of CMS100 are reference electrode, working electrodes and counter electrodes. The electrodes placement are made and and designed on two packages, these are Salt bridge and Counter-specimen placement. From the result of testing these both of placement are able to 90 bar (pressure) and 280 C (temperature) operation rate measurement was done on temperature variation from 150 0C, 190 0C, 200 0C, 210 0C, 220 0C and 230 0C, and the solution is 0.1 ppm chloride. The pressure experiment is the pressure, which occurred in Autoclave. From the Tafel analysis, even through very little The corrosion current increased from 150 C to 230 C it is 2,54x10-10 a/cm2 to 1,62x10-9 A/cm2, but the the corrosion rate is still zero

  13. Effect of surface stress state on dissolution property of Alloy 690 in simulated primary water condition

    International Nuclear Information System (INIS)

    Kim, Kyung Mo; Shim, Hee-Sang; Lee, Eun Hee; Seo, Myung Ji; Han, Jung Ho; Hur, Do Haeng

    2014-01-01

    The dissolution control of nickel is important to reduce the radioactive dose rate and deterioration of fuel performance in the operation of nuclear power plants (PWR). The corrosion properties are affected by the metal surface residual stress introduced in manufacture process such as work hardening. This work studied the effect of surface modification on the release rate of Alloy 690, nickel-base alloy for a steam generator tube, in the test condition of simulated primary water chemistry in PWRs. The surface stress modification was applied by the electro-polishing and shot peening method. Shot peening process was applied using ceramic beads with different intensities through the variation of air pressure. The corrosion release tests performed at 330degC with LiOH 2 ppm and H 3 BO 4 1200 ppm, DH(dissolved hydrogen) 35 cc/kg (STP) and about 20 ppb of DO(dissolved oxygen) condition. The corrosion release rate was evaluated by a gravimetric analysis method and the surface analysed by SEM and optical microscope. The surface residual stress was measured by an X-ray diffractometer, and the distribution of stress state was evaluated by a micro-hardness tester. The metal ion release rate of alloy 690 was evaluated from the influence of the stress state on the metal surface. The oxide property and structure was affected by the residual stress in the oxide layer. (author)

  14. Las reglas angloamericanas de catalogación y la norma ISO 690 - 1 y 2

    OpenAIRE

    Campos Herrera, Airelys

    2007-01-01

    Se define la catalogación como etapa del ciclo de procesamiento de la información, así como sus diferencias con el proceso de descripción bibliográfica. Se comparan las reglas angloamericanas de catalogación, segunda edición, con las normas ISO 690 - 1 y 2 para la descripción bibliográfica con respecto a: organismo creador, finalidad, alcance, estructura, tipos de asientos, niveles de descripción y sintaxis. Cataloguing, a phase within the cycle of information processing, as well as its di...

  15. Influence of the S/N ratio on the corrosion release of Alloy 690 tubes in a primary coolant

    International Nuclear Information System (INIS)

    Shim, Hee-Sang; Choi, Myung Sik; Kim, Kyung Mo; Seo, Myung Ji; Hur, Do Haeng; Choi, Tack-Sang; Yoo, One

    2014-01-01

    Alloy 690TT is a promising steam generator (SG) tube material of a pressurized water reactor due to its excellent resistance to stress corrosion cracking (SCC) that has caused problems in Alloy 600 as an old SG tube material. The qualities of this material have been managed thoroughly from manufacturing step under various specification regulations as well as in in-service step. For examples, the surface roughness are prescribed as the values less than 1.6 μm for the tube outside and 0.5 μm for the inside, respectively. In addition, the surface state and defect must be qualified through the eddy current test (ECT) and the ultrasonic test (UT) according to the ASME Section III, NB2550. Then, the signal-to-noise (S/N) ratio, which is measured using ECT bobbin probe, is the important criteria to determine the material and it shall be 15 to 1 or higher at the standard frequency for any fixed 0.5 m length of any tube. The corrosion behaviours of the Alloy 690TT under high-temperature pressurized primary water have been studied widely in a point of the SCC but discussed narrowly in a point of the corrosion release. In particular, the effect of the S/N ratio on the corrosion release of this material surface has been rarely investigated. In this work, we evaluate the influence of the S/N ratio on the corrosion release of Alloy 690 SG tubes. The specimens with different S/N ratio were selected through ECT bobbin inspection and a corrosion release test was conducted using a simulated primary circulation loop. The material properties and oxidation behaviours were investigated by surface profiler, scanning electron microscopy, transmission electron microscopy, grazing incidence X-ray diffraction and etc. As a result, the corrosion rate was matched preferably with the MRPC characteristics showing macroscopic surface state rather than with the bobbin S/N ratio results. (author)

  16. On-line experience with the 168/E

    International Nuclear Information System (INIS)

    Carroll, J.T.; Brau, J.E.; Maruyama, T.; Parker, D.B.; Chima, J.S.; Price, D.R.; Rankin, P.; Hatley, R.W.

    1981-04-01

    Current 20 GeV/c photoproduction experiments at the SLAC Hybrid Facility require a decision to take a picture within 150 to 300 μs after the beam pulse. A charged track trigger is provided by a 168/E processor which finds tracks in a downstream PWC system. To meet trigger time requirements the 168/E SNOOP module CAMAC interface is augmented by a CAMAD Auxiliary Controller and dedicated I/0 cards in the 168/E chassis. Between beam pulses a floating point Fortran program executing on a 168/E monitors data acquisition. Experiences with software development and application are reviewed

  17. Role of hydrogen in the intergranular cracking mechanism by stress corrosion in primary medium of nickel based alloys 600 and 690

    International Nuclear Information System (INIS)

    Odemer, G.; Coudurier, A.; Jambon, F.; Chene, J.; Odemer, G.; Coudurier, A.; Chene, J.

    2007-01-01

    The aim of this work is to characterize the sensitivity to hydrogen embrittlement of alloys 600 and 690 in order to better understand the eventual role of hydrogen in the stress corrosion mechanism which affects these alloys when they are exposed in PWR primary medium. (O.M.)

  18. Nuclear dependence of Drell-Yan and J/ψ production in FNAL E866

    International Nuclear Information System (INIS)

    Tribble, R.E.; Beddo, M.E.; Brown, C.N.; Carey, T.A.; Chang, T.H.; Cooper, W.E.; Gagliardi, C.A.; Garvey, G.T.; Geesaman, D.F.; Hawker, E.A.; He, X.C.; Isenhower, L.D.; Kaufman, S.B.; Kaplan, D.M.; Koetke, D.D.; Lee, W.M.; Leitch, M.J.; McGaughey, P.L.; Moss, J.M.; Mueller, B.A.; Papavassiliou, V.; Peng, J.C.; Petitt, G.; Reimer, P.E.; Sadler, M.E.; Stankus, P.W.; Sondheim, W.E.; Towell, R.S.; Vasiliev, M.A.; Webb, J.C.; Willis, J.L.; Young, G.R.

    2000-01-01

    Fermilab E866 has measured the target-mass dependence of Drell-Yan and J/ψ dimuon production induced by an 800 GeV proton beam on targets of Be, Fe and W. Clear evidence of nuclear shadowing is observed in the Drell-Yan cross section ratios per nucleon at small x 2 . The x 1 dependence of the cross section ratios provides a determination of the energy loss of ultra-relativistic quarks as they pass through cold nuclei. Preliminary results for J/ψ yields show maximum cross section ratios that are slightly less than 1 at an x F value near 0.1. The yield on heavy targets is much more strongly suppressed relative to light targets at larger values of x F

  19. Tecnologia, experiência e memória

    Directory of Open Access Journals (Sweden)

    Aécio Amaral Jr

    2006-10-01

    Full Text Available O artigo investiga a estruturação de uma nova cultura de memória, a qual inverte a lógica metafísica com que se pensou a relação entre tecnologia e experiência nas ciências sociais. Com as recentes tecnologias da vida e da informação, a concepção do corpo humano como algo que se constitui à margem de um aparato tecnológico declina em credibilidade. Com isso, um dos principais projetos da metafísica ocidental, a saber, a estruturação de um campo de experiência e conhecimento livre de suportes técnicos, malogra em seu humanismo tecnofóbico. A partir de uma apreciação do conto Memento Mori, de Jonathan Nolan, e do filme Amnésia, de Christopher Nolan, analiso a relação entre memória e escritura, corpo e arquivo na contemporaneidade. O objetivo é perceber as tensões e oscilações implícitas na tentativa de instauração de uma mnemotécnica pretensamente pós-humana ou pós-orgânica. Palavras-chave: tecnologia; experiência; memória; humanismo; pós-humanismo.

  20. Mu2e, a coherent μ → e conversion experiment at Fermilab

    International Nuclear Information System (INIS)

    Brown, D. N.

    2012-01-01

    We describe a proposed experiment to search for Charged Lepton Flavor Violation (CLFV) using stopped muons at Fermilab. A primary Proton beam will strike a gold target, producing pions which decay to muons. Low-momentum negative muons will be collected, selected, and transported by a custom arrangement of solenoidal magnets and collimators. Muons will stop in thin foil targets, creating muonic atoms with significant nuclear overlap. Mu2e will search for the coherent conversion of nuclear bound muons to electrons, with an experimental signature of a single mono-energetic electron. Conversion electrons will be detected and measured in a low-mass straw tracker and a crystal calorimeter. Mu2e will have a sensitivity four orders of magnitude better than the most sensitive published result for μ → e conversion, and will have complementary physics reach to LHC experiments and μ → eγ decay experiments such as MEG.

  1. Making a Case for E - learning: Experiences in E-learning at ...

    African Journals Online (AJOL)

    Making a Case for E - learning: Experiences in E-learning at Langston University ... performances can surpass those of students in traditional learning settings. ... The research method was qualitative based mainly on participatory and ...

  2. Variations of microstructure and properties of 690 MPa grade low carbon bainitic steel after tempering

    Energy Technology Data Exchange (ETDEWEB)

    Feng, Rui [Key Laboratory for Liquid-Solid Structural Evolution and Processing of Materials, Ministry of Education, Shandong University, Jinan Shandong 250061 (China); School of Materials Science and Engineering, Shandong University, Jinan Shandong 250061 (China); Li, Shengli, E-mail: lishengli@sdu.edu.cn [Key Laboratory for Liquid-Solid Structural Evolution and Processing of Materials, Ministry of Education, Shandong University, Jinan Shandong 250061 (China); School of Materials Science and Engineering, Shandong University, Jinan Shandong 250061 (China); Li, Zhenshun; Tian, Lei [Key Laboratory for Liquid-Solid Structural Evolution and Processing of Materials, Ministry of Education, Shandong University, Jinan Shandong 250061 (China); School of Materials Science and Engineering, Shandong University, Jinan Shandong 250061 (China)

    2012-12-15

    The variations of microstructure, mechanical properties and electrical resistivity of 690 MPa grade low carbon bainitic steel tempered at different temperatures were investigated with Scanning Electron Microscopy (SEM), Transmission Electron Microscopy (TEM) and double-arm Bridge. The results show that the appearance of granular bainite, decomposition of retained austenite, variations of dislocation density and solid solution of microalloying elements are the main reasons for variations of mechanical properties and electrical resistivity. Electrical resistivity reflects the solution content of microalloying elements and variations of dislocation density, which can be used as a fast and effective way to analyze the microstructure of materials.

  3. BNL workshop on rare K decays and CP violation, August 25-27, 1988

    International Nuclear Information System (INIS)

    1988-10-01

    This report contains viewgraphs on the following topics: rare and forbidden K decays; CP violation in the K system; the status of current experiments at BNL, CERN, FNAL, and KEK; and future experiments and facilities

  4. Antropologia e filosofia: estética e experiência em Clifford Geertz e Walter Benjamin

    Directory of Open Access Journals (Sweden)

    Relivaldo Pinho de Oliveira

    2012-06-01

    Full Text Available Este artigo estuda as concepções de estética e experiência de Clifford Geertz e Walter Benjamin como possibilidades argumentativas e metodológicas para pensar a realidade e suas formas estéticas. Utiliza-se para isso as discussões metodológicas de Geertz, especialmente a respeito do lugar da estética e de sua relação com os demais âmbitos do humano, que encetaram uma nova forma de concebê-los para a etnografia e antropologia de modo geral, e os estudos de Benjamin a respeito da estética como expressão fisionômica de uma época, de determinada realidade, especialmente os que se referem sobre a modernidade. Constata-se essa possibilidade a partir da observação de que a estética e a experiência, nos autores, são tomadas como dimensões da realidade que se relacionam, não de modo mecânico, e sim como âmbitos que atravessam a realidade, os artefatos estéticos, os discursos, e esses assim devem ser observados.This article study the conceptions of aesthetics and experience of Clifford Geertz and Walter Benjamin as argumentative and methodological possibilities for thinking reality and its aesthetic forms. Uses for this Geertz's methodological discussions, especially regarding the place of aesthetics and its relation to other spheres of the human, which has embarked on a new way of conceiving them to ethnography and anthropology in general, and studies Benjamin about the aesthetics and physiognomical expression of an era, a certain reality, especially those concerning about modernity. There is that possibility from the observation that the aesthetics and experience, in the authors, are taken as the dimensions of reality are related, not mechanically, but as areas that cross the reality, the aesthetic artifacts, the speeches, and so these must be observed.

  5. Experience Effect in E-Learning Research

    Science.gov (United States)

    Wu, Bing; Xu, WenXia; Ge, Jun

    This study is a productivity review on the literature gleaned from SSCI, SCIE databases concerning experience in E-Learning research. The result indicates that the number of literature productions on experience effect in ELearning research is still growing from 2005. The main research development country is Croatia, and from the analysis of the publication year, the number of papers is increasing to the peaking in 2010. And the main source title is British Journal of Educational Technology. In addition the subject area concentrated on Education & Educational Research. Moreover the research focuses on are mainly survey research and empirical research, in order to explore experience effect in E-Learning research. Also the limitations and future research of these research were discussed, so that the direction for further research work can be exploited

  6. Particle searches in e+e- experiments at PEP and PETRA

    International Nuclear Information System (INIS)

    Lau, K.H.

    1982-10-01

    This talk reviews recent results in new particle searches performed by experiments at the high energy e + e - storage rings PEP and PETRA. It concentrates on recent searches for: hadrons with a new quark flavor, spin-1/2 charged heavy leptons, spin-0 charged leptons, spin-0 point-like scalars or pseudoscalars, and neutral heavy leptons

  7. Conectividade e Informação: Usabilidade e Mobilidade orientada para User Experience

    Directory of Open Access Journals (Sweden)

    Antonio Mendes Silva Filho

    2012-08-01

    Full Text Available Tempo é o bem mais precioso que todo ser humano pode possuir, inclusive para aqueles que pensam nada ter. Adicionalmente, o livre arbítrio de cada ser lhe permite escolher como utilizar esse bem precioso. O ser humano quando envolvido em atividades profissionais ou de lazer buscam otimizar o uso de tempo, que é propiciada pela facilidade através da qual ele(a consegue realizar a atividade. E, se para realizar a atividade, ele requer uso de tecnologias como computador, notebook, iGadgets (como, por exemplo, iPad, iPhone e iPod, TV, DVD player, dentre outros, essa facilidade é oferecida pela usabilidade do produto. Isso é determinante no momento que usuário vai escolher um produto. Preocupar-se com o usuário e prover ele com um produto que tem simplicidade, eficiência e elegância é prover suporte à experiência do usuário. Nesse sentido, este artigo explora e discute como a experiência do usuário (user experience e usabilidade impactam uso e adoção de novas tecnologias.

  8. Validation of the YuWell YE690A upper-arm blood pressure monitor, for clinic use and self-measurement, according to the European Society of Hypertension International Protocol revision 2010.

    Science.gov (United States)

    Chen, Qi; Lei, Lei; Li, Yan; Wang, Ji-Guang

    2017-10-01

    The present study aimed to evaluate the accuracy of the automated oscillometric upper-arm blood pressure monitor YuWell YE690A for blood pressure measurement according to the International Protocol of the European Society of Hypertension revision 2010. Systolic and diastolic blood pressures were measured sequentially in 33 adult Chinese (12 women, 44.2 years of mean age) using a mercury sphygmomanometer (two observers) and the YE690A device (one supervisor). A total of 99 pairs of comparisons were obtained from 33 participants for judgments in two parts with three grading phases. All the blood pressure requirements were fulfilled. The YuWell YE690A device achieved the targets in part 1 of the validation study. The number of absolute differences between device and observers within 5, 10, and 15 mmHg was 79/99, 96/99, and 97/99, respectively, for systolic blood pressure and 72/99, 95/99, and 98/99, respectively, for diastolic blood pressure. The device also fulfilled the criteria in part 2 of the validation study. Thirty-one and 25 participants for systolic and diastolic blood pressure, respectively, had at least two of the three device-observer differences within 5 mmHg (required ≥24). No participant for systolic and two participants for diastolic blood pressure had all the three device-observer comparisons greater than 5 mmHg. The YuWell blood pressure monitor YE690A has passed the requirements of the International Protocol revision 2010 and hence can be recommended for blood pressure measurement in adults.

  9. Complete (γ,2e) experiments at 0.1 eV above threshold

    International Nuclear Information System (INIS)

    Rond, F.; Mazeau, J.; Huetz, A.

    1999-01-01

    Here we report on a new experiment which has been designed to perform (γ,2e) experiments extremely close to threshold, in an energy range which is inaccessible to conventional electron analysers. The angular and energy resolutions of this new technique are illustrated by measuring electrons issued from resonant single ionization of argon. First results on double ionization of argon for the 3p 4 3 P e J=2 final state of Ar ++ are also presented. The contribution of an indirect process producing 20 meV Auger electrons, which was suspected from previous experiments, is clearly observed in addition to the direct process. (orig.)

  10. [Experimental and theoretical high energy physics program

    Energy Technology Data Exchange (ETDEWEB)

    Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.

    1993-04-01

    Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac{endash}Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e{sup +}e{sup {minus}} collisions at CERN; {bar p}{endash}p collisions at FNAL; accelerator physics at Fermilab; development work for the SDC detector at SSC; TOPAZ; D-zero physics; physics beyond the standard model; and the Collider Detector at Fermilab. (RWR)

  11. [Experimental and theoretical high energy physics program

    International Nuclear Information System (INIS)

    Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.

    1993-04-01

    Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac endash Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e + e - collisions at CERN; bar p endash p collisions at FNAL; accelerator physics at Fermilab; development work for the SDC detector at SSC; TOPAZ; D-zero physics; physics beyond the standard model; and the Collider Detector at Fermilab

  12. Λ(anti Λ) beams at FNAL

    International Nuclear Information System (INIS)

    Overseth, O.

    1977-01-01

    The discussion of the lambda anti lambda beams involves how to make polarized protons from lambda decay so that experiments on polarization at very high energies may be possible. The aspect studied is the amount of polarization and how to get it

  13. Observation of the rare {eta}{yields}e{sup +}e{sup -}e{sup +}e{sup -} decay with the KLOE experiment

    Energy Technology Data Exchange (ETDEWEB)

    Ambrosino, F. [Dipartimento di Scienze Fisiche dell' Universita ' Federico II' , Napoli (Italy); INFN Sezione di Napoli, Napoli (Italy); Antonelli, A.; Antonelli, M. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Archilli, F. [Dipartimento di Fisica dell' Universita ' Tor Vergata, Roma (Italy); INFN Sezione di Roma Tor Vergata, Roma (Italy); Balwierz, I. [Institute of Physics, Jagiellonian University, Krakow (Poland); Bencivenni, G. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Bini, C. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy); Bloise, C. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Bocchetta, S. [Dipartimento di Fisica dell' Universita ' Roma Tre' , Roma (Italy); INFN Sezione di Roma Tre, Roma (Italy); Bossi, F. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Branchini, P. [INFN Sezione di Roma Tre, Roma (Italy); Capon, G.; Capussela, T. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Ceradini, F. [Dipartimento di Fisica dell' Universita ' Roma Tre' , Roma (Italy); INFN Sezione di Roma Tre, Roma (Italy); Ciambrone, P.; Czerwinski, E.; De Lucia, E. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); De Santis, A. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy); De Simone, P. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); De Zorzi, G. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy)

    2011-08-26

    We report the first observation of the rare {eta}{yields}e{sup +}e{sup -}e{sup +}e{sup -}({gamma}) decay based on 1.7 fb{sup -1} collected by the KLOE experiment at the DA{Phi}NE {phi}-factory. The selection of the e{sup +}e{sup -}e{sup +}e{sup -} final state is fully inclusive of radiation. We have identified 362{+-}29 events resulting in a branching ratio of (2.4{+-}0.2{sub stat}+bckg{+-}0.1{sub syst})x10{sup -5}.

  14. Study of the decay D0 --> K+pi-.

    Science.gov (United States)

    Link, J M; Reyes, M; Yager, P M; Anjos, J C; Bediaga, I; Göbel, C; Magnin, J; Massafferi, A; de Miranda, J M; Pepe, I M; dos Reis, A C; Simão, F R; Carrillo, S; Casimiro, E; Sánchez-Hernández, A; Uribe, C; Vazquez, F; Cinquini, L; Cumalat, J P; O'Reilly, B; Ramirez, J E; Vaandering, E W; Butler, J N; Cheung, H W; Gaines, I; Garbincius, P H; Garren, L A; Gottschalk, E; Kasper, P H; Kreymer, A E; Kutschke, R; Bianco, S; Fabbri, F L; Sarwar, S; Zallo, A; Cawlfield, C; Kim, D Y; Rahimi, A; Wiss, J; Gardner, R; Chung, Y S; Kang, J S; Ko, B R; Kwak, J W; Lee, K B; Park, H; Alimonti, G; Boschini, M; Caccianiga, B; D'Angelo, P; DiCorato, M; Dini, P; Giammarchi, M; Inzani, P; Leveraro, F; Malvezzi, S; Menasce, D; Mezzadri, M; Milazzo, L; Moroni, L; Pedrini, D; Pontoglio, C; Prelz, F; Rovere, M; Sala, A; Sala, S; Davenport, T F; Agostino, L; Arena, V; Boca, G; Bonomi, G; Gianini, G; Liguori, G; Merlo, M; Pantea, D; Ratti, S P; Riccardi, C; Segoni, I; Viola, L; Vitulo, P; Hernandez, H; Lopez, A M; Mendez, H; Mendez, L; Mirles, A; Montiel, E; Olaya, D; Paris, A; Quinones, J; Rivera, C; Xiong, W; Zhang, Y; Wilson, J R; Cho, K; Handler, T; Engh, D; Hosack, M; Johns, W E; Nehring, M S; Sheldon, P D; Stenson, K; Webster, M S; Sheaff, M

    2001-04-02

    Using a large sample of photoproduced charm mesons from the FOCUS experiment at Fermilab (FNAL-E831), we observe the decay D0-->K+pi- with a signal yield of 149+/-31 events compared to a similarly cut sample consisting of 36 760+/-195 D0-->K-pi+ events. We use the observed ratio of D0-->K+pi- to D0-->K-pi+ (0.404+/-0.085+/-0.025)% to obtain a relationship between the D0 mixing and doubly Cabibbo suppressed decay parameters.

  15. Study of the Decay D0 --> K+π-

    Science.gov (United States)

    Link, J. M.; Reyes, M.; Yager, P. M.; Anjos, J. C.; Bediaga, I.; Göbel, C.; Magnin, J.; Massafferi, A.; de Miranda, J. M.; Pepe, I. M.; Dos Reis, A. C.; Simão, F. R.; Carrillo, S.; Casimiro, E.; Sánchez-Hernández, A.; Uribe, C.; Vazquez, F.; Cinquini, L.; Cumalat, J. P.; O'Reilly, B.; Ramirez, J. E.; Vaandering, E. W.; Butler, J. N.; Cheung, H. W.; Gaines, I.; Garbincius, P. H.; Garren, L. A.; Gottschalk, E.; Kasper, P. H.; Kreymer, A. E.; Kutschke, R.; Bianco, S.; Fabbri, F. L.; Sarwar, S.; Zallo, A.; Cawlfield, C.; Kim, D. Y.; Rahimi, A.; Wiss, J.; Gardner, R.; Chung, Y. S.; Kang, J. S.; Ko, B. R.; Kwak, J. W.; Lee, K. B.; Park, H.; Alimonti, G.; Boschini, M.; Caccianiga, B.; D'Angelo, P.; Dicorato, M.; Dini, P.; Giammarchi, M.; Inzani, P.; Leveraro, F.; Malvezzi, S.; Menasce, D.; Mezzadri, M.; Milazzo, L.; Moroni, L.; Pedrini, D.; Pontoglio, C.; Prelz, F.; Rovere, M.; Sala, A.; Sala, S.; Davenport, T. F.; Agostino, L.; Arena, V.; Boca, G.; Bonomi, G.; Gianini, G.; Liguori, G.; Merlo, M.; Pantea, D.; Ratti, S. P.; Riccardi, C.; Segoni, I.; Viola, L.; Vitulo, P.; Hernandez, H.; Lopez, A. M.; Mendez, H.; Mendez, L.; Mirles, A.; Montiel, E.; Olaya, D.; Paris, A.; Quinones, J.; Rivera, C.; Xiong, W.; Zhang, Y.; Wilson, J. R.; Cho, K.; Handler, T.; Engh, D.; Hosack, M.; Johns, W. E.; Nehring, M. S.; Sheldon, P. D.; Stenson, K.; Webster, M. S.; Sheaff, M.

    2001-04-01

    Using a large sample of photoproduced charm mesons from the FOCUS experiment at Fermilab (FNAL-E831), we observe the decay D0-->K+π- with a signal yield of 149+/-31 events compared to a similarly cut sample consisting of 36 760+/-195 D0-->K-π+ events. We use the observed ratio of D0-->K+π- to D0-->K-π+ \\(0.404+/-0.085+/-0.025\\)% to obtain a relationship between the D0 mixing and doubly Cabibbo suppressed decay parameters.

  16. A experiência da maternidade e a dialogia mãe-filho com distúrbio de linguagem Maternal experience and language impairment mother-child dialogics

    Directory of Open Access Journals (Sweden)

    Anelise Henrich Crestani

    2012-04-01

    Full Text Available TEMA: a experiência da maternidade e dialogia mãe-filho com distúrbio de linguagem. PROCEDIMENTOS: o objetivo de investigar as possíveis relações entre a constituição da experiência da maternidade e a dialogia mãe-filho com distúrbio de linguagem. A amostra desta pesquisa foi constituída por 4 crianças, entre 2 e 4 anos, com distúrbio de linguagem, e suas mães. As mães foram submetidas a uma entrevista semi-estruturada acerca da experiência materna e a possibilidade de a mesma ter passado por alterações emocionais tais como a depressão e/ou ansiedade. Coletou-se uma interação mãe-filho, e em um caso avó-neta, através da filmagem da díade em atividade lúdica para analisar o modo como a dialogia e a interação aconteciam na díade. RESULTADOS: demonstraram que as quatro crianças estiveram sujeitas a interações com mães e avó com índices de ansiedade (dois casos e depressão (dois casos. Apenas uma mãe não possuía tais índices e esta possuía dialogia adequada com a filha. CONCLUSÃO: os dados demonstraram relações entre a dialogia mãe-filho e a experiência materna. Houve distinções na dialogia e no brincar relacionados aos estados emocionais das mães e, em um caso, da avó.BACKGROUND: the maternal experience and language impairment mother-child dialogics. PROCEDURES: the aim was to research the possible relations between maternal experience and mother-child dialogics, in language impairment children cases. The sample was made up with four children, between two and four year old with language impairment and their mothers.The mothers answered a semi-structured interview about the maternal experience and possible mothers' emotional signs like anxiety and depression. The pairs engaged in interaction were videotaped in order to interpret the mother's speech, in one case grand-mother, and the interaction process. RESULTS: the results showed that the children were in interactions with mothers and a grandmother

  17. Theoretical and experimental studies of elementary physics

    International Nuclear Information System (INIS)

    Bodek, A.; Ferbel, T.; Melissinos, A.C.; Olsen, S.; Slattery, P.; Tipton, P.; Das, A.; Hagen, C.R.; Rajeev, S.G.; Okubo, S.

    1992-01-01

    The experimental high energy physics program is directed toward the execution of experiments that probe the basic constituents of matter and the forces between them. These experiments are carried out at national and international accelerator facilities. At the current time, we are primarily concentrating on the following projects: Direct photon production in hadronic reactions (Fermilab E706); Production of hybrid mesons in the nuclear Coulomb field; The D-Zero experiment at the Tevatron collider; Deep inelastic neutrino- and electron-nucleon scattering at FNAL and SLAC; Nonlinear QED at critical field strengths at SLAC; The Experiments at KEK (AMY, 17keV neutrino); The CDF experiment at the Tevatron collider; and SSC-related detector R ampersand D on scintillating tile- and diamond-based calorimetry and microstrip tracking detectors

  18. Study of heavy particle production

    International Nuclear Information System (INIS)

    1990-01-01

    The collaboration of Columbia University, Fermilab, University of Massachusetts, Mexico and Texas A ampersand M is working on installation of E690 at Fermilab and on analysis of data from the Brookhaven E766 experiment. All the major components of the E690 experiment are in place and final cabling and electronics check outs are being done. In addition to the Brookhaven set-up, the Fermilab set-up has a downstream spectrometer made up of five main ring magnets for detection of a fast 800 GeV proton. This allows us on-line to identify diffraction dissociation of the target proton and to select on the mass produced. We expect copious charm production and some bottom particles. This work should produce papers on charm production at Brookhaven, high mass diffraction dissociation, Lambda-Lambda correlations and polarization of Lamdas

  19. Event structures in large psub(T) hadron-hadron collisions

    International Nuclear Information System (INIS)

    Boeggild, H.

    1977-01-01

    Recent large psub(T) experimental results are reviewed with a special emphasis on high energy pp experiments at FNAL and ISR. Some theoretical approaches with a considerable success are discussed. (Auth.)

  20. Macrorrealismo fenomenológico e campos-experiência

    Directory of Open Access Journals (Sweden)

    Renato Schaeffer

    1995-01-01

    Full Text Available Este artigo critica a concepção predominante, representacionista-neurofisicalista sobre a percepção sensorial. Introduz a noção de "campo-experiência" na tentativa de tratamento ontológico dos dados fenomenológicos da experiência. A idéia geral é que a experiência visual, por exemplo, seria ontologicamente algo assim como um campo-experiência de intencionalidade visual, que se estende por sobre e entre o sistema nervoso central do sujeito da experiência e o objeto distai da visão. Chamo esta posição de macrorrealismo fenomenológico, em contraste com o microrrealismo científico. Qualidades da fenomenalidade não estão subjetivamente dentro do cérebro, mas objetivamente dentro de campos-experiência perceptuais extra-encefálicos, ou, como dizemos, lá fora no mundo. Algumas conseqüências específicas do macrorrealismo fenomenológico são apresentadas.

  1. Children’s E-books are Born: How E-books for Children are Leading E-book Development and Redefining the Reading Experience

    Directory of Open Access Journals (Sweden)

    Kathleen Schreurs

    2013-12-01

    Full Text Available Children’s e-books waited to emerge until technology could support their advanced requirements. Recent technologies such as colour e-readers and tablets like Apple’s iPad provide support for heavy visual content and opportunities for interactivity. E-books for children have grown in availability and popularity and now include puzzles, games, music, video, and audio features that boost narratives and create a unique reading experience that is further from print than ever before. This article positions e-books for children as leaders in e-book development. It reviews concepts, practices, and scholarship in the area of e-books for children and highlights issues with definitions and research caused by the rapid growth of enhanced and interactive e-books. There is little argument among scholars and practitioners that the reading experience is changing, and the new generation of readers may have different opinions, assumptions, and preferences for the meanings of ‘book’ and ‘reading’. Managing these shifts in the reading experience, which is still strongly tied to notions from print culture, is an important role for LIS scholars, librarians, educators, and parents. Recent research on e-books for children focuses largely on literacy and education. Little attention has been paid to if and why children enjoy the e-reading experience. Additionally, the majority of current research examines children’s e-reading from an adult perspective with most surveys and interviews consulting parent participants and not children. An examination of relevant research as well as literature on the history and conceptualization of e-books and reading as an evolving experience reveals that, from new technologies to new experiences and new definitions, e-books for children are pushing toward the future of reading.

  2. Precursor Evolution and Stress Corrosion Cracking Initiation of Cold-Worked Alloy 690 in Simulated Pressurized Water Reactor Primary Water

    Energy Technology Data Exchange (ETDEWEB)

    Zhai, Ziqing [Pacific Northwest National Laboratory, 622 Horn Rapids Road, P.O. Box 999, Richland, Washington 99352.; Toloczko, Mychailo [Pacific Northwest National Laboratory, 622 Horn Rapids Road, P.O. Box 999, Richland, Washington 99352.; Kruska, Karen [Pacific Northwest National Laboratory, 622 Horn Rapids Road, P.O. Box 999, Richland, Washington 99352.; Bruemmer, Stephen [Pacific Northwest National Laboratory, 622 Horn Rapids Road, P.O. Box 999, Richland, Washington 99352.

    2017-05-22

    Stress corrosion crack initiation of two thermally-treated, cold-worked (CW) alloy 690 (UNS N06690) materials was investigated in 360oC simulated PWR primary water using constant load tensile (CLT) tests and blunt notch compact tension (BNCT) tests equipped with direct current potential drop (DCPD) for in-situ detection of cracking. SCC initiation was not detected by DCPD for either the 21% or 31%CW CLT specimens loaded at their yield stress after ~9,220 hours, however intergranular (IG) precursor damage and isolated surface cracks were observed on the specimens. The two 31%CW BNCT specimens loaded at moderate stress intensity after several cyclic loading ramps showed DCPD-indicated crack initiation after 10,400 hours of exposure at constant stress intensity, which was resulted from significant growth of IG cracks. The 21%CW BNCT specimens only exhibited isolated small IG surface cracks and showed no apparent DCPD change throughout the test. Post-test cross-section examinations revealed many grain boundary (GB) nano-cavities in the bulk of all the CLT and BNCT specimens particularly for the 31%CW materials. Cavities were also found along GBs extending to the surface suggesting an important role in crack nucleation. This paper provides an overview of the evolution of GB cavities and discusses their effects on crack initiation in CW alloy 690.

  3. Infrared and x-ray photoelectron spectroscopic studies on sodium borosilicate glass interacted with thermally oxidized aluminides formed on alloy 690

    International Nuclear Information System (INIS)

    Yusufali, C.; Dutta, R.S.; Dey, G.K.; Kshirsagar, R.J.; Jagannath; Mishra, R.K.

    2012-01-01

    Thermally oxidized aluminides formed on Ni-Cr-Fe based superalloy 690 substrates were subjected to interaction with sodium borosilicate melt (used as matrices for immobilization of high-level radioactive liquid waste) at 1248 K for 192 hours. After the interaction, Fourier-transform infrared (FT-IR) spectroscopy analysis of glass samples indicated the incorporation of Al in the glass network. X-ray photoelectron spectroscopy (XPS) of glass specimens revealed modified glass structure. (author)

  4. Manufacturing experience for the LHC inner triplet quadrupole cables

    CERN Document Server

    Scanlan, R M; Bossert, R; Kerby, J S; Ghosh, A K; Boivin, M; Roy, T

    2002-01-01

    The design for the U.S. LHC Inner Triplet Quadrupole magnet requires a 37 strand (inner layer) and a 46 strand (outer layer) cable. This represents the largest number of strands attempted to date for a production quantity of Rutherford-type cable. The cable parameters were optimized during the production of a series of short prototype magnets produced at FNAL. These optimization studies focused on critical current degradation, dimensional control, coil winding, and interstrand resistance. After the R&D phase was complete, the technology was transferred to NEEW and a new cabling machine was installed to produce these cables. At present, about 60 unit lengths, out of 90 required for the entire production series of magnets, have been completed for each type of cable. The manufacturing experience with these challenging cables will be reported. Finally, the implications for even larger cables, with more strands, will be discussed. (8 refs).

  5. Experimental Tests of the Standard Model for Particles and Nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Stanislaus, Shirvel [Valparaiso Univ., IN (United States); Manweiler, Robert [Valparaiso Univ., IN (United States); Koetke, Donald [Valparaiso Univ., IN (United States)

    2015-10-01

    This report summarizes the research carried out by the faculty, staff and students of Valparaiso University (VU) during the 30-year period from 1986 to 2015 using funds provided by the Medium Energy Nuclear Physics program of the Department of Energy (DOE). Three faculty members led the VU research group during the lifetime of the research grant. The three principal investigators responsible for the research were: Dr. Donald Koetke (1986 – 2007), Dr. Robert Manweiler (2008 – 2010), and Dr. Shirvel Stanislaus (2011 – 2015). During this period we participated and contributed to the progress of the following experiments: 1. The MEGA Experiment at Los Alamos National Laboratory (LAMPF E969). 2. The Crystal Ball Experiment at Brookhaven National Laboratory (BNL/AGS E906, E913). 3. The NuSea Experiment at Fermilab (FNAL E866). 4. The TWIST Experiment at TRIUMF (TRIUMF E614). 5. The STAR Experiment at RHIC. 6. The nEDM Experiment at Oak Ridge National Laboratory. In the following sections we briefly describe the goals of the above experiments and the contributions made by the Valparaiso University personnel towards the progress of each project.

  6. Progress on the design of a data push architecture for an array of optimized time tagging pixels

    International Nuclear Information System (INIS)

    Shapiro, S.; Cords, D.; Mani, S.; Holbrook, B.; Atlas, E.

    1993-06-01

    A pixel array has been proposed which features a completely data driven architecture. A pixel cell has been designed that has been optimized for this readout. It retains the features of preceding designs which allow low noise operation, time stamping, analog signal processing, XY address recording, ghost elimination and sparse data transmission. The pixel design eliminates a number of problems inherent in previous designs, by the use of sampled data techniques, destructive readout, and current mode output drivers. This architecture and pixel design is directed at applications such as a forward spectrometer at the SSC, an e + e - B factory at SLAC, and fixed target experiments at FNAL

  7. Part of the hydrogen in the intergranular crack by stress corrosion in primary circuit for the 600 and 690 nickel base alloys; Role de l'hydrogene dans le mecanisme de fissuration intergranulaire par corrosion sous contrainte en milieu primaire des alliages base nickel 600 et 690

    Energy Technology Data Exchange (ETDEWEB)

    Odemer, G.; Coudurier, A.; Jambon, F.; Chene, J. [CEA Saclay, Dept. de Physico-Chimie (DPC/SCCME/LECA), 91 - Gif sur Yvette (France); Odemer, G.; Coudurier, A.; Chene, J. [Evry Univ., UMR 8587 CNRS / CEA, LAMBE, 91 (France)

    2007-07-01

    The aim of this study is, in a first part, to characterize the hydrogen embrittlement sensitivity of the 600 and 690 based alloys in order to better understand the hydrogen role in the stress corrosion mechanism which appears in theses alloys in the primary circuit of the PWR type reactors. The authors studies how the hydrogen embrittlement is resulting from an interaction between the hydrogen and the plastic deformation. (A.L.B.)

  8. Open-Rate Controlled Experiment in E-Mail Marketing Campaigns

    Directory of Open Access Journals (Sweden)

    Antun Biloš

    2016-06-01

    Full Text Available Purpose – The main purpose of this paper is to test the controlled experiment (A/B split methodology in B2C oriented e-mail marketing campaigns. Design/Methodology/Approach – E-mail marketing techniques have been a substantial part of e-marketing methodology since the early Internet days of the mid-1990s. From the very beginning of Internet utilization for business purposes, e-mail was one of the most widely used communication techniques in B2B and B2C markets alike. Due to high volumes of spamming and progression of online communication clutter, some practitioners began to question the usability of e-mail as a marketing communication channel, while others embarked on working on improving the message itself. Efforts were invested into improving message quality, as well as into better understanding user expectations. One of the most commonly used techniques to test specific e-mail message elements is the controlled experiment. Findings and implications – This paper explores several types of controlled experiments in a specific Croatian B2C market. Tests were run to determine subscriber behavior towards several newsletter components, including sending time, sending day, sender’s name, and subject line. Open and click rates for tested campaigns, and several other metrics were investigated using MailChimp software. An N − 1 two-proportion test using an adjusted Wald confidence interval around the difference in the proportions was used for comparing the open-rate measure in the controlled experiments between subjects. Limitation – Controlled experiments (A/B split tests showed a lot of potential as a way of measuring behavior and preferences of subscribers, although several apparent limitations (the data-set scope, comparability issues indicated a clear need for standardization on a managerial and scientific level. Originality – This paper provides an up-to-date e-mail marketing effectiveness literature review, describes and tests the

  9. E-36: First Proto-Megascience Experiment at NAL

    Energy Technology Data Exchange (ETDEWEB)

    Pronskikh, Vitaly S. [Fermilab

    2016-03-01

    E-36, an experiment on small angle proton-proton scattering, began testing equipment in the National Accelerator Laboratory’s newly achieved 100-GeV beam on February 12, 1972, marking the beginning of NAL’s experimental program. This experiment, which drew collaborators from NAL, Joint Institute for Nuclear Research (JINR at Dubna, USSR), the University of Rochester (Rochester, New York) and Rockefeller University (New York City) was significant not only as a milestone in Fermilab’s history but also as a model of cooperation between the East and West at a time when Cold War tensions still ran high. An examination of the origin, operation, and resolution of E-36 and the chain of experiments it spawned reveals the complex interplay of science and politics that drove these experiments as well as seeds of the megascience paradigm that has come to dominate high-energy physics research since the 1970s.

  10. Charged particle multiplicity distributions in e+e--annihilation processes in the LEP experiments

    International Nuclear Information System (INIS)

    Shlyapnikov, P.V.

    1992-01-01

    Results of studies of the charged particle multiplicity distributions in the process of e + e - -annihilation into hadrons obtained in experiments at LEP accelerator in CERN are reviewed. Universality in energy dependence of the average charged particle multiplicity in e + e - and p ± p collisions, evidence for KNO-scaling in e + e - data, structure in multiplicity distribution and its relation to the jet structure of events, average particle multiplicities or quark and gluon jets, 'clan' picture and other topics are discussed. 73 refs.; 20 figs.; 3 tabs

  11. E143 experiment. Shower counter calibration

    International Nuclear Information System (INIS)

    Fonvieille, H.; Grenier, P.

    1994-01-01

    The calibration procedure for the shower counters used in the E143 experiment is described. It has been developed during january 1994 in view of being used for the quick analysis. The method is explained and the results obtained on a given run are presented. (author)

  12. Final Technical Report: Mu2e at the City University of New York

    Energy Technology Data Exchange (ETDEWEB)

    Lynch, Kevin [City Univ. (CUNY), NY (United States); Popp, James [City Univ. (CUNY), NY (United States)

    2017-06-25

    This DOE grant award for was for the period June 1, 2013 to March 31, 2016. Popp was awarded an internship in the Visiting Faculty Program at FNAL in summer of 2015; consequently the unused portion of summer salary funds allowed us to apply for a no-cost extension with our remaining funds until March 31, 2017. That support furnished us with the means to carry out numerous successful projects for Mu2e for nearly four years. Up to now, the driving force to our work has been dictated primarily by the Mu2e Project cost and schedule needs. Our work has been under the purview of three of the Working Groups to which we belong: Target Station, Electron Tracker, and Stopping Target Monitor. We have carried out a mix of bench-top testing tasks locally, more elaborate work at Fermilab every summer, and extensive software development and simulation studies.

  13. The Influence of Experience, Ability and Interest on e-Learning Effectiveness

    Science.gov (United States)

    Haverila, Matti; Barkhi, Reza

    2009-01-01

    The purpose of this paper is to report the findings of a research conducted to evaluate the effect of learning preconceptions, prior e-learning experience, ability and interest of students on their perceptions regarding the process of e-learning. We study the effectiveness of e-learning as it relates to the level of e-learning experience. The…

  14. Search for Multi-quark Exotic States with Heavy Flavor at D0 Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Popov, Alexei [Serpukhov, IHEP

    2017-12-20

    We present the results for multi-quark exotic states search from D0 Collaboration at the FNAL Tevatron. This includes an evidence for a state (X(5568)) with hadronic decays of Bs meson, a confirmation of the X(5568) state with semileptonic decays of Bs meson, and a search for exotic baryons decaying to J/ψΛ pairs.

  15. Part of the hydrogen in the intergranular crack by stress corrosion in primary circuit for the 600 and 690 nickel base alloys

    International Nuclear Information System (INIS)

    Odemer, G.; Coudurier, A.; Jambon, F.; Chene, J.; Odemer, G.; Coudurier, A.; Chene, J.

    2007-01-01

    The aim of this study is, in a first part, to characterize the hydrogen embrittlement sensitivity of the 600 and 690 based alloys in order to better understand the hydrogen role in the stress corrosion mechanism which appears in theses alloys in the primary circuit of the PWR type reactors. The authors studies how the hydrogen embrittlement is resulting from an interaction between the hydrogen and the plastic deformation. (A.L.B.)

  16. The Mu2e experiment at Fermilab

    International Nuclear Information System (INIS)

    Donghia, R.

    2017-01-01

    The Mu2e experiment searches for the neutrinoless muon to electron conversion in the field of a nucleus, which is a charged lepton flavor violating process. The goal of the experiment is to reach a single event sensitivity of 2.8×10"−"1"7, setting an upper limit on the muon conversion rate of 6.7 × 10"−"1"7. This corresponds to a four order of magnitude improvement with respect to the existing limits.

  17. Redes Sociais e as Gerações X e Y: Disseminação e Compartilhamento de Experiências de Turismo / Social Networks and Generations X and Y: Dissemination and Tourism Experience Sharing

    Directory of Open Access Journals (Sweden)

    Antônio Claret Guerra

    2015-07-01

    Full Text Available Este artigo tem como objetivo identificar a contribuição de redes sociais on-line (OSN para o processo de disseminação e compartilhamento de experiências de turismo das gerações X e Y. A pesquisa realizada tem natureza exploratória e abordagem qualitativa, sendo os dados obtidos por entrevistas semiestruturadas. A análise de conteúdo (Bardin, 2009 foi a técnica usada para a análise dos dados coletados. Procurou-se, dessa forma, investigar vários aspectos ligados ao tema proposto: se as OSN são uma inovação tecnológica que impactou o setor de viagens; sua importância para o desenvolvimento e manutenção de relacionamentos das gerações X e Y com mídias sociais on-line; a interface de cocriação de produtos turísticos; sua contribuição para a formação de preferências e intenções de compra. Entre as conclusões do estudo, verifica-se que os entrevistados concordam que as OSN impactam o setor e o consumidor busca benefícios ao utilizá-las, destacando a praticidade, comodidade, segurança, troca de informações e experiências. Foi citado, ainda, que as OSN divulgam roteiros turísticos competitivos e acessíveis, que antes da era digital eram relativamente pouco conhecidos do grande público. Palavras-chave: Turismo. Experiência Turística. Redes Sociais On-line. Gerações X e Y. Social Networks and Generations X and Y: Dissemination and Tourism Experience Sharing - This article aims to identify the on-line social network (OSN contribution to the X and Y generations´ tourism experiences of dissemination and sharing process. The content analysis (Bardin, 2008 was the technique used to analyses the data obtained through semi structured interviews. It was sought to investigate the OSN as technological innovation, its significance for the X and y generations relationships development, co-creation and formation of purchase intentions interface. Among the conclusions is the actual benefit of the OSN impact on the

  18. Collaborative e-Science Experiments and Scientific Workflows

    NARCIS (Netherlands)

    Belloum, A.; Inda, M.A.; Vasunin, D.; Korkhov, V.; Zhao, Z.; Rauwerda, H.; Breit, T.M.; Bubak, M.; Hertzberger, L.O.

    2011-01-01

    Recent advances in Internet and grid technologies have greatly enhanced scientific experiments' life cycle. In addition to compute- and data-intensive tasks, large-scale collaborations involving geographically distributed scientists and e-infrastructure are now possible. Scientific workflows, which

  19. Effect of surface stress states on the corrosion behavior of alloy 690

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Myung Mo; Shim, Hee Sang; Seo, Myung Ji; Hur, Do Haeng [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    The test environment simulated the primary water chemistry in PWRs. Dissolved oxygen (DO), dissolved hydrogen (DH), pH and conductivity were monitored at room temperature using sensors manufactured by Orbisphere and Mettler Toledo. The temperature and pressure were maintained at 330 .deg. C and 150 bars during the corrosion test. The condition of the test solution was lithium (LiOH) 2 ppm and boron (H3BO4) 1,200 ppm, DH 35 cc/kg (STP) and less than 5 ppb DO. The flow rate of the loop system was 3.8 L/hour. Corrosion tests were conducted for 500 hours. The corrosion release rate was evaluated by a gravimetric analysis method using a two-step alkaline permanganate-ammonium citrate (AP/AC) descaling process. Compressive residual stress is induced by shot peening treatment but its value reveals some different trend between the shot peening intensity on the surface of Alloy 690 TT. A higher shot peening intensity causes a reduction in the corrosion rate and it is considered that the compressive residual stress beneath the surface layer suppresses the metal ion transfer in an alloy matrix.

  20. Meson spectroscopy experiment at KEK - E/iota puzzle

    International Nuclear Information System (INIS)

    Tsuru, Tsuneaki

    1985-01-01

    Physics interests at the KEK (National Laboratory for High Energy Physics) are (1) search for exotic mesons such as glueballs (gg), meiktons (q anti q g) and multiquark states (q sup(2 - )q 2 ), (2) search for missing ordinary mesons (q anti q) and confirmation of unestablished mesons, and (3) new informations of quark contents of mesons, mixing angles of SU(3) singlet-octet and tests of conservations law. Special interest is in search for exotics such as glueballs and meiktons. (2) is a so-called meson spectroscopy experiment. This is important not only in itself but also in identifying newly discovered states as exotics because exotics have often same quantum numbers as ordinary mesons. Contents are the following: glueballs and E/iota puzzles, spectrometer system, experiments, performance of the spectrometer, physics outputs, E/iota puzzles and πI experiment, future plans. (Mori, K.)

  1. Experiência e Utopia em Theodor W. Adorno, André Gorz e François Dubet

    Directory of Open Access Journals (Sweden)

    Sílvio César Camargo

    2007-01-01

    sociedade contemporânea. Conceito bastante complexo quanto a sua possibilidade de apreensão pela sociologia, experiência se refere tanto a problemas relativos ao conhecimento e suas possibilidades, mas também para as possibilidades de transformação da sociedade. Entende-se que há três teóricos da sociedade contemporânea, que partindo de bases epistemológicas diferentes, problematizam a emancipação humana a partir de uma singular atenção ao conceito de experiência. Theodor W. Adorno, André Gorz e François Dubet representam três formas de pensamento sobre a sociedade bastante diferentes, mas que possuem em comum o interesse normativo, e seu confronto nos mostra a importância do conceito de experiência para a compreensão da sociedade contemporânea e para pensar-se a utopia.

  2. Radio frequency systems for present and future accelerators

    International Nuclear Information System (INIS)

    Raka, E.C.

    1987-01-01

    Rf systems are described for the FNAL Main Ring and Tevatron Ring, CERN SPS and LEP, and HERA proton acceleration system, CERN PS e + e/sup minus/ acceleration system, and CERN EPA monochromatic cavity. Low impedance rf systems in CERN ISR, the Brookhaven CBA, and SSC are also discussed

  3. Delírios I – Agonia e experiência (jogos de vida e morte

    Directory of Open Access Journals (Sweden)

    Vinícius Nicastro Honesko

    2010-07-01

    Full Text Available O presente ensaio pretende expor uma idéia de agonia como jogo de vida e morte no qual imerge o artista no ato de criação. A partir das leituras e conceituações do termo jogo em Johan Huizinga e em Roger Caillois, mostra como tais idéias são importantes para compreender a experiência humana diante do incompreensível que é a morte. Aponta como a agonia inspira no poeta, principalmente na modernidade, uma distância em relação às certezas do conhecimento, implicando uma leitura etimológica do termo experiência, isto é, como ex periri, (aqui, também, jogo de vida e morte. Por fim, procura ver como os traços desse jogo – uma eterna luta – sutilmente se mostram nos pânicos de Murilo Mendes e de Paul Gauguin, artistas nos quais a consciência dessa luta é atravessada pela imagem do lugar por excelência da agonia: o Calvário.

  4. Report of the Snowmass M6 Working Group on high intensity proton sources

    Energy Technology Data Exchange (ETDEWEB)

    Weiren Chou and J. Wei

    2002-08-20

    The U.S. high-energy physics program needs an intense proton source, a 1-4 MW Proton Driver (PD), by the end of this decade. This machine will serve as a stand-alone facility that will provide neutrino superbeams and other high intensity secondary beams such as kaons, muons, neutrons, and anti-protons (cf. E1 and E5 group reports) and also serve as the first stage of a neutrino factory (cf. M1 group report). It can also be a high brightness source for a VLHC. Based on present accelerator technology and project construction experience, it is both feasible and cost-effective to construct a 1-4 MW Proton Driver. Two recent PD design studies have been made, one at FNAL and the other at the BNL. Both designed PD's for 1 MW proton beams at a cost of about U.S. $200M (excluding contingency and overhead) and both designs were upgradeable to 4 MW. An international collaboration between FNAL, BNL and KEK on high intensity proton facilities is addressing a number of key design issues. The superconducting (sc) RF cavities, cryogenics, and RF controls developed for the SNS can be directly adopted to save R&D efforts, cost, and schedule. PD studies are also actively being pursued at Europe and Japan.

  5. Electronic Collaboration Logbook

    International Nuclear Information System (INIS)

    Gysin, Suzanne; Mandrichenko, Igor; Podstavkov, Vladimir; Vittone, Margherita

    2012-01-01

    In HEP, scientific research is performed by large collaborations of organizations and individuals. The logbook of a scientific collaboration is an important part of the collaboration record. Often it contains experimental data. At Fermi National Accelerator Laboratory (FNAL), we developed an Electronic Collaboration Logbook (ECL) application, which is used by about 20 different collaborations, experiments and groups at FNAL. The ECL is the latest iteration of the project formerly known as the Control Room Logbook (CRL). We have been working on mobile (IOS and Android) clients for the ECL. We will present the history, current status and future plans of the project, as well as design, implementation and support solutions made by the project.

  6. Experiment E89-044 on the Quasielastic 3He(e,e'p) Reaction at Jefferson Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Penel-Nottaris, Emilie [Univ. Joseph Fourier Grenoble (France)

    2004-07-07

    The Jefferson Lab Hall A E89-044 experiment has measured the 3He(e,e'p) reaction cross-sections. The extraction of the longitudinal and transverse response functions for the two-body break-up 3He(e,e'p)d reaction in parallel kinematics allows the study of the bound proton electromagnetic properties inside the 3He nucleus and the involved nuclear mechanisms beyond plane wave approximations.

  7. Evaluation Of User Experience And Its Economics In E-Commerce

    Directory of Open Access Journals (Sweden)

    Praneeth Kumar Baru

    2017-10-01

    Full Text Available User Experience pertains to designing studying and evaluating experiences that users have while using or interacting with the system with a specific context. UX is seen as a field of study a phenomenon and as a practice as well. To understand it with an analogy justice as a phenomenon law as a field of study and a lawyers work as a practice. Evaluating the users experience can help quantify or measure to the extent to which the system is being understood or perceived the way it is supposed to be. Evaluation methods can take various forms and are categorized in this paper. Essentials of the user experience are elaborated and furthermore some quantified data is presented that discusses the role user experience in e-commerce website and also the future prospects of the e-commerce domain are briefly described.

  8. O Plano Real à luz da experiência mexicana e argentina

    Directory of Open Access Journals (Sweden)

    Paulo Nogueira Batista Jr.

    1996-12-01

    Full Text Available O trabalho discute os primeiros dois anos do Plano Real e em especial os seus efeitos sobre as relações externas do Brasil, à luz da experiência de programas de estabilização adotados no México, em 1988-1994, e na Argentina, desde 1991. Embora cada experiência nacional apresente as suas peculiaridades, argumenta-se que a economia brasileira vem revivendo a experiência mexicana e argentina em alguns pontos importantes, combinando sucesso no combate à inflação com acentuada e persistente apreciação cambial, elevados déficits no balanço de pagamentos em conta corrente e dependência de fluxos voláteis de capital internacional.This paper discusses the first two years of Brazil's current stabilization programme - known as the Real Plan - and in particular its effects on the country's external economic relations, in the ligth of similar stabilization programmes adopted in Mexico from 1988 to 1994 and in Argentina since 1991. Although each national experience has its peculiarities, it is shown that the Brazilian economy has been reliving the Mexican and Argentinian experience in some important respects, combining success in terms of inflation reduction, with strong and persistent exchange rate appreciation, high deficits in the balance of payments on current account and dependence on volatile international capital flows.

  9. Piloting the use of experience sampling method to investigate the everyday social experiences of children with Asperger syndrome/high functioning autism.

    Science.gov (United States)

    Cordier, Reinie; Brown, Nicole; Chen, Yu-Wei; Wilkes-Gillan, Sarah; Falkmer, Torbjorn

    2016-01-01

    This pilot study explored the nature and quality of social experiences of children with Asperger Syndrome/High Functioning Autism (AS/HFA) through experience sampling method (ESM) while participating in everyday activities. ESM was used to identify the contexts and content of daily life experiences. Six children with AS/HFA (aged 8-12) wore an iPod Touch on seven consecutive days, while being signalled to complete a short survey. Participants were in the company of others 88.3% of their waking time, spent 69.0% of their time with family and 3.8% with friends, but only conversed with others 26.8% of the time. Participants had more positive experiences and emotions when they were with friends compared with other company. Participating in leisure activities was associated with enjoyment, interest in the occasion, and having positive emotions. ESM was found to be helpful in identifying the nature and quality of social experiences of children with AS/HFA from their perspective.

  10. International Reactor Physics Experiment Evaluation (IRPhE) Project. IRPhE Handbook - 2015 edition

    International Nuclear Information System (INIS)

    Bess, John D.; Gullifor, Jim

    2015-03-01

    The purpose of the International Reactor Physics Experiment Evaluation (IRPhE) Project is to provide an extensively peer-reviewed set of reactor physics-related integral data that can be used by reactor designers and safety analysts to validate the analytical tools used to design next-generation reactors and establish the safety basis for operation of these reactors. This work of the IRPhE Project is formally documented in the 'International Handbook of Evaluated Reactor Physics Benchmark Experiments', a single source of verified and extensively peer-reviewed reactor physics benchmark measurements data. The evaluation process entails the following steps: Identify a comprehensive set of reactor physics experimental measurements data, Evaluate the data and quantify overall uncertainties through various types of sensitivity analysis to the extent possible, verify the data by reviewing original and subsequently revised documentation, and by talking with the experimenters or individuals who are familiar with the experimental facility, Compile the data into a standardized format, Perform calculations of each experiment with standard reactor physics codes where it would add information, Formally document the work into a single source of verified and peer reviewed reactor physics benchmark measurements data. The International Handbook of Evaluated Reactor Physics Benchmark Experiments contains reactor physics benchmark specifications that have been derived from experiments that were performed at nuclear facilities around the world. The benchmark specifications are intended for use by reactor designers, safety analysts and nuclear data evaluators to validate calculation techniques and data. Example calculations are presented; these do not constitute a validation or endorsement of the codes or cross-section data. The 2015 edition of the International Handbook of Evaluated Reactor Physics Benchmark Experiments contains data from 143 experimental series that were

  11. The growth mechanism of grain boundary carbide in Alloy 690

    International Nuclear Information System (INIS)

    Li, Hui; Xia, Shuang; Zhou, Bangxin; Peng, Jianchao

    2013-01-01

    The growth mechanism of grain boundary M 23 C 6 carbides in nickel base Alloy 690 after aging at 715 °C was investigated by high resolution transmission electron microscopy. The grain boundary carbides have coherent orientation relationship with only one side of the matrix. The incoherent phase interface between M 23 C 6 and matrix was curved, and did not lie on any specific crystal plane. The M 23 C 6 carbide transforms from the matrix phase directly at the incoherent interface. The flat coherent phase interface generally lies on low index crystal planes, such as (011) and (111) planes. The M 23 C 6 carbide transforms from a transition phase found at curved coherent phase interface. The transition phase has a complex hexagonal crystal structure, and has coherent orientation relationship with matrix and M 23 C 6 : (111) matrix //(0001) transition //(111) carbide , ¯ > matrix // ¯ 10> transition // ¯ > carbide . The crystal lattice constants of transition phase are c transition =√(3)×a matrix and a transition =√(6)/2×a matrix . Based on the experimental results, the growth mechanism of M 23 C 6 and the formation mechanism of transition phase are discussed. - Highlights: • A transition phase was observed at the coherent interfaces of M 23 C 6 and matrix. • The transition phase has hexagonal structure, and is coherent with matrix and M 23 C 6 . • The M 23 C 6 transforms from the matrix directly at the incoherent phase interface

  12. How to measure parity violating effects in e/sup +/e/sup -/. -->. tau/sup +/tau/sup -/ annihilation experiments

    Energy Technology Data Exchange (ETDEWEB)

    Dahmen, H D; Schuelke, L; Zech, G [Physics Department, Siegen University, Germany, F.R.

    1979-02-26

    A measurement of parity violating effects in the process e/sup +/e/sup -/ ..-->.. tau/sup +/tau/sup -/ for unpolarized e/sup +/e/sup -/ beams is proposed. For realistic assumptions on the luminosity of PETRA and PEP an estimate shows that the experiment is feasible.

  13. Religiosidade e turismo: o primado da experiência

    Directory of Open Access Journals (Sweden)

    António Sérgio Araújo de Almeida

    Full Text Available Resumo Localizada em um plano complexo e multifacetado, a experiência turística em contexto religioso é fortemente afetada pelos aspectos simbólicos, culturais, sociais e econômicos, presentes no lugar de visitação. É neste sentido que este trabalho se propõe a discutir alguns destes elementos no contexto empírico da Semana Santa de Braga, em Portugal.

  14. Feminilidade: alteridade e experiência Femininity: alterity and experience

    Directory of Open Access Journals (Sweden)

    Márcia Arán

    2002-06-01

    Full Text Available Este ensaio tem como objetivo desenvolver a noção de alteridade na psicanálise a partir dos conceitos de feminilidade e de experiência. Parte de uma crítica à centralidade do modelo Édipo / castração na teoria psicanalítica ­ modelo este que fundamenta uma forma de subjetivação que se faz pelo recalque como defesa ou pela renúncia pulsional - para pensar novas formas de sociabilidade. Inicialmente, procura-se analisar o destino da experiência alteritária na modernidade: o outro como estranho-familiar. Em seguida, através da análise de algumas passagens da obra freudiana, procura-se desen­ volver a noção de alteridade no registro da imanência, ou seja, como uma abertura para a diferença.The objective of this essay is to elaborate on the notion of alterity in psychoanalysis based on the concepts of femininity and experience. The point of departure is a critique of the centrality of the Oedipean/castration model in psychoanalytical theory (a model underlying a form of subjectivation resulting from repression or denial of drive in order to conceive new forms of sociabilily. The article begins by analyzing lhe fate of the altetily experience in modernity: lhe other as slrange/familiar. Next, by analyzing key passages from Freud's work, lhe author seeks to develop the notion of alterily in lhe context of immanence, that is, as an openness to difference.

  15. A "Uses and Gratification Expectancy Model" to Predict Students' "Perceived e-Learning Experience"

    Science.gov (United States)

    Mondi, Makingu; Woods, Peter; Rafi, Ahmad

    2008-01-01

    This study investigates "how and why" students' "Uses and Gratification Expectancy" (UGE) for e-learning resources influences their "Perceived e-Learning Experience." A "Uses and Gratification Expectancy Model" (UGEM) framework is proposed to predict students' "Perceived e-Learning Experience," and…

  16. The E166 experiment: Development of an undulator-based ...

    Indian Academy of Sciences (India)

    A longitudinal polarized positron beam is foreseen for the international linear collider (ILC). A proof-of-principle experiment has been performed in the final focus test beam at SLAC to demonstrate the production of polarized positrons for implementation at the ILC. The E166 experiment uses a 1 m long helical undulator in a ...

  17. Antiproton storage: a comparison of proposals

    International Nuclear Information System (INIS)

    Pondrom, L.G.

    1977-01-01

    Projects to produce and store anti p's and to accelerate anti p's and p's together in the same large ring are underway at CERN and FNAL. The goal is to achieve anti pp collisions with a luminosity L approximately 10 30 cm -2 sec -1 by perhaps 1980. These experiments predate any similar effort at ISABELLE by at least four years, so it is necessary to plan an ISABELLE project which will have significantly higher luminosity. A lower bound L = 10 31 cm -2 sec -1 has been rather arbitrarily chosen. The basic numbers which enter into the luminosity calculations for the CERN and FNAL proposals are presented and are compared with what could be achieved at ISABELLE under ideal conditions

  18. Harvard University High Energy Physics

    International Nuclear Information System (INIS)

    1993-01-01

    The mainly experimental research program in high energy physics at Harvard is summarized in a descriptive fashion according to the following outline: Proton endash antiproton colliding beam program at Fermilab -- CDF (forward/backward electromagnetic calorimeters -- FEM, central muon extension -- CMX, gas calorimetry and electronics development, front-end electronics upgrades, software development, physics analysis, timetable), electron -- positron collisions in the upsilon region -- CLEO (the hardware projects including CLEO II barrel TOF system and silicon drift detector R ampersand D, physics analysis), search for ν μ to ν τ oscillations with the NOMAD experiment at CERN, the solenoidal detector collaboration at the SSC, muon scattering at FNAL -- E665, the L3 experiment, and phenomenological analysis of high-energy bar pp cross sections. 149 refs

  19. O ensino e a experiência nas narrativas de professores de Inglês

    Directory of Open Access Journals (Sweden)

    Annallena de Souza Guedes

    2016-09-01

    Full Text Available Resumo: Este trabalho tem como objetivo analisar três narrativas de professores de Inglês em exercício, através das quais são reveladas experiências que dizem respeito ao processo de ensinar Inglês em contextos de instituições públicas no Brasil. Pautado no conceito de experiência (MICCOLI, 2010, buscamos compreender quais experiências emergem dessas narrativas e como elas influenciam na prática de ensino dos professores. Ademais, intentamos analisar como os professores de Inglês se veem e quais desafios ele enfrentam nos seus contextos de trabalho. Os resultados desse estudo mostraram que, apesar de todas as experiências de dificuldades e indisciplina reveladas nas narrativas, duas delas parecem ainda encontrar motivação e esperança quanto à sua profissão. Além disso, percebemos que o modo como os professores veem sua realidade, seus alunos e seu trabalho são importantes para caracterizar sua prática profissional. Assim, acreditamos que o contexto e as experiências retratados nas narrativas podem ser caminhos que direcionem as ações desses professores em sala de aula e, consequentemente, possibilitem reflexões e mudanças no seu papel como educador. 

  20. Open-Rate Controlled Experiment in E-Mail Marketing Campaigns

    OpenAIRE

    Biloš, Antun; Turkalj, Davorin; Kelić, Ivan

    2016-01-01

    Purpose – The main purpose of this paper is to test the controlled experiment (A/B split) methodology in B2C oriented e-mail marketing campaigns. Design/Methodology/Approach – E-mail marketing techniques have been a substantial part of e-marketing methodology since the early Internet days of the mid-1990s. From the very beginning of Internet utilization for business purposes, e-mail was one of the most widely used communication techniques in B2B and B2C markets alike. Due to high volumes o...

  1. Rare K+ decays from experiment E787

    International Nuclear Information System (INIS)

    Jain, V.

    2000-01-01

    This paper presents the latest results from experiment E787, at Brookhaven National Laboratory, on K + -> π + νbar ν and radiative K + decays. The result for K + -> π + νbar ν uses data collected in runs taken during 1995, 1996 and 1997. In addition, they discuss plans for future measurements of K + -> π + νbar ν

  2. International Reactor Physics Experiment Evaluation (IRPhE) Project

    International Nuclear Information System (INIS)

    2013-01-01

    The International Reactor Physics Experiment Evaluation (IRPhE) Project aims to provide the nuclear community with qualified benchmark data sets by collecting reactor physics experimental data from nuclear facilities, worldwide. More specifically the objectives of the expert group are as follows: - maintaining an inventory of the experiments that have been carried out and documented; - archiving the primary documents and data released in computer-readable form; - promoting the use of the format and methods developed and seek to have them adopted as a standard. For those experiments where interest and priority is expressed by member countries or working parties and executive groups within the NEA provide guidance or co-ordination in: - compiling experiments into a standard international agreed format; - verifying the data, to the extent possible, by reviewing original and subsequently revised documentation, and by consulting with the experimenters or individuals who are familiar with the experimenters or the experimental facility; - analysing and interpreting the experiments with current state-of-the-art methods; - publishing electronically the benchmark evaluations. The expert group will: - identify gaps in data and provide guidance on priorities for future experiments; - involve the young generation (Masters and PhD students and young researchers) to find an effective way of transferring know-how in experimental techniques and analysis methods; - provide a tool for improved exploitation of completed experiments for Generation IV reactors; - coordinate closely its work with other NSC experimental work groups in particular the International Criticality Safety Benchmark Evaluation Project (ICSBEP), the Shielding Integral Benchmark Experiment Data Base (SINBAD) and others, e.g. knowledge preservation in fast reactors of the IAEA, the ANS Joint Benchmark Activities; - keep a close link with the working parties on scientific issues of reactor systems (WPRS), the expert

  3. XbD Video 2, Taxonomy of Experience (ToE) [Online

    DEFF Research Database (Denmark)

    2013-01-01

    This is the second video in the Experience-based Designing series: It describes the Taxonomy of Experience, a structural way of looking at human experiences of almost any kind.This hierarchical model is useful to researchers and decision makers as a general method or tool for guiding the collection......, processing and categorisation of field data about an everyday experience. Researchers using this model often referred to the process as 'doing a ToE'...

  4. Nietzsche e a jubilosa experiência trágica dos gregos

    Directory of Open Access Journals (Sweden)

    Renato Nunes Bittencourt

    2010-10-01

    Full Text Available Neste texto analisamos a interpretação de Nietzsche sobre o sentido existencial da experiência trágica realizada pelos antigos gregos na celebração estética e religiosa da Tragédia Ática, e de que modo tal experiência favorece a compreensão imanente e amoral da vida, suprimindo-se ainda qualquer tipo de depreciação moralista em relação ao real.

  5. E-Books and Audiobooks: Extending the Digital Reading Experience

    Science.gov (United States)

    Larson, Lotta C.

    2015-01-01

    This article examines how sixth-grade students navigated and perceived a combined e-book and audiobook reading experience using Kindle Fires. While audiobooks and e-books are not new, little is known about students' use and perceptions of the combination of these two media, as the ability to synchronize audio contents with digital texts is rather…

  6. De Marias e Luizes: experiências devocionais e de gênero numa festa mariana

    Directory of Open Access Journals (Sweden)

    Martín, Eloísa

    2003-01-01

    Full Text Available O presente artigo parte de uma pesquisa levada a cabo entre 1998 e 2000 na festa da Virgem de Itatí em Corrientes (Argentina. A partir de dois casos, proponho analisar a maneira pela qual as experiências religiosas e de gênero relacionam-se e se constituem mutuamente a través de certas práticas devocionais. Tais práticas, transmitidas e reproduzidas por meio de laços familiares também marcadas por diferenciais de gênero, se processam em termos de um compromisso com a Virgem, mas também com as tradições locais e com os próprios laços de parentesco. Assim, através de certas práticas de devoção, veremos como se aprende a ser, ao mesmo tempo e desde o início, mulher e devota, homem e devoto

  7. Contribution of the low cycle fatigue on ultra high purity Ni-Cr-Fe alloys and on Ni monocrystals to the understanding of the hydrogen role in stress corrosion cracking for the alloys 600 and 690; Apport de la fatigue oligocyclique sur alliages Ni-Cr-Fe d'ultra haute purete et sur monocristaux de Ni a la comprehension sous contrainte des alliages 600 et 69O

    Energy Technology Data Exchange (ETDEWEB)

    Renaudot, N

    1999-06-01

    We discuss the role of hydrogen in cracking of Ni base alloys used for pressurised water reactor (PWR) primary tubes (alloy 600 and 690). Cracking can be explained by a Stress Corrosion Cracking (SCC) phenomenon. For this purpose, Low cycle fatigue (R = - 1) under cathodic charging at room temperature is conducted to study hydrogen effects on propagation of cracks mechanically initiated by the formation of Persistent Slip Bands (PSB). Low cycle fatigue on Ultra High Purity specimens (Ni, alloy 600 and 690) reveals the very important hydrogen effect on crack propagation rate, whatever the Cr content in the Ni base alloy. If Cr seems to have an effect over-hydrogen penetration in specimens (by a protective film formation), it have no beneficial effect when hydrogen have diffused ahead of a crack tip. Propagation rates (transgranular or intergranular) are highly increased, no matter of the absence of impurities like sulphur. Then, in PWR, the difference in the behaviour of alloy 600 and 690 could be due to a slower microcrack propagation rate for alloy 690. Protective films could play an important role in this difference, which is to study. Low cycle fatigue on Ni single crystals oriented for single slip shows, for the first time on bulk specimen, a macroscopic softening which can be explained. by hydrogen-dislocation interactions. Moreover, a simple quantitative model based on these interactions results in the same softening as the one observed experimentally. These results allow to validate experimentally one of the most important steps in the 'Corrosion Enhanced Plasticity (CEP) model', i.e. the softening ahead of a stress corrosion crack tip by hydrogen dislocation interactions. This is of importance because this model can explain cracking in numerous FCC materials-environment couple. (author)

  8. Optimizing Centrifugal Barrel Polishing For Mirror Finish SRF Cavity And RF Tests At Jefferson Lab

    International Nuclear Information System (INIS)

    Palczewski, Ari; Geng, Rongli; Tian, Hui

    2012-01-01

    We performed Centrifugal Barrel Polishing (CBP) on a 1.3 GHz fine grain TESLA single cell cavity and 1.5 GHz fine grain CEBAF high gradient superconducting radio frequency (SRF) single cell cavity following a modified recipe originally developed at Fermi National Accelerator Lab (FNAL). We were able to obtain a mirror like surface similar to that obtained at FNAL, while reducing the number of CBP steps and total processing time. This paper will discuss the change in surface and subsequent cavity performance post CBP, after a 800 C bake (no pre-bake chemistry) and minimal controlled electro-polishing (10 micron). In addition to Q vs. E ACC thermometry mapping with preheating characteristics and optical inspection of the cavity after CBP will also be shown.

  9. Phenomenology of neutrino oscillations

    Indian Academy of Sciences (India)

    Hence, I think it is time to look at the next job. .... travel Д in vacuum is given by. И´ « .... travelling through the earth that the effect is most dominant. ..... real confirmation or ruling out has to await the Mini BOONE experiment at FNAL, a long.

  10. The challenges of new nuclear projects. E.ON Experience

    International Nuclear Information System (INIS)

    Spechty, J.; Perez Rodriguez, J. L.

    2012-01-01

    E.ON is one of the largest privately-owned energy companies in the world. Its portfolio of nuclear assets in composed of 21 nuclear power plants on 13 sites located in Germany and Sweden, 9 of which are directly operated by E.ON. At present E.ON develops large-scale construction projects in two of the European countries willing to commit to new nuclear build-Finland and UK - for which its experience as the best nuclear power plant operator in Europe is key. (Author)

  11. Feasibility of a 81Br(ν,e-) 81Kr solar neutrino experiment

    International Nuclear Information System (INIS)

    Hurst, G.S.; Chen, C.H.; Kramer, S.D.; Cleveland, B.T.; Davis, R. Jr.; Rowley, R.K.; Gabbard, F.; Schima, F.J.

    1984-01-01

    A solar neutrino experiment utilizing the interaction of 81 Br(ν,e - ) 81 Kr to study the 7 Be neutrino source in the interior of the sun is shown to be feasible. Resonance ionization spectroscopy was used to count less than 1000 atoms of 2 x 10 5 -yr 81 Kr, making the bromine experiment possible. Except for the method of counting product atoms, the bromine experiment would be very similar to the successful chlorine detector 37 Cl(ν,e - ) 37 Ar, and thus it is a natural sequel to the only solar neutrino experiment to date

  12. Microstructural Characterization and Mechanical Properties of Electron Beam Welded Joint of High Strength Steel Grade S690QL

    Directory of Open Access Journals (Sweden)

    Błacha S.

    2016-06-01

    Full Text Available In the paper the results of metallographic examination and mechanical properties of electron beam welded joint of quenched and tempered steel grade S690QL are presented. Metallographic examination revealed that the concentrated electron beam significantly affect the changes of microstructure in the steel. Parent material as a delivered condition (quenched and tempered had a bainitic-martensitic microstructure at hardness about 290 HV0.5. After welding, the microstructure of heat affected zone is composed mainly of martensite (in the vicinity of the fusion line of hardness 420 HV0.5. It should be noted, however, that the microstructure of steel in the heat affected zone varies with the distance from the fusion line. The observed microstructural changes were in accordance with the CCT-S transformation diagram for the examined steel.

  13. International Reactor Physics Experiment Evaluation (IRPhE) Project. IRPhE Handbook - 2017 edition

    International Nuclear Information System (INIS)

    2017-01-01

    The International Reactor Physics Evaluation (IRPhE) Project was initiated as a pilot in 1999 by the Nuclear Energy Agency (NEA) Nuclear Science Committee (NSC). The project was endorsed as an official activity of the NSC in June 2003. While the NEA co-ordinates and administers the IRPhE Project at the international level, each participating country is responsible for the administration, technical direction and priorities of the project within their respective countries. The information and data included in this handbook are available to NEA member countries, to all contributing countries and to others on a case-by-case basis. The IRPhE Project is patterned after the International Criticality Safety Benchmark Evaluation Project (ICSBEP). It closely co-ordinates with the ICSBEP to avoid duplication of efforts and publication of conflicting information. Some benchmark data are applicable to both nuclear criticality safety and reactor physics technology. Some have already been evaluated and published by the ICSBEP, but have been extended to include other types of measurements in addition to the critical configuration. Through this effort, the IRPhE Project will be able to 1) consolidate and preserve the existing worldwide information base; 2) retrieve lost data; 3) identify areas where more data are needed; 4) draw upon the resources of the international reactor physics community to help fill knowledge gaps; 5) identify discrepancies between calculations and experiments due to deficiencies in reported experimental data, cross-section data, cross-section processing codes and neutronics codes; 6) eliminate a large amount of redundant research and processing of reactor physics experiment data, and 7) improve future experimental planning, execution and reporting. This handbook contains reactor physics benchmark specifications that have been derived from experiments performed at nuclear facilities around the world. The benchmark specifications are intended for use by

  14. Infância, experiência e performatividade: primeiras aproximações

    Directory of Open Access Journals (Sweden)

    Sandro Vinicius Sales dos Santos

    2014-08-01

    Full Text Available http://dx.doi.org/10.5007/1980-4512.2014n30p31 O presente trabalho apresenta e discute alguns resultados parciais de uma pesquisa de mestrado em andamento que objetiva analisar as experiências vivenciadas por crianças de quatro anos no interior de uma instituição pública de educação infantil. O estudo de caráter interpretativo busca suas bases teóricas na sociologia da infância e nas pedagogias da infância e da educação infantil. Do ponto de vista metodológico, a pesquisa se fundamenta em um estudo de caso (ANDRÉ, 1991; SARMENTO, 2003 assumindo uma lógica de investigação etnográfica (CASTANHEIRA, 2004; GREEN, DIXON, ZAHALIRICK, 2005, tendo como principais instrumentos de coleta de dados, a observação participante, fotografias e desenhos articulados com a oralidade; entrevista com crianças e adultos, dentre outros. Discute ainda a noção de experiência infantil como a possibilidade de análise das formas de sociabilidade das crianças. Palavras-chave: infância, crianças, educação infantil, experiência infantil, ponto de vista das crianças.

  15. Coincidence (e,e'p) Scattering on 40Ar and 48Ti to Aid Precision Neutrino Oscillation Experiments

    Science.gov (United States)

    Abrams, Dan; E12-14-012 Collaboration

    2017-09-01

    Neutrino oscillations are an active area of research, with experiments such as DUNE (Deep Underground Neutrino Experiment). DUNE will make use of large liquid argon detectors to perform a precision measurement of the CP violating phase. Hence, an understanding of the argon nuclear ground state and its response to (anti-)neutrino interactions is of paramount importance. Information about the nuclear ground state is encapsulated in the spectral function, S (k , E) , the joint probability of removing a nucleon of momentum k = |k | from the ground state leaving the residual (A-1) system with excitation energy E. E12-14-012 at Jefferson Lab ran in early 2017 and has measured the argon spectral function through coincidence (e ,e' p) scattering on 40Ar and 48Ti. The results of E12-14-012 are important to both the neutrino and nuclear physics communities. A direct measurement of the coincidence (e ,e' p) cross section from 40Ar and 48Ti will provide valuable information about the argon nucleus, as well as the experimental input necessary to constrain theoretical models used to calculate S (k , E) , paving the way for reliable estimates of the neutrino cross sections. Data from E12-14-012 is currently being analyzed at UVA and Va. Tech. Supported in part by the Department of Energy Grant No: DE-FG02-96ER40950.

  16. Tempo e Trânsito na Experiência Subjetiva de Motoristas

    OpenAIRE

    Ana Inez Oka Elvas de Lima; Sylvia Cavalcante

    2015-01-01

    Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas d...

  17. Healthcare students' experiences when integrating e-learning and flipped classroom instructional approaches.

    Science.gov (United States)

    Telford, Mark; Senior, Emma

    2017-06-08

    This article describes the experiences of undergraduate healthcare students taking a module adopting a 'flipped classroom' approach. Evidence suggests that flipped classroom as a pedagogical tool has the potential to enhance student learning and to improve healthcare practice. This innovative approach was implemented within a healthcare curriculum and in a module looking at public health delivered at the beginning of year two of a 3-year programme. The focus of the evaluation study was on the e-learning resources used in the module and the student experiences of these; with a specific aim to evaluate this element of the flipped classroom approach. A mixed-methods approach was adopted and data collected using questionnaires, which were distributed across a whole cohort, and a focus group involving ten participants. Statistical analysis of the data showed the positive student experience of engaging with e-learning. The thematic analysis identified two key themes; factors influencing a positive learning experience and the challenges when developing e-learning within a flipped classroom approach. The study provides guidance for further developments and improvements when developing e-learning as part of the flipped classroom approach.

  18. A model based estimate of the geometrical acceptance of the e+e- experiment on the HYPERON spectrometer

    International Nuclear Information System (INIS)

    Cerny, V.

    1983-01-01

    A model based estimate is presented of the geometrical acceptance of the HYPERON spectrometer for the detection of the e + e - pairs in the proposed lepton experiment. The results of the Monte Carlo calculation show that the expected acceptance is fairly high. (author)

  19. Proposed solar neutrino experiment using 81Br(nu,e-)81Kr

    International Nuclear Information System (INIS)

    Hurst, G.S.; Chen, C.H.; Kramer, S.D.; Allman, S.L.

    1984-12-01

    It has now been shown that it is feasible to measure the 7 Be neutrino source in the sun by using the reaction 81 Br(nu,e - ) 81 Kr in a radiochemical experiment. Such an experiment would be quite similar to the Davis, Cleveland, and Rowley method for measuring the 8 B neutrino using 37 Cl(nu,e - ) 37 Ar except that the resonance ionization spectroscopy (RIS) method (instead of decay counting) would be employed to count the 2 x 10 5 -yr 81 Kr atoms

  20. 48 CFR 801.690-1 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... purchasing agents; contracting officers warranted above the micro-purchase threshold; program and project... statement includes information on experience, education, training, and pertinent contracting authority... experience leading to the fulfillment of core competencies in acquisition-related disciplines. Selection...

  1. Status and future of the experiment PS 170 (anti pp → e+e-)

    International Nuclear Information System (INIS)

    Duclos, J.

    1985-03-01

    The LEAR experiment PS170 is designed to detect the e +- pairs from anti p-annihilation. It aims to measure the proton form factors in the time like region and the spectrum of vector mesons in the mass range: 1-1,6 GeV. Data have been taken at 300, 600 and 1500 MeV/c incident momenta. The analysis of the 300 MeV/c data gave 200 2-body events: (anti pp → e + e - ), clearly separated from the hadronic background. Values of the form factors are extracted near threshold. The next step will be to accumulate sufficient data to measure separately the electric and magnetic components up to 600 MeV/c. The use of an internal target is considered for measurements at high momenta

  2. Final summary report of fuel-dynamics tests H2 and E4

    International Nuclear Information System (INIS)

    Doerner, R.C.; Rothman, A.B.; De Volpi, A.; Dickerman, C.E.; Deitrich, L.W; Stahl, D.; Murphy, W.F.

    1976-02-01

    Results of two failure experiments using LMFBR-type fuel during simulated unprotected transient overpower accidents are reported and analyzed. In both experiments, a single fresh fuel pin in a Mark-IIA loop was subjected to a temperature-limited, step-reactivity irradiation in the TREAT reactor. Total energy was 490 MJ in Test H2 and 690 MJ in Test E4. Except for their timing, the sequence of events in the failure scenario was the same for both tests. Local coolant boiling began 25-50 msec before failure. Significant upward fuel flow in the center of the pin started as early as 100 msec before cladding failure. Cladding failure was due to melting after contact with molten fuel and occurred at the top of the fuel column. Formation of an outlet flow-channel blockage began about 10 msec after failure and was complete by 50 msec. Inlet blockage began later and was less extensive. No significant amount of fuel sweepout was observed. Fuel remains separated into a small group of 50-1000-μm fragments and a macroscopic group of chunks and clinkers. The final distribution of fuel remains may have resulted from a delayed fuel/steel interaction in the inlet region

  3. Assessing the User Experience of E-Books in Academic Libraries

    Science.gov (United States)

    Zhang, Tao; Niu, Xi; Promann, Marlen

    2017-01-01

    We report findings from an assessment of e-book user experience (search and information seeking) from usage data and user tests. The usage data showed that most reading sessions were brief and focused on certain pages, suggesting that users mainly use e-books to find specific information. The user tests found that participants tended to use…

  4. Two-particle correlations at FNAL and ISR energies

    International Nuclear Information System (INIS)

    Darriulat, P.

    1975-01-01

    Some recent experimental results concerning the cluster structure of hadronic final states at high incident energies are reviewed. Results of experiments on angular correlations, both rapidity correlations and joint azimuth-rapidity correlations, in the central region, are discussed. Recent evidence for local compensation of charges and new data on resonance production are reviewed. Leading and high transverse momentum clusters, in as much as they may somehow be related to central clusters, are dealt with briefly. (U.K.)

  5. Emoções e pesquisa narrativa: transformando experiências de aprendizagem

    Directory of Open Access Journals (Sweden)

    Rodrigo Aragão

    2008-01-01

    Full Text Available Este artigo explora a influência de uma pesquisa narrativa nas experiências de aprendizagem de estudantes de Letras/Inglês. Ao refletir sobre suas histórias de aprendizagem, eles deram voz e sentido às suas experiências, sentindo-se valorizados. Suas histórias de aprendizagem expõem a relevância das emoções no desenvolvimento de habilidades orais, na reflexão e na responsabilidade por sua trajetória profissional. Três participantes transformaram suas experiências de aprendizagem de inglês ao refletir sobre as emoções que limitam seu desempenho oral e ao projetar imagens que representassem o desejo de se tornarem falantes fluentes. Porém, transformar os desejos em ações pode envolver investimentos que extrapolam a tomada de consciência na reflexão pela pesquisa.This article explores the influence of a narrative research on the language learning experiences of undergraduate students of English. As they reflect upon their language learning histories, they give voice and meaning to their experiences and their self-esteem improves. Their language learning histories reveal the relevance of emotions in their oral skills development, reflection, and responsibility for their professional trajectories. Three participants transformed their language experiences by reflecting on the emotions that restrained their speaking skills and projecting images that would represent their desire to become fluent speakers. However, transforming their desires into actions entails dealing with investments that may go beyond reflection fostered by this research.

  6. Experimental and theoretical high energy physics research. [UCLA

    Energy Technology Data Exchange (ETDEWEB)

    Buchanan, Charles D.; Cline, David B.; Byers, N.; Ferrara, S.; Peccei, R.; Hauser, Jay; Muller, Thomas; Atac, Muzaffer; Slater, William; Cousins, Robert; Arisaka, Katsushi

    1992-01-01

    Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e{sup +}e{sup {minus}} analysis, {bar P} decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the {phi} factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K{sub L}{sup 0} {yields} {pi}{sup 0}{gamma}{gamma} and {pi}{sup 0}{nu}{bar {nu}}, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R D.

  7. Experimental and theoretical high energy physics research. Annual progress report, September 1, 1991--September 31, 1992

    Energy Technology Data Exchange (ETDEWEB)

    1992-10-01

    Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e{sup +}e{sup {minus}} analysis, {bar P} decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the {phi} factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K{sub L}{sup 0} {yields} {pi}{sup 0}{gamma}{gamma} and {pi}{sup 0}{nu}{bar {nu}}, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R & D.

  8. Experimental and theoretical high energy physics research

    International Nuclear Information System (INIS)

    1992-01-01

    Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e + e - analysis, bar P decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the φ factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K L 0 → π 0 γγ and π 0 ν bar ν, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R ampersand D

  9. Usabilidade e user experience: essencial para aceitabilidade de produtos e serviços

    Directory of Open Access Journals (Sweden)

    Antonio Mendes Silva Filho

    2011-11-01

    Full Text Available Usabilidade é um atributo de qualidade essencial que tem sido usado pelas empresas para conquistar novos consumidores. E, você quando busca adquirir um novo produto (ou serviço, você intenciona (a atingir objetivos (que atendam suas necessidades num determinado contexto; (b eficiência (obtendo um resultado ou solução, de modo eficiente e produtivo, para um problema que tenha em mãos; e (c satisfação (de maneira subjetiva no uso do produto ou serviço. Esses três aspectos destacados compreendem os fatores, utilizados pela Norma 9241-11 da ISO (International Organization for Standardization para definir a usabilidade. De acordo com a Norma 9241-11 da ISO (International Organization for Standardization, a usabilidade é definida como “The extent to which a product can be used by specified users to achieve specified goals with effectiveness, efficiency, and satisfaction in a specified context of use”. Esses objetivos compreendem a base do que é denominado “user experience”. Mas, o que é user experience? Trata-se da experiência do usuário quando interage com produtos ou serviços. Um produto pode ser qualquer coisa como, por exemplo, um tablet, um aparelho celular ou smartphone, um painel de automóvel ou software. Qualquer desses produtos ou até serviços (como oferecidos em web sites, têm a usabilidade como atributo determinante da qualidade perceptível aos usuários. Nesse sentido, o objetivo deste artigo é discutir a usabilidade e estratégias de sua avaliação.

  10. Progress report of a research program in experimental high energy physics. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Lanou, R.E. Jr.

    1984-01-01

    An experimental program in strong and electro-weak interaction physics of elementary particles is being carried out using electronic detection techniques. Experiments have been performed or are being prepared utilizing the accelerators of the laboratories at Brookhaven and Fermilab. The experiments described in this report by the Electronic Detector Group include the following: (1) experiments to measure neutrino-electron scattering and other neutral current phenomena, (2) preparations for experiments at the FNAL anti P P Collider, (3) neutrino oscillation experiments at BNL, and (4) a monopole search

  11. Perfil sociodemográfico e de experiências anômalas em indivíduos com vivências psicóticas e dissociativas em grupos religiosos Sociodemographic and anomalous experiences profile in subjects with psychotic and dissociative experiences in religious groups

    Directory of Open Access Journals (Sweden)

    Adair Menezes Jr.

    2012-01-01

    Full Text Available CONTEXTO: Vivências psicóticas e dissociativas não patológicas são comuns na população geral, especialmente em grupos religiosos. Há poucos estudos sobre o perfil da população não clínica com essas vivências, bem como há dúvidas sobre critérios para o diagnóstico diferencial dessas experiências. OBJETIVOS: Identificar o perfil sociodemográfico e de experiências anômalas (EA entre pessoas que buscaram ajuda em centros espíritas. MÉTODOS: Foram entrevistadas 115 pessoas que procuraram auxílio em seis centros espíritas de Juiz de Fora/MG por causa de vivências psicóticas e/ou dissociativas. Entrevista semiestruturada investigou dados sociodemográficos, experiências anômalas apresentadas e a presença de critérios propostos para identificar experiências espirituais não patológicas. RESULTADOS: Predomínio de mulheres (70%, de meia-idade, com alta escolaridade, ativas ocupacionalmente e cujas EA começaram na infância (65% ou adolescência (23%. As EA mais frequentes foram alucinações visuais (63%, auditivas (54%, "percepção espiritual" (53%, "sonhos paranormais" (38% e experiências fora do corpo (31%. Para a maioria da amostra, essas EA não traziam prejuízos sócio-ocupacionais, eram curtas, episódicas e benéficas; entretanto referiram sofrimento emocional e falta de controle sobre elas. CONCLUSÃO: A alta frequência e diversidade de EA encontradas, bem como suas implicações teóricas, clínicas e de saúde pública, indicam a urgência de maior atenção a esse tópico.BACKGROUND: Non-pathological psychotic and dissociative experiences are frequent in the general population, particularly in religious groups. There are few studies on the profile of non-clinical populations with these experiences, and on criteria for differential diagnosis. OBJECTIVES: To identify the sociodemographic profile and anomalous experiences (AE among people who sought help in spiritualist groups. METHODS: We interviewed 115

  12. Progress report of a research program in experimental high energy physics

    International Nuclear Information System (INIS)

    Lanou, R.E. Jr.; Cutts, D.

    1990-01-01

    An experimental program in strong and electro-weak interaction physics of elementary particles is being carried out using electronic detection techniques. Experiments have been performed at Brown, Brookhaven, and Fermilab. The work described in this report by the Electronic Detector Group addresses the following: neutrino interactions and intrinsic properties, preparations for experiments (''D--ZERO'') at the FNAL 2 TeV bar pp Collider, new detection techniques for neutrino properties

  13. A research program in experimental high energy physics: Task C, Progress report

    International Nuclear Information System (INIS)

    Lanou, R.E. Jr.; Cutts, D.

    1988-01-01

    An experimental program in strong and electro-weak interaction physics of elementary particles is being carried out using electronic detection techniques. Experiments have been performed at Brown, Brookhaven, and Fermilab. The work described in this report by the /electronic Detector Group addresses the following: electroweak parameters via neutrino interactions, preparations for experiments (''D-ZERO'') at the FNAL 2 TeV /bar p/p Collider, new detection techniques for neutrino properties

  14. Empirical study on flow experience in China tourism e-commerce market

    Directory of Open Access Journals (Sweden)

    Jianling Wang

    2015-04-01

    Full Text Available Purpose: While tourism e-commerce develops rapidly in China, these channels are truly new to both web providers and web consumers, understanding the nature of these media attaches greater importance. This study investigates the mediation effects of flow experience on the relationship between motivation and behavior intention in tourism e-commerce.Design/methodology/approach: Based on the technology acceptance model, an empirical study is designed to test this relationship.we estimated the measurement model with 13 manifest indicators and 4 latent constructs by CFA to assess the reliability and validity of the construct measures, then tested hypotheses by OLS regression and a formal three-step mediation procedure.Findings: Overall, the results reveal that trust is incorporated in motivation and play it’s role together with other motivations; telepresence and concentration are confirmed in flow experience, and both partially mediated the relationship.Research limitations/implications: This study demonstrates that to improve consumers’ usage adoption, marketers should pay much attention to not only consumers’ motivation but also the areas such as flow experience.Originality/value: This study takes flow experience as a new perspective to explore china tourism e-commerce, estimates its measurement and tests its roles between motivation and behavior intention.

  15. Review of e+e- experiments with PLUTO from 3 to 31 GeV

    International Nuclear Information System (INIS)

    Criegee, L.; Knies, G.

    1981-07-01

    The contributions of the PLUTO experiment to e + e - physics at collision energies in the range of 3-31 GeV are reviewed. The review briefly sketches the storage rings DORIS and PETRA at DESY, and describes the most important features of the PLUTO detector, of data processing, and of the analysis methods. It covers the physics results in the fields of electroweak interactions, of the heavy lepton tau and the search for still heavier leptons, of hadron production with evidence for quark and gluon jets, as well as multiparton effects, of UPSILON decays and their relation to QCD, and concludes with first results in high-energy photon-photon interactions. (orig.)

  16. An Electron Fixed Target Experiment to Search for a New Vector Boson A' Decaying to e+e-

    Energy Technology Data Exchange (ETDEWEB)

    Essig, Rouven; Schuster, Philip; /SLAC; Toro, Natalia; /Stanford U., Phys. Dept.; Wojtsekhowski, Bogdan; /Jefferson Lab

    2010-06-11

    We describe an experiment to search for a new vector boson A' with weak coupling {alpha}' {approx}> 6 x 10{sup -8} {alpha} to electrons ({alpha} = e{sup 2}/4{pi}) in the mass range 65 MeV < m{sub A'} < 550 MeV. New vector bosons with such small couplings arise naturally from a small kinetic mixing of the 'dark photon' A' with the photon - one of the very few ways in which new forces can couple to the Standard Model - and have received considerable attention as an explanation of various dark matter related anomalies. A' bosons are produced by radiation off an electron beam, and could appear as narrow resonances with small production cross-section in the trident e{sup +}e{sup -} spectrum. We summarize the experimental approach described in a proposal submitted to Jefferson Laboratory's PAC35, PR-10-009. This experiment, the A' Experiment (APEX), uses the electron beam of the Continuous Electron Beam Accelerator Facility at Jefferson Laboratory (CEBAF) at energies of {approx} 1-4 GeV incident on 0.5-10% radiation length Tungsten wire mesh targets, and measures the resulting e{sup +}e{sup -} pairs to search for the A' using the High Resolution Spectrometer and the septum magnet in Hall A. With a {approx} 1 month run, APEX will achieve very good sensitivity because the statistics of e{sup +}e{sup -} pairs will be {approx} 10,000 times larger in the explored mass range than any previous search for the A' boson. These statistics and the excellent mass resolution of the spectrometers allow sensitivity to {alpha}'/{alpha} one to three orders of magnitude below current limits, in a region of parameter space of great theoretical and phenomenological interest. Similar experiments could also be performed at other facilities, such as the Mainz Microtron.

  17. Controlled Experiment Replication in Evaluation of E-Learning System's Educational Influence

    Science.gov (United States)

    Grubisic, Ani; Stankov, Slavomir; Rosic, Marko; Zitko, Branko

    2009-01-01

    We believe that every effectiveness evaluation should be replicated at least in order to verify the original results and to indicate evaluated e-learning system's advantages or disadvantages. This paper presents the methodology for conducting controlled experiment replication, as well as, results of a controlled experiment and an internal…

  18. The Social & Mobile Learning Experiences of Students Using Mobile E-Books

    Science.gov (United States)

    Kissinger, Jeff S.

    2013-01-01

    This research was designed to explore the learning experiences of state college students using mobile electronic textbook (e-book) readers. The purpose of the study was to build a rich description of how students used e-books delivered on mobile computing devices for college-level, introductory

  19. Cross section measurements for quasi-elastic neutrino-nucleus scattering with the MINOS near detector

    Energy Technology Data Exchange (ETDEWEB)

    Dorman, Mark Edward [Univ. College London, Bloomsbury (United Kingdom)

    2008-04-01

    The Main Injector Neutrino Oscillation Search (MINOS) is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory (FNAL) in Chicago, Illinois. MINOS measures neutrino interactions in two large iron-scintillator tracking/sampling calorimeters; the Near Detector on-site at FNAL and the Far Detector located in the Soudan mine in northern Minnesota. The Near Detector has recorded a large number of neutrino interactions and this high statistics dataset can be used to make precision measurements of neutrino interaction cross sections. The cross section for charged-current quasi-elastic scattering has been measured by a number of previous experiments and these measurements disagree by up to 30%. A method to select a quasi-elastic enriched sample of neutrino interactions in the MINOS Near Detector is presented and a procedure to fit the kinematic distributions of this sample and extract the quasi-elastic cross section is introduced. The accuracy and robustness of the fitting procedure is studied using mock data and finally results from fits to the MINOS Near Detector data are presented.

  20. Cross section measurements for quasi-elastic neutrino-nucleus scattering with the MINOS near detector

    International Nuclear Information System (INIS)

    Dorman, Mark Edward

    2008-01-01

    The Main Injector Neutrino Oscillation Search (MINOS) is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory (FNAL) in Chicago, Illinois. MINOS measures neutrino interactions in two large iron-scintillator tracking/sampling calorimeters; the Near Detector on-site at FNAL and the Far Detector located in the Soudan mine in northern Minnesota. The Near Detector has recorded a large number of neutrino interactions and this high statistics dataset can be used to make precision measurements of neutrino interaction cross sections. The cross section for charged-current quasi-elastic scattering has been measured by a number of previous experiments and these measurements disagree by up to 30%. A method to select a quasi-elastic enriched sample of neutrino interactions in the MINOS Near Detector is presented and a procedure to fit the kinematic distributions of this sample and extract the quasi-elastic cross section is introduced. The accuracy and robustness of the fitting procedure is studied using mock data and finally results from fits to the MINOS Near Detector data are presented

  1. Making music out of noise. The Sentara Healthcare Experience Implementing e-Care.

    Science.gov (United States)

    Abraham, Chon; Reese, Bertram

    2010-01-01

    This paper describes insights from the an implementation experience with a project titled eCare, a comprehensive health IT solution integrating all environments of care and the primary business functions at Sentara Healthcare, the largest system in southeastern Virginia and northeastern North Carolina. eCare is expected to account for more than $16 million by the end of 2009, from realized benefits in quality of care, process efficiencies and firm performance. Made evident by Sentara's experience, eCare-type technology may be as much of a market differentiator for healthcare as the ATM was for banking industry, but prudent management in the implementation process is key.

  2. Search for exotic baryons in 800 GeV/c pp → pX

    Science.gov (United States)

    Christian, D. C.; Felix, J.; Gottschalk, E. E.; Gutierrez, G.; Hartouni, E. P.; Knapp, B. C.; Kreisler, M. N.; Moreno, G.; Reyes, M. A.; Sosa, M.; Wang, M. H. L. S.; Wehmann, A.

    2006-05-01

    We present preliminary results of the search for the pentaquark candidates Θ(1540) and Ξ(1862) using data from Fermilab experiment E690 in the reaction pp → pX at 800 GeV/c. We find that production of pentaquark resonances is heavily suppressed with respect to the production of normal baryon and antibaryon resonances.

  3. Search for exotic baryons in 800 GeV/c pp {yields} pX

    Energy Technology Data Exchange (ETDEWEB)

    Christian, D C [Fermi National Accelerator Laboratory, Batavia, Illinois (United States); Felix, J [University of Guanajuato, Leon, Guanajuato (Mexico); Gottschalk, E E [Fermi National Accelerator Laboratory, Batavia, Illinois (United States); Gutierrez, G [Fermi National Accelerator Laboratory, Batavia, Illinois (United States); Hartouni, E P [Lawrence Livermore National Laboratory, Livermore, California (United States); Knapp, B C [Columbia University, Nevis Laboratory, New York (United States); Kreisler, M N [University of Massachusetts, Amherst, Massachusetts (United States); Moreno, G [University of Guanajuato, Leon, Guanajuato (Mexico); Reyes, M A [University of Guanajuato, Leon, Guanajuato (Mexico); Sosa, M [University of Guanajuato, Leon, Guanajuato (Mexico); Wang, M H L S [Fermi National Accelerator Laboratory, Batavia, Illinois (United States); Wehmann, A [Fermi National Accelerator Laboratory, Batavia, Illinois (United States)

    2006-05-15

    We present preliminary results of the search for the pentaquark candidates {theta}(1540) and {xi}(1862) using data from Fermilab experiment E690 in the reaction pp {yields} p{sup X} at 800 GeV/c. We find that production of pentaquark resonances is heavily suppressed with respect to the production of normal baryon and antibaryon resonances.

  4. Calibrating the CERN ATLAS Experiment with $E/p$

    CERN Document Server

    Froeschl, R; Aleksa, M

    2009-01-01

    Inside the ATLAS experiment two proton beams will collide with a center of mass energy of 14 TeV. These proton beams will be delivered with unprecedented high collision rates by the Large Hadron Collider (LHC) at the European Center of Particle Physics, CERN. For important parts of the physics program of ATLAS, e.g. the search for the Higgs boson, the performance of the electromagnetic calorimeter, whose primary task is to measure the energy of electrons and photons, is crucial. The main topic of this thesis is the intercalibration of the energy scale of the electromagnetic calorimeter and the momentum scale of the inner detector. This is an important consistency test for these two detectors. The intercalibration is performed by investigating the ratio E/p for electrons, i.e. the ratio of the energy E measured by the electromagnetic calorimeter and the momentum p measured by the inner detector. The starting point is the Combined Test Beam (CTB) 2004, where a segment of the ATLAS detector was exposed to differ...

  5. Study of the granular electromagnetic calorimeter with PPDs and scintillator strips for ILC

    Energy Technology Data Exchange (ETDEWEB)

    Kotera, Katsushige, E-mail: coterra@azusa.shinshu-u.ac.j [Shinshu University, Asahi 3-1-1, Matsumoto 390-8621 (Japan)

    2011-02-01

    A prototype module of a fine-granular electromagnetic calorimeter has been constructed by the CALICE collaboration and tested in the period August-September 2008 at the FNAL meson beam test facility. The calorimeter is one of the proposed concepts for a highly granular electromagnetic calorimeter for the International Linear Collider (ILC) experiment, which is designed to have an effective 10 mmx10 mm lateral segmentation using 10 mmx45 mm scintillator strips. The strips in the 15 odd layers are orthogonal with respect to those in the 15 even layers. A total of 2160 strip scintillators are individually read out using a Pixelated Photon Detector (PPD) or MPPC. As a preliminary result of the first stage analysis, we obtain a relative energy resolution for single electrons of {sigma}{sub E}/E=(15.15{+-}0.03)%/{radical}(E{sub beam}(GeV))+(1.44{+-}0.02)%, the quoted uncertainties are purely statistical.

  6. Providing pervasive Learning eXperiences by Combining Internet of Things and e-Learning standards

    Directory of Open Access Journals (Sweden)

    Aroua TAAMALLAH

    2015-12-01

    Full Text Available Nowadays, learning is more and more taking place anywhere and anytime. This implies that e-learning environments are expanded from only virtual learning environments to both virtual and physical ones. Thanks to the evolution of Internet, ICT (Information and Communication Technology and Internet of Things, new learning scenarios could be experienced by learners either individually or collaboratively. These learning scenarios are Pervasive in such a way that they allow to mix virtual and physical learning environments as well. They are therefore characterized by possible interactions of the learner with the physical environment, the Learner's contextual data detection as well as the adaptation of pedagogical strategies and services according to this context. This paper aims to take advantage of this trend and keep up also with existing e-Learning standards such as IMS LD and LOM. The solution proposed is therefore to extend these standards models with that of Internet of Things and to provide an adaptation approach of learning activities based on learner's context and her/his track using the eXperience API. In this context and in order to allow both reasoning capabilities and interoperability between the proposed models Ontological representations and implementation are therefore proposed. Moreover a technical architecture highlighting the required software components and their interactions is provided. And finally, a relevant pervasive learning scenario is implemented and experimented.

  7. Fermilab Education Office - Contacts

    Science.gov (United States)

    Search The Office of Education and Public Outreach: Contacts All telephone numbers require area code Presentations for Presenters 840-3094 Office of Education and Public Outreach Spencer Pasero spasero@fnal.gov Education Office 840-3076 Fermilab Friends for Science Education General Questions Susan Dahl sdahl@fnal.gov

  8. SUBJETIVIDADE, AMIZADE E MONTANHISMO: potencialidades das experiências de lazer e aventura na natureza

    Directory of Open Access Journals (Sweden)

    Sandoval Vilaverde Monteiro

    2004-01-01

    Full Text Available O principal objetivo do texto consiste em problematizar as práticas corporais vivenciadas como lazer e aventura em ambientes naturais, em especial aquelas ligadas ao montanhismo, buscando pensá-las no contexto das formas contemporâneas de sociabilidade e processos de subjetivação, indagando sobre os liames sociais suscitados a partir da relação com tais práticas. A partir dos dados provenientes do contexto dos grupos estudados, bem como do referencial teórico adotado, sustenta-se o argumento de que o envolvimento com estas práticas coletivas de lazer e aventura na natureza pode, em algumas situações, ser entendido como experiências existenciais férteis para o exercício de uma relação renovada do sujeito consigo mesmo, com o outro e com a natureza. Este exercício faculta aos sujeitos envolvidos a possibilidade de vivenciar processos renovados de subjetivação coletiva, podendo resultar em formas de amizade mais solidárias, livres e criativas. Palavras-chaves: subjetividade, amizade, lazer, natureza

  9. Mestres do Tao: tradição, experiência e etnografia

    Directory of Open Access Journals (Sweden)

    José Bizerril Neto

    2005-12-01

    Full Text Available Neste artigo analiso a dimensão performática constitutiva da transmissão da tradição em uma linhagem taoísta no Brasil, partindo de uma perspectiva baseada na antropologia da experiência. A idéia de conhecimento no taoísmo baseia-se em uma noção pragmática: conhece-se por experiência pessoal corporificada o legado da tradição. A possibilidade de conhecer está fundada em uma relação pessoal entre mestre e aprendiz, inserida em uma cadeia dialógica e genealógica.In this article I analyse the performative dimension that constitutes the transmission of tradition in taoist lineage located in Brazil, from the perspective of the anthropology of experience. The idea of knowing in taoism is based on a practical notion: one knows the legacy of tradition through personal embodied experience. The very possibility of knowing is based upon a personal relation between master and apprentice, inserted on a dialogical and genealogical.

  10. Contatos imediatos: investigando personalidade, transtornos mentais e atribuição de causalidade em experiências subjetivas com óvnis e alienígenas

    OpenAIRE

    Leonardo Breno Martins

    2012-01-01

    Esta pesquisa compara pessoas que alegam experiências anômalas e que não as alegam quanto aos cinco grandes fatores da personalidade, indicadores de transtornos mentais e atribuições de causalidade. O recorte incide sobre experiências caracteristicamente contemporâneas, que mencionam objetos voadores não-identificados (óvnis) e eventos correlatos, como alegadas visões de alienígenas. As variáveis foram escolhidas para o estudo devido ao seu papel teórico na edificação das experiências e aos a...

  11. Association of eHealth literacy with cancer information seeking and prior experience with cancer screening.

    Science.gov (United States)

    Park, Hyejin; Moon, Mikyung; Baeg, Jung Hoon

    2014-09-01

    Cancer is a critical disease with a high mortality rate in the US. Although useful information exists on the Internet, many people experience difficulty finding information about cancer prevention because they have limited eHealth literacy. This study aimed to identify relationships between the level of eHealth literacy and cancer information seeking experience or prior experience with cancer screening tests. A total of 108 adults participated in this study through questionnaires. Data covering demographics, eHealth literacy, cancer information seeking experience, educational needs for cancer information searching, and previous cancer screening tests were obtained. Study findings show that the level of eHealth literacy influences cancer information seeking. Individuals with low eHealth literacy are likely to be less confident about finding cancer information. In addition, people who have a low level of eHealth literacy need more education about seeking information than do those with a higher level of eHealth literacy. However, there is no significant relationship between eHealth literacy and cancer screening tests. More people today are using the Internet for access to information to maintain good health. It is therefore critical to educate those with low eHealth literacy so they can better self-manage their health.

  12. Search for νμ→νe oscillations in the NOMAD experiment

    International Nuclear Information System (INIS)

    Krasnoperov, A.

    2000-06-01

    The NOMAD experiment is looking for ν μ →ν τ and ν→ν e oscillations in a predominantly ν μ beam at the CERN SPS. Neutrino oscillations are closely related with the existence of non-zero neutrino mass and mixing between different flavours. This document describes the search for ν μ →ν e oscillations in the full NOMAD data sample accumulated during four years of data-taking (1995-98). The search for ν e appearance was performed by studying the charged current (CC) interactions with in the NOMAD detector. The selection of ν e CC and ν μ interactions with the help of different particle identification algorithms, as well as using the event kinematic criteria, is described here in detail. We show that the NOMAD experiment is sensitive to the LSND allowed region of oscillation parameters with the squared mass difference larger than 10 eV 2 /C 4 . An upper limit on the probability of ν μ →ν e oscillations, based on a fraction of the NOMAD data, is given. (author)

  13. Flex-prints for the Mu3e experiment

    Energy Technology Data Exchange (ETDEWEB)

    Dittmeier, Sebastian [Physikalisches Institut, Universitaet Heidelberg (Germany); Collaboration: Mu3e-Collaboration

    2016-07-01

    Mu3e is a novel experiment dedicated to the search for the charged lepton flavor violating decay μ{sup +} → e{sup +}e{sup -}e{sup +} with a targeted sensitivity of a branching ratio (BR) down to 10{sup -16}. Within the standard model of particle physics this process is extremely suppressed to BR<10{sup -54}. Thus, any observation would be a clear sign for new physics beyond the standard model. The Mu3e detector consists of a silicon pixel tracking detector using the novel HV-MAPS (High Voltage Monolithic Active Pixel Sensor) technology to measure the momentum of the decay products, and scintillating fibres and tiles for precise timing. The pixel sensors are thinned to 50 μ m to achieve a material budget of about 0.1% radiation length per tracking layer. The pixel sensors are powered and connected to readout frontend boards using custom designed flex-prints, which are low material interconnects with a high signal density. We present studies of high speed data transmission up to 3.2 Gb/s over flex-print prototypes produced in-house. The design of the flex-prints for the Mu3e detector will be discussed. A 3-layer design including power, ground and slow control distribution, as well as 9 1.25 Gb/s data transmission lines for the readout of the pixel sensors is foreseen.

  14. Precise measurement in elastic electron scattering: HAPPEX and E-158 experiments

    International Nuclear Information System (INIS)

    Vacheret, A.

    2004-12-01

    Parity Violation asymmetry measurements in elastic electron scattering are in one hand an interesting way of retrieving new informations about the sea quarks of the nucleon and in the other hand a powerful test of the Standard Model electroweak sector at low energy. This thesis describes the HAPPEX experiment at JLab and the E-158 experiment at SLAC (USA) which measure de parity violation asymmetries in elastic scattering of polarized electron on nuclei like Hydrogen or Helium and on atomic electrons. With the measurements on hadronic targets one can extract the strange quarks contribution to the charge and current density of the nucleon. With the electron-electron scattering one can test the standard model at the loop level and far from the Z pole by extracting sin 2 θ W . In this thesis we describe the formalism associated with the electroweak probe. We present in detail the experimental methods used to make such precise measurements of parity violation asymmetry. Then, we describe the experimental set-up of each experiment and in particular the electron detector and the feedback loop on the beam current for the HAPPEX experiment and the analysis of E-158 run III with a dedicated systematic study on the beam sub-pulse fluctuations. We present the preliminary results for each experiment with a comparison with the other existing results and the future experiments. (author)

  15. Beam Extinction Monitoring in the Mu2e Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Prebys, Eric [Fermilab; Bartoszek, Larry [Technicare; Gaponenko, Andrei [Fermilab; Kasper, Peter [Fermilab

    2015-06-01

    The Mu2e Experiment at Fermilab will search for the conversion of a muon to an electron in the field of an atomic nucleus with unprecedented sensitivity. The experiment requires a beam consisting of proton bunches approximately 200ns FW long, separated by 1.7 microseconds, with no out-of-time protons at the 10⁻¹⁰ fractional level. The verification of this level of extinction is very challenging. The proposed technique uses a special purpose spectrometer which will observe particles scattered from the production target of the experiment. The acceptance will be limited such that there will be no saturation effects from the in-time beam. The precise level and profile of the out-of-time beam can then be built up statistically, by integrating over many bunches.

  16. Feasibility of 81Br(nu,e-)81Kr solar neutrino experiment

    International Nuclear Information System (INIS)

    Hurst, G.S.; Allman, S.L.; Chen, C.H.; Kramer, S.D.; Thomson, J.O.; Cleveland, B.

    1985-05-01

    Several ingenious solutions have been offered for the solar neutrino problem - a defect in the solar model, the appearance of a new type of neutrino physics, the sun is no longer burning, etc. The range of these proffered solutions stresses the need for a new experiment to study the sun. The modern pulsed laser now makes possible a new solar neutrino test which examines an independent neutrino source in the sun. A recently proposed experiment would use the reaction 81 Br(nu,e - ) 81 Kr to measure the flux of 7 Be neutrinos from the sun. When 7 Be decays by electron capture to make 7 Li, a neutrino is emitted at 0.862 MeV and the flux of these on the earth is about 4 x 10 9 cm -2 s -1 , according to the standard model. Therefore, an experiment based on 81 Br(nu,e - ) 81 Kr which is sensitive to these lower energy neutrinos would be of fundamental importance. To first order, the chlorine experiment detects the 8 B neutrinos while bromine detects the much more abundant 7 Be neutrino source. In practice, the proposed bromine experiment would be very similar to the chlorine radiochemical experiment, except that 81 Kr with a half-life of 2 x 10 5 years cannot be counted by decay methods. With an experiment of about the same volume as the chlorine experiment (380 m 3 ) filled with CH 2 Br 2 , the model predicts about 2 atoms of 81 Kr per day. The bromine experiment depends entirely on the RIS method, implemented with pulsed lasers, for its success. 10 refs., 3 figs

  17. Search for charginos and neutralinos in the like sign dimuon channel with the D0-FNAL experiment; Recherche de charginos et neutralinos dans le canal dimuon de meme signe aupres de l'experience D0-FNAL

    Energy Technology Data Exchange (ETDEWEB)

    Lesne, V

    2006-07-15

    In the framework of the mSUGRA model which provides a simple breaking mechanism of supersymmetry, sparticles with masses beyond the kinematic reach of the LEP-II experiments may be produced at the Tevatron pp-bar collider at a center of mass energy of 1.96 TeV. A promising source of sparticles at the Tevatron collider is the associated production of the lightest chargino, {chi}-tilde{sub 1}{sup {+-}}, and the next to lightest neutralino, {chi}-tilde{sub 2}{sup 0}. Leptonic decay modes, {chi}-tilde{sub 2}{sup 0} {yields} {chi}-tilde{sub 1}{sup 0}l{sup +}l{sup -} and {chi}-tilde{sub 1}{sup {+-}}l{sup {+-}}{nu}{sub l}, lead to a clean detector signature with three leptons and a large amount of missing transverse energy. In order to increase the sensitivity to signal in regions of mSUGRA parameters space leading to a very soft third lepton with small reconstruction efficiency, a selection based on 2 like sign leptons plus missing transverse energy has been developed. The particular signature with 2 like sign muons is presented in this work. No evidence for supersymmetry has been observed in a dataset collected from April 2002 to February 2006 with the D0 detector at the Tevatron collider and corresponding to an integrated luminosity of 0.9 fb{sup -1}. Then, limits on the product of the cross-section and the 3-leptonic branching ratio, {sigma}(pp-bar {yields} {chi}-tilde{sub 1}{sup {+-}}{chi}-tilde{sub 2}{sup 0}) * BR(3l), have been set as a function of the {chi}-tilde{sub 1}{sup {+-}} mass. The results obtained with the like sign dimuon selection have been combined with the results of three tri-lepton selections. For mSUGRA models with enhanced leptonic decays, a {chi}-tilde{sub 1}{sup {+-}} mass limit of 140 GeV/c{sup 2} has been derived at 95% confidence level. (author)

  18. Weak mixing and CP-violation involving heavy quarks and possible measurements in e+e- experiments

    International Nuclear Information System (INIS)

    Ali, A.; Aydin, Z.Z.

    1978-09-01

    We evaluate weak mass mixing among the neutral heavy mesons with a bottom (Q = -1/3) or top (Q = +2/3) quark and CP-violation in the frame work of six quark (V - A) models. It is argued that bottom and top mesons may distinguish the Higgs exchange mechanism of CP-violation from a complex phase in the quark mass matrix, if bottom and top quark masses are sufficiently different. Estimates of weak mixing-and CP-violating effects for e + e - experiments at PETRA, PEP and CESR energies are presented. (orig.) [de

  19. As práticas educativas parentais e a experiência das crianças Parental education practices and children's experience

    Directory of Open Access Journals (Sweden)

    Cléopâtre Montandon

    2005-08-01

    Full Text Available Este artigo tenta mostrar o quanto é importante estudar a experiência das crianças e seus pontos de vista para podermos compreender os diferentes fenômenos sociais que lhes dizem respeito. Na perspectiva da sociologia da infância, sua experiência é considerada no âmbito das estruturas sociais e do contexto particular nos quais se insere. A partir de vários exemplos no campo da educação de crianças, a autora argumenta que não basta examinar as práticas educativas de seus educadores, mas que é necessário compreender as perspectivas das crianças ou, dito de modo mais simples, que importa analisar não apenas o que os educadores fazem com as crianças, como também o que estas fazem com o que se faz com elas. Duas pesquisas são apresentadas para apoiar essa abordagem: a primeira diz respeito à experiência que as crianças têm de sua educação no âmbito familiar e escolar; a segunda trata de um objetivo particular dos educadores modernos: o desenvolvimento da autonomia das crianças. Em ambos os estudos, a experiência das crianças foi apreendida por intermédio de suas representações, emoções e ações, e foi situada segundo suas características sociais e culturais.This paper tries to show that the experience of children and their points of view are paramount when one wants to understand the various social phenomena that concern them. According to the perspective of the Sociology of Childhood, children's experience is analyzed in the framework of the social structures and the particular contexts in which it takes place. Using different examples from the field of the education of children, the author argues that it is not sufficient to examine the educational practices of adults; it is equally important to examine the children's perspective. In other words, we should take into consideration what the children do with what is done to them. Two studies are presented to support this approach: the first one concerns the

  20. Preliminary experiments to simulate glass/electrode interactions within a Joule Ceramic Melter

    International Nuclear Information System (INIS)

    Dalton, J.T.; Paige, E.L.; Sutcliffe, P.W.

    1986-01-01

    Preliminary isothermal corrosion tests have been made on Inconel 690 coupon samples immersed in Harvest II M9 glass with and without excess additions of Li 2 O (1.5%) and RuO 2 (20%) together with TeO 2 (2%) at 1200 0 C for periods up to 100 hours. Inconel 690 corrosion and the products and ruthenium redox conditions within the glass approximate to those observed in the 1/3rd scale Joule Ceramic Melter operations. Corrosion takes place by an oxidation mechanism to form a chromium-rich surface oxide, and dissolution of this surface oxide by the surrounding glass. Additions of excess Li 2 O increase the corrosion rate of Inconel 690, whereas RuO 2 + TeO 2 are neutral. The latter however have a marked effect in lowering the room temperature resistivity by at least 5 orders of magnitude even though relatively small fraction of the RuO 2 precipitates were reduced to ruthenium metal. (author)

  1. Experiência subjetiva do tempo e sua influência no comportamento: revisão e modelos

    Directory of Open Access Journals (Sweden)

    Alejandro Vásquez Echeverría

    Full Text Available Pesquisadores têm tentado explicar, desde o início da psicologia, a experiência temporal das pessoas e sua influência nas cognições, emoções e comportamentos. Trata-se de uma das dimensões mais complexas e influentes da psique, que tem sido abordada a partir de concepções diferentes e sem uma estrutura consensual. Este artigo tem o objetivo de contribuir na sistematização da psicologia do tempo, ampliando um modelo de quatro níveis, aprofundando na percepção do tempo vital ou tempo III. Trabalhos incluídos foram selecionados segundo a sua importância na historia da psicologia ou índice de citação. Sugere-se um modelo explicativo do Tempo III, que inclui discussão e debate e visa integrar os diferentes modelos existentes na literatura.

  2. Quark Energy Loss and Shadowing in Nuclear Drell-Yan Process

    Institute of Scientific and Technical Information of China (English)

    DUAN Chun-Gui; CUI Shu-Wen; YAN Zhan-Yuan

    2005-01-01

    The energy loss effect in nuclear matter is another nuclear effect apart from the nuclear effects on the parton distribution as in deep inelastic scattering process. The quark energy loss can be measured best by the nuclear dependence of the high energy nuclear Drell-Yan process. By means of three kinds of quark energy loss parameterizations given in literature and the nuclear parton distribution extracted only with lepton-nucleus deep inelastic scattering experimental data, measured Drell-Yan production cross sections are analyzed for 800 GeV proton incident on a variety of nuclear targets from FNAL E866. It is shown that our results with considering the energy loss effect are much different from those of the FNAL E866, who analyzes the experimental data with the nuclear parton distribution functions obtained by using the deep inelastic IA collisions and pA nuclear Drell-Yan data. Considering the existence of energy loss effect in Drell-Yan lepton pairs production, we suggest that the extraction of nuclear parton distribution functions should not include Drell-Yan experimental data.

  3. Quark Energy Loss and Shadowing in Nuclear Drell-Yan Process

    International Nuclear Information System (INIS)

    Duan Chungui; Cui Shuwen; Yan Zhanyuan

    2005-01-01

    The energy loss effect in nuclear matter is another nuclear effect apart from the nuclear effects on the parton distribution as in deep inelastic scattering process. The quark energy loss can be measured best by the nuclear dependence of the high energy nuclear Drell-Yan process. By means of three kinds of quark energy loss parameterizations given in literature and the nuclear parton distribution extracted only with lepton-nucleus deep inelastic scattering experimental data, measured Drell-Yan production cross sections are analyzed for 800 GeV proton incident on a variety of nuclear targets from FNAL E866. It is shown that our results with considering the energy loss effect are much different from those of the FNAL E866, who analyzes the experimental data with the nuclear parton distribution functions obtained by using the deep inelastic lA collisions and pA nuclear Drell-Yan data. Considering the existence of energy loss effect in Drell-Yan lepton pairs production, we suggest that the extraction of nuclear parton distribution functions should not include Drell-Yan experimental data.

  4. RF cogging in the FNAL Booster Accelerator

    International Nuclear Information System (INIS)

    William A. Pellico and Robert C. Webber

    2000-01-01

    The Fermilab Booster operates at a Radio Frequency (RF) harmonic number of 84 with beam in all buckets. One or two bunches of beam are systematically lost in the 8 GeV extraction process as beam is swept across a magnetic septum during the extraction kicker rise time. The prompt radiation and component activation resulting from this localized high energy beam loss become serious concerns as Booster beam throughput must be increased more than tenfold to meet the requirements of RUN II, NUMI, and MiniBooNE experiments. Synchronizing a gap in the beam to the firing of the extraction kickers, a relatively easy and standard practice in many machines, can eliminate the problem. This seemingly simple operation is greatly complicated in the Booster by the need to synchronize extraction to beam already circulating in the Main Injector. Coupled with the inflexibility of the Booster resonant magnetic cycle, cycle to cycle variations, and constraints inherent in the accelerator physics, that requirement forces active control of the gap's azimuthal position throughout the acceleration process as the revolution frequency sweeps rapidly. Until recently, the complexities of actually implementing and demonstrating this process in the Booster had not been worked out. This paper describes a successful demonstration of gap cogging in the Booster

  5. Legitimidade e não legitimidade das experiências dos sofrimentos e adoecimentos de longa duração

    OpenAIRE

    Canesqui, Ana Maria

    2018-01-01

    Resumo Discute-se a legitimidade e não legitimidade das experiências de adoecimentos e sofrimentos de longa duração selecionados, considerados ou não doenças pelos diagnósticos médicos, como a dor, a fadiga crônica e a “pressão alta”, usando pesquisas internacionais e nacionais sociológicas e antropológicas em saúde. As análises dos relatos de adoecidos ou de profissionais de saúde nas pesquisas consideradas exploram o assunto, suas implicações, reflexos e ambiguidades geradas nos sujeitos e ...

  6. Experimentos em bovinos com as favas de Enterolobium contortisiliquum e E. timbouva para verificar propriedades fotossensibilizantes e/ou abortivas Experiments in cattle with the pods of Enterolobium contortisiliquum e E. timbouva to determine photosensitive and abortive properties

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia

    1999-01-01

    Full Text Available Em função de históricos obtidos, no presente estudo tentou-se reproduzir, em bovinos, fotossensibilização e/ou aborto com as favas de Enterolobium spp (Leg. Mimosoi-deae. As favas de E. contortisiliquum e E. timbouva ("tamboril" ou "timbaúba", de diversas procedências, inclusive as colhidas durante dois surtos de intoxicação caracterizados por fotossensiblilização e aborto, foram administradas em doses únicas e repetidas, a bovinos jovens e a vacas em gestação. Em todos os experimentos realizados, a resposta à ingestão das favas independentemente da procedência, sempre foi caracterizada por diarréia e diminuição do apetite, passageiras. Também ficou evidente que os animais mostram menor sensibilidade, à medida que ingerem as favas seguidamente. Os experimentos não revelaram possíveis fatores envolvidos ou eventuais condições necessárias para que as favas de Enterolobium contortisiliquum e E. timbouva causem fotossen-siblização e/ou aborto.The pods of Enterolobium spp (Leg.Mimosoideae are said to cause photsensitivity and abortion in cattle. The pods of E. contortisiliquum and E. timbouva ("tamboril" or "timbaúba", collected at various localities, in two occasions during outbreaks of photosensitization and abortions, were fed in single and repeated doses to young bovines and to cows in calf. In all experiments the animals showed only diarrhoea and loss of apetite, as it had been already seen in previous experiments with E. contortisiliquum performed in Fortaleza, northeastern Brazil. Also it was seen again that the animals become tolerant to the toxicity of the pods if they get successive doses. The experiments did not reveal possible conditions necessary for the pods of Enterolobium contortisiliquum and E. timbouva to cause photosensitization and/or abortion.

  7. Etnografia como prática e experiência

    Directory of Open Access Journals (Sweden)

    José Guilherme Cantor Magnani

    2009-12-01

    Full Text Available Este artigo, a partir de alguns usos pouco ortodoxos da etnografia, fora do campo da antropologia, propõe uma discussão sobre a especificidade desse método de pesquisa, com base em pesquisas e reflexões realizadas sobre o tema no Núcleo de Antropologia Urbana da USP (NAU. Tomando como ponto de partida uma citação de Lévi-Strauss, repassa alguns autores - Goldman, Peirano, DaMatta, Favret-Saada, entre outros - para estabelecer parâmetros na busca de traços que considera específicos do fazer etnográfico e assim chega a três considerações principais: etnografia como experiência, como prática e com base numa certa noção de totalidade. O relato de uma etnografia sobre jovens surdos é apresentado para oferecer um suporte empírico àquelas conclusões.Considering some less orthodox uses of ethnography, not belonging to the anthropological field, this article proposes a discussion on the specificities of the ethnographical research method, based on reflections and researches undertaken at the Urban Anthropology Nucleus (NAU. Taking a Lévi-Strauss's quotation as its starting point, it examines the ideas of authors like Goldman, Peirano, Da Matta, Favret-Saada, among others, in order to establish parameters to guide the search for specific features in the ethnographic métier. Such a discussion leads to three considerations: ethnography as experience, as practice, and as based on a certain concept of "totality". The report of an ethnography on deaf young people is included in the article as empirical support to the conclusions.

  8. New measurement technique of ductility curve for ductility-dip cracking susceptibility in Alloy 690 welds

    Energy Technology Data Exchange (ETDEWEB)

    Kadoi, Kota, E-mail: kadoi@hiroshima-u.ac.jp [Graduate School of Engineering, Hiroshima University, 1-4-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8527 (Japan); Uegaki, Takanori; Shinozaki, Kenji; Yamamoto, Motomichi [Graduate School of Engineering, Hiroshima University, 1-4-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8527 (Japan)

    2016-08-30

    The coupling of a hot tensile test with a novel in situ observation technique using a high-speed camera was investigated as a high-accuracy quantitative evaluation method for ductility-dip cracking (DDC) susceptibility. Several types of Alloy 690 filler wire were tested in this study owing to its susceptibility to DDC. The developed test method was used to directly measure the critical strain for DDC and high temperature ductility curves with a gauge length of 0.5 mm. Minimum critical strains of 1.3%, 4.0%, and 3.9% were obtained for ERNiCrFe-7, ERNiCrFe-13, and ERNiCrFe-15, respectively. The DDC susceptibilities of ERNiCrFe-13 and ERNiCrFe-15 were nearly the same and quite low compared with that of ERNiCrFe-7. This was likely caused by the tortuosity of the grain boundaries arising from the niobium content of around 2.5% in the former samples. Besides, ERNiCrFe-13 and ERNiCrFe-15 indicated higher minimum critical strains even though these specimens include higher content of sulfur and phosphorus than ERNiCrFe-7. Thus, containing niobium must be more effective to improve the susceptibility compared to sulfur and phosphorous in the alloy system.

  9. New measurement technique of ductility curve for ductility-dip cracking susceptibility in Alloy 690 welds

    International Nuclear Information System (INIS)

    Kadoi, Kota; Uegaki, Takanori; Shinozaki, Kenji; Yamamoto, Motomichi

    2016-01-01

    The coupling of a hot tensile test with a novel in situ observation technique using a high-speed camera was investigated as a high-accuracy quantitative evaluation method for ductility-dip cracking (DDC) susceptibility. Several types of Alloy 690 filler wire were tested in this study owing to its susceptibility to DDC. The developed test method was used to directly measure the critical strain for DDC and high temperature ductility curves with a gauge length of 0.5 mm. Minimum critical strains of 1.3%, 4.0%, and 3.9% were obtained for ERNiCrFe-7, ERNiCrFe-13, and ERNiCrFe-15, respectively. The DDC susceptibilities of ERNiCrFe-13 and ERNiCrFe-15 were nearly the same and quite low compared with that of ERNiCrFe-7. This was likely caused by the tortuosity of the grain boundaries arising from the niobium content of around 2.5% in the former samples. Besides, ERNiCrFe-13 and ERNiCrFe-15 indicated higher minimum critical strains even though these specimens include higher content of sulfur and phosphorus than ERNiCrFe-7. Thus, containing niobium must be more effective to improve the susceptibility compared to sulfur and phosphorous in the alloy system.

  10. A research program in experimental high energy physics: Task C, Progress report for contract period January 1, 1987 to December 31, 1987

    International Nuclear Information System (INIS)

    Lanou, R.E. Jr.; Cutts, D.

    1987-01-01

    An experimental program in strong and electro-weak interaction physics of elementary particles is being carried out using electronic detection techniques. Experiments have been performed at Brown, Brookhaven, Fermilab and SLAC. The work described in this report by the Electronic Detector Group addresses the following: (1) electroweak parameters via neutrino interactions, (2) preparations for experiments (''D-ZERO'') at the FNAL 2 TeV anti pp Collider, (3) neutrino properties, and (4) study of the charm system

  11. Influence of pH on the chemical and structural properties of the oxide films formed on 316L stainless steel, alloy 600 and alloy 690 in high temperature aqueous environments

    International Nuclear Information System (INIS)

    Dupin, M.; Gosser, P.; Walls, M.G.; Rondot, B.; Pastol, J.L.

    2002-01-01

    The oxide films formed on 316L stainless steel, alloy 600 and alloy 690 at 320 deg C in high temperature aqueous environments of different pH have been examined by glow discharge optical spectroscopy, scanning electron microscopy, atomic force microscopy and capacitance measurements. The analytical study reveals that the films formed at pH 5 are mainly composed of chromium oxides. When the pH increases the chromium concentration decreases and those of the other two elements (Ni and Fe) tend to increase. The films formed at pH 5 on 316L stainless steel and alloy 600 are thick and powder-like. The film formed at the same pH on alloy 690 is thin and is composed of a compact protective inner layer and a less-compact outer layer formed by crystals of mixed iron-nickel-chromium oxides. The morphological appearance of the thick films and that of the thin films is very different. However, equivalent morphologies can be observed for the relatively thin duplex films formed at pH 8 and pH 9.5 on the 316L stainless steel and nickel-base alloys. The evolution of the chemical composition of the films is accompanied by important changes from the point of view of their semi-conductivity. (authors)

  12. "Antes e depois da LMC": experiências e dimensões da leucemia mieloide crônica como uma ruptura biográfica

    Directory of Open Access Journals (Sweden)

    Yeimi Alexandra Alzate López

    2014-10-01

    Full Text Available O artigo analisa as experiências de enfermidade de pacientes com leucemia mieloide crônica (LMC, centrando nas dimensões que apontam a chegada da doença como uma ruptura biográfica. Este estudo qualitativo baseou-se na análise das narrativas de seis pacientes, com idades entre 23 e 62 anos, usuários do Sistema Único de Saúde (SUS e pacientes de um hospital – centro de referência em atenção hematológica na cidade de Salvador, Bahia, Brasil. Nos resultados apresenta-se a experiência de ruptura com base em três categorias (1 os significados da doença e a LMC como ameaça; (2 rupturas físicas, sociais e as experiências estigmatizantes; (3 a percepção de um “antes” e um “depois” da LMC, apontando para as mudanças no self, nas relações sociais e na vida cotidiana. Concluiu-se que os impactos biográficos, sociais e dos sistemas de saúde (considerando o custo das medicações atualizam e ampliam questões como o acesso a tratamentos, assim como o enfrentamento do certo e do incerto, em que o “conhecido” da LMC encontra-se pouco acessível ao estoque de conhecimento da vida cotidiana.

  13. Search for {nu}{sub {mu}}{yields}{nu}{sub e} oscillations in the NOMAD experiment; Recherche des oscillations {nu}{sub {mu}}{yields}{nu}{sub e} dans l'experience NOMAD

    Energy Technology Data Exchange (ETDEWEB)

    Krasnoperov, A

    2000-06-01

    The NOMAD experiment is looking for {nu}{sub {mu}}{yields}{nu}{sub {tau}} and {nu}{yields}{nu}{sub e} oscillations in a predominantly {nu}{sub {mu}} beam at the CERN SPS. Neutrino oscillations are closely related with the existence of non-zero neutrino mass and mixing between different flavours. This document describes the search for {nu}{sub {mu}}{yields}{nu}{sub e} oscillations in the full NOMAD data sample accumulated during four years of data-taking (1995-98). The search for {nu}{sub e} appearance was performed by studying the charged current (CC) interactions with in the NOMAD detector. The selection of {nu}{sub e} CC and {nu}{sub {mu}} interactions with the help of different particle identification algorithms, as well as using the event kinematic criteria, is described here in detail. We show that the NOMAD experiment is sensitive to the LSND allowed region of oscillation parameters with the squared mass difference larger than 10 eV{sup 2}/C{sup 4}. An upper limit on the probability of {nu}{sub {mu}}{yields}{nu}{sub e} oscillations, based on a fraction of the NOMAD data, is given. (author)

  14. HEPiX Summary

    CERN Multimedia

    CERN. Geneva; BONFILLOU, Eric; Dr. WIEBALCK, Arne

    2015-01-01

    The HEPiX forum brings together worldwide Information Technology staff, including system administrators, system engineers, and managers from the High Energy Physics and Nuclear Physics laboratories and institutes, to foster a learning and sharing experience between sites facing scientific computing and data challenges. Participating sites include BNL, CERN, DESY, FNAL, IN2P3, INFN, JLAB, NIKHEF, RAL, SLAC, TRIUMF and many others.

  15. Summary of the HEPiX autumn meeting

    CERN Multimedia

    CERN. Geneva; VALSAN, Liviu; Dr. WIEBALCK, Arne

    2014-01-01

    The HEPiX forum brings together worldwide Information Technology staff, including system administrators, system engineers, and managers from the High Energy Physics and Nuclear Physics laboratories and institutes, to foster a learning and sharing experience between sites facing scientific computing and data challenges. Participating sites include BNL, CERN, DESY, FNAL, IN2P3, INFN, JLAB, NIKHEF, RAL, SLAC, TRIUMF and many others.

  16. Seiberg duality and e+e- experiments

    International Nuclear Information System (INIS)

    De Gouvea, Andre; Friedland, Alexander; Murayama, Hitoshi

    1998-01-01

    Seiberg duality in supersymmetric gauge theories is the claim that two different theories describe the same physics in the infrared limit. However, one cannot easily work out physical quantities in strongly coupled theories and hence it has been difficult to compare the physics of the electric and magnetic theories. In order to gain more insight into the equivalence of two theories, we study the ''e + e - '' cross sections into ''hadrons'' for both theories in the superconformal window. We describe a technique which allows us to compute the cross sections exactly in the infrared limit. They are indeed equal in the low-energy limit and the equality is guaranteed because of the anomaly matching condition. The ultraviolet behavior of the total ''e + e - '' cross section is different for the two theories. We comment on proposed nonsupersymmetric dualities. We also analyze the agreement of the ''γγ'' and ''WW'' scattering amplitudes in both theories, and in particular try to understand if their equivalence can be explained by the anomaly matching condition

  17. Book Review "Advances on remote laboratories and e-learning experiences"

    Directory of Open Access Journals (Sweden)

    Jesús A. del Alamo

    2007-08-01

    Full Text Available Book Review "Advances on remote laboratories and e-learning experiences", book editors: Luís Gomes and Javier García-Zubía, University of Deusto, Spain. Reviewed by Jesús A. del Alamo, Massachusetts Institute of Technology, M.I.T.

  18. Correlation between corrosion resistance properties and thermal cycles experienced by gas tungsten arc welding and laser beam welding Alloy 690 butt weldments

    International Nuclear Information System (INIS)

    Lee, H T; Wu, J L

    2009-01-01

    This study investigates the correlation between the thermal cycles experienced by Alloy 690 weldments fabricated using gas tungsten arc welding (GTAW) and laser beam welding (LBW) processes, and their corresponding corrosion resistance properties. The corrosion resistance of the weldments is evaluated using a U-bend stress corrosion test in which the specimens are immersed in a boiling, acid solution for 240 h. The experimental results reveal that the LBW inputs significantly less heat to the weldment than the GTAW, and therefore yields a far faster cooling rate. Moreover, the corrosion tests show that in the GTAW specimen, intergranular corrosion (IGC) occurs in both the fusion zone (FZ) and the heat affected zone (HAZ). By contrast, the LBW specimen shows no obvious signs of IGC.

  19. Muon Intensity Increase by Wedge Absorbers for Low-E Muon Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Neuffer, D. V. [Fermilab; Stratakis, D. [Fermilab; Bradley, J. [Fermilab

    2017-09-01

    Low energy muon experiments such as mu2e and g-2 have a limited energy spread acceptance. Following techniques developed in muon cooling studies and the MICE experiment, the number of muons within the desired energy spread can be increased by the matched use of wedge absorbers. More generally, the phase space of muon beams can be manipulated by absorbers in beam transport lines. Applications with simulation results are presented.

  20. Status of soft photons in experiment E855

    International Nuclear Information System (INIS)

    Woody, C.; Lissauer, D.; Gomez del Campo, J.; Ray, A.; Shapira, D.; Tincknell, M.; Clark, R.; Erd, C.; Schukraft, J.; Willis, W.

    1990-01-01

    Experiment E855 was carried out at the AGS at Brookhaven National Laboratory to study soft photon production near center of mass rapidity Y cm ∼ 0 in proton-nucleus collisions at 10 at 18 GeV/c. This was the first dedicated experiment to study this phenomenon at these lower energies. It is important to note that the related process of low mass dilepton pair production has been studied extensively at these energies and an excess signal of dileptons above known hadronic backgrounds has been firmly established. E855 was designed to measure photon production from P t ∼ 5 MeV/c up to several GeV/c. A search will be made for an excess of soft photons in the P t region below the Jacobian peak from π 0 decays, above that which is expected from hadronic bremsstrahlung. Any observed signal will be correlated with the total charged multiplicity in the event in order to determine its production mechanism. This correlation can be used to distinguish purely hadronic sources of soft photons, such as mesons decays and bremsstrahlung, which vary linearly with the charged multiplicity, and a thermal source of soft photons which would exhibit a quadratic dependence on the charged multiplicity. In addition, E855 will measure low energy photons from nuclear decays which can be a background for measuring soft photons near Y cm ∼ 0. These photons are also interesting from a nuclear physics point of view, since the spectrum of photons from nuclei excited by incident high energy protons gives a measure of the temperature of the excited nucleus and the amount of excitation energy which can be transferred to a nucleus in a high energy proton collision

  1. The interplay between value and service quality experience: e-loyalty development process through the eTailQ scale and value perception

    OpenAIRE

    Li, Honglei; Aham-Anyanwu, Nnanyelugo; Tevrizci, Cemal; Luo, Xin

    2015-01-01

    This research aims to investigate the process and factors relevant for developing customer e-loyalty from an e-service quality experience perspective. Based on previously published loyalty studies and e-commerce literature, an integrated model of e-loyalty development process is proposed by including and validating value perception and the e-service quality scale eTailQ scale. The eTailQ scale consists of website design, security/privacy, value perception, reliability and customer support and...

  2. User Experience: essencial no projeto de produtos e serviços

    Directory of Open Access Journals (Sweden)

    Antonio Mendes Silva Filho

    2012-03-01

    Full Text Available Simplicidade é um desejo inconsciente buscado pelo ser humano quando utiliza um produto para executar uma tarefa. Simplicidade é um objetivo de projeto que todo projetista deve ter em mente quando projeta um novo produto. O projetista deve se colocar no lugar do usuário do produto, buscando entender se as funcionalidades implementadas pelo sistema e a maneira pela qual elas podem ser acessadas são facilmente assimiladas pelos usuários. Ter essa preocupação é considerar a usabilidade como determinante no processo de desenvolvimento de um produto ou sistema. Essa atitude impacta diretamente sobre a aceitabilidade e sucesso do produto. Este artigo aborda como a experiência do usuário (user experience é essencial no desenvolvimento de novos produtos.

  3. Efeitos da experiência nas dimensões de intensidade, direção e frequência da ansiedade e autoconfiança competitiva: Um estudo em atletas de desportos individuais e coletivos

    OpenAIRE

    Fernandes, Marcos Gimenes; Nunes, Sandra Adriana Neves; Raposo, José Vasconcelos; Fernandes, Helder Miguel

    2014-01-01

    O presente estudo teve os seguintes objetivos: i) examinar as correlações inter-escalas entre as três dimensões de respostas (intensidade, direção e frequência) do CSAI-2R e sua relação com a experiência competitiva; e ii) verificar o efeito da experiência competitiva na ansiedade (cognitiva e somática) e na autoconfiança na amostra total e em função de diferentes tipos de modalidades (individuais vs. coletivas). A amostra foi composta por 267 atletas (196 do sexo masculino e 71 do sexo femin...

  4. Tempo e Trânsito na Experiência Subjetiva de Motoristas

    Directory of Open Access Journals (Sweden)

    Ana Inez Oka Elvas de Lima

    2015-03-01

    Full Text Available Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas discussões grupais utilizaram-se os critérios da Análise Clássica de Conteúdo. Os resultados levaram à conclusão de que a questão do tempo e da pressa constitui um potencial gerador de erros e violações na condução de veículos, pois exerce influência decisiva sobre os comportamentos dos motoristas e configura uma realidade importante para se compreender os fatores humanos envolvidos na dinâmica do trânsito e do ambiente urbano como um todo.

  5. “Aniversário Guanabara”: comunicação, consumo e experiência comum

    Directory of Open Access Journals (Sweden)

    João Luis de Araújo Maia

    2015-12-01

    Full Text Available Neste artigo, discutimos como experiências de consumo podem compreender muito mais que a simples venda e aquisição de bens ou serviços. Nosso foco está na experiência vivida de forma compartilhada, onde o desejo de estar junto, em meio à multidão, ganha mais destaque e relevância que a prática econômica do consumo. No evento “Aniversário Guanabara”, comprar barato é apenas um dos dados que orientam os consumidores. Tocar-se, esbarrar-se e vivenciar a confusão nos corredores do supermercado assumem um caráter de divertimento e prazer para muitos que ali estão.

  6. Midlatitude Continental Convective Clouds Experiment (MC3E)

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E

    2010-04-10

    The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the April–May 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administration’s (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States, combined with an extensive sounding array, remote sensing and in situ aircraft observations, NASA GPM ground validation remote sensors, and new ARM instrumentation purchased with American Recovery and Reinvestment Act funding. The overarching goal is to provide the most complete characterization of convective cloud systems, precipitation, and the environment that has ever been obtained, providing constraints for model cumulus parameterizations and space-based rainfall retrieval algorithms over land that have never before been available.

  7. Women's expectations and experiences regarding e-health treatment: A systematic review.

    Science.gov (United States)

    Verhoeks, Carmen; Teunissen, Doreth; van der Stelt-Steenbergen, Anke; Lagro-Janssen, Antoine

    2017-08-01

    There is a gap in knowledge of women's perceptions of e-health treatment. This review aims to investigate women's expectations and experiences regarding e-health. A search was conducted in MEDLINE, EMBASE, CINAHL and PsycInfo in March 2016. We included articles published between 2000 and March 2016, reporting on e-health interventions. The initial search yielded 2987 articles. Eventually, 16 articles reporting on 16 studies were included. Barriers to e-health treatment were lower for women than barriers to face-to-face treatment, such as feelings of shame and time constraints. Women were able to develop an online therapeutic relationship. As reduced feelings of obligation and lack of motivation were women's greatest challenges in completing e-health treatment, they expressed a wish for more support during e-health treatment, preferably blended care. e-Health lowers the threshold for women to seek healthcare. Combining e-health interventions with face-to-face sessions may enhance women's motivation to complete treatment.

  8. Pixel sensor evaluation and online event selection for the Mu3e experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bruch, Dorothea vom

    2017-10-27

    Despite having survived numerous experimental tests, the standard model of particle physics is not a complete description of nature. The Mu3e experiment tests theories beyond the standard model by searching for the lepton flavour violating decay μ→e{sup +}e{sup -}e{sup +}, aiming at a branching ratio sensitivity of 2.10{sup -15} in a first phase of the experiment. A high precision magnetic spectrometer combined with scintillation detectors will measure the momenta, vertices and timing of the decay products of 1.10{sup 8} μ/s stopped on a target. In this work, a prototype of the high voltage monolithic active pixel sensor envisaged for the spectrometer was characterised. With an efficiency >99% and a time resolution of 14 ns, it meets the requirements imposed on the final sensor. Furthermore, an online signal selection process was developed and implemented on a graphics processing unit (GPU), keeping 98% of signal decays, while reducing the data rate of 80 Gbit/s by a factor of 140; resulting in a rate that can be stored to disk. With the computing performance achieved on the GPU, the selection process can run on the hardware planned for the experiment. Both the online selection and the silicon sensor are key aspects for the success of Mu3e.

  9. Inclusive (e,e'N), (e,e'NN), (e,e'π),... reactions in nuclei

    International Nuclear Information System (INIS)

    Gil, A.; Oset, E.

    1997-01-01

    We study the inclusive (e,e'N), (e,e'NN), (e,e'π), (e,e'πN) reactions in nuclei using a Monte Carlo simulation method to treat the multichannel problem of the final state. The input consists of reaction probabilities for the different steps evaluated using microscopical many body methods. We obtain a good agreement with experiment in some channels where there is data and make predictions for other channels which are presently under investigation in several electron laboratories. The comparison of the theoretical results with experiment for several kinematical conditions and diverse channels can serve to learn about different physical processes occurring in the reaction. The potential of this theoretical tool to make prospections for possible experiments, aiming at pinning down certain reaction probabilities, is also emphasized. (orig.)

  10. "Nicarágua na encruzilhada": Cortázar, Vargas Llosa e a experiência sandinista

    Directory of Open Access Journals (Sweden)

    Adriane Vidal Costa

    2009-12-01

    Full Text Available No final dos anos 1970 e início dos 80, Julio Cortázar e Mario Vargas Llosa compararam a Nicarágua sandinista com a Cuba de Fidel Castro, colocando em dia o debate sobre a revolução e o socialismo na América Latina. O presente trabalho analisa os artigos de Cortázar e Vargas Llosa para mostrar como eles compreenderam e traduziram a experiência sandinista. Em fins dos anos 1970, muitos intelectuais passaram a defender a Revolução Sandinista, como a possível revolução ideal ou uma nova chance para a experiência socialista na América Latina, como foi o caso de Cortázar. Vargas Llosa, desencantado com as esquerdas, apontava os "erros" do regime que poderiam levar a experiência sandinista a transformar o país centro-americano em uma "nova Cuba".

  11. Perfeccionismo e representação vinculativa em jovens adultos Perfectionism and attachment representations in young adults

    Directory of Open Access Journals (Sweden)

    Diana Fernandes Oliveira

    2012-01-01

    Full Text Available As relações estabelecidas no seio familiar são extremamente importantes no desenvolvimento dos traços de personalidade dos indivíduos. O objectivo deste estudo foi investigar a relação entre o desenvolvimento do perfeccionismo e as representações de vinculação, numa amostra de 690 jovens adultos, com idades entre os 17 e os 30 anos. Os participantes preencheram um Questionário Sócio-Demográfico, duas Escalas Multidimensionais de Perfeccionismo (MPS-F e MPS-H e um Inventário de Vinculação (IPPA. Os resultados indicam a existência de uma relação entre as dimensões maladaptativas do perfeccionismo e a representação de uma Vinculação Insegura à mãe e ao pai, enquanto as dimensões adaptativas do perfeccionismo relacionam-se com a representação de uma Vinculação Segura. Estes resultados sugerem que um dos factores que contribuem para o desenvolvimento do perfeccionismo é a natureza das relações parentais e consequentes interacções.The relationships established within the family are extremely important in the development of individual personality traits. The goal of this study was to investigate the relation between the development of perfectionism and attachment representations in a sample of 690 young adults, aged between 17 and 30 years old. Participants completed two scales of Self-report Measure of Perfectionism (H-MPS and F-MPS and the Inventory of Parent and Peer Attachment (IPPA, as well as a Social-Demographic Questionnaire. Results indicate the existence of a relation between maladaptive perfectionism dimensions and an insecure attachment representation to parents, whereas adaptive perfectionism dimensions seem to be related to a secure attachment representation. The results suggest that one of the contributing factors to the development of perfectionism is the nature of parental relationships and their consequent interactions.

  12. Direito, opinião pública e racismo nos Estados Unidos e no Brasil: duas experiências de ações afirmativas

    Directory of Open Access Journals (Sweden)

    Monica Grin

    2011-09-01

    Full Text Available O presente artigo busca tratar comparativamente duas experiências recentes de reserva de vagas em universidades públicas, nos EUA e no Brasil, que utilizaram o critério racial, e seus impactos na opinião pública. Trata-se, no primeiro caso, da pioneira introdução de cotas para negros na UERJ, em janeiro de 2003; e, no segundo, da decisão da Suprema Corte norte-americana envolvendo a graduação (college e a Escola de Direito (Law School da Universidade de Michigan, em junho de 2003. Como hipótese inicial, sugiro que as duas experiências de cotas raciais em universidades públicas, ainda que assemelhadas, ativam princípios sociológicos, éticos e jurídicos substantivamente diferenciados.

  13. An example of e-p colliding machine experiments at TRISTAN

    International Nuclear Information System (INIS)

    1980-01-01

    This is a design report of a possible detector system of the e-p colliding machine experiment at TRISTAN. The aim of this note is to know what kind of detectors should be developed and what kind of requirements the TRISTAN machines and the environmental supporting facilities should fulfill. (author)

  14. $\\pi^0$ Production at High Transverse Momenta from $\\pi^-$ Collisions at 520-GeV/c on Be and Cu Targets

    Energy Technology Data Exchange (ETDEWEB)

    Varelas, Nikos [Univ. of Rochester, NY (United States)

    1994-01-01

    The inclusive $\\pi^0$ cross section in 520 GeV/c $\\pi^-$ Be and $\\pi^-$ Cu interactions has been measured as a function of transverse momentum and rapidity, using the E706 spectrometer at FNAL. The production of $\\pi^0$ s was studied using = 5.2 events/pb of $\\pi^-$ Be data and = 0.84 events/pb of $\\pi^-$ Cu data collected during the 1990 run of the E706 experiment. This data sample represents an order of magnitude increase in statistics over the data recorded during the initial run of the experiment in 1988. The $\\pi^0$ decay photons were detected by a finely segmented liquid argon electromagnetic calorimeter. The $\\pi^0$ cross section was measured for transverse momenta between 3.5 and 10 GeV/c and rapidities between -0.75 and 0.75. From the data on Be and Cu, we have extracted the nuclear dependence of $\\pi^0$ production. The measurements are compared with earlier results, as well as with recent next-to-leading-log calculations from Quantum Chromodynamics (QCD).

  15. Public gaming: eSport and event marketing in the experience economy

    OpenAIRE

    Borowy, Michael

    2012-01-01

    This thesis situates organized competitive digital gaming (eSport) in the context of historical sport, the rise of the computer and video games industry, event marketing, and the experience economy. It argues that the oftentimes misattributed origins of eSport in truth first took place during the early 1980s in arcades, when the various criteria for sport, including public contest, a structured framework for victory and defeat, mediatization and promotion, professionalization, record-keeping,...

  16. Capital social e qualidade da atenção à saúde: as experiências do Brasil e da Catalunha

    Directory of Open Access Journals (Sweden)

    Selma Cristina Franco

    2013-07-01

    Full Text Available Os diferentes modelos de gestão da saúde refletem as concepções que os embasam e seus arranjos institucionais podem propiciar o aprimoramento da política de saúde. O presente artigo objetiva fazer uma reflexão sobre as potencialidades e os limites da estrutura organizacional e do capital social para produzirem mudanças no desempenho das organizações públicas de saúde na busca de melhor qualidade assistencial. A descrição e a análise de duas experiências de organização de sistemas públicos de saúde universais, na Catalunha e no Brasil, mostram similaridades nos marcos legais, porém com uma diversidade de caminhos trilhados, que deu origem a experiências distintas de gestão, uma priorizando a organização gerencial e a outra o protagonismo de atores sociais promovendo a institucionalização do capital social. Sugere-se que em modelos de gestão onde há diálogo entre um desenho organizacional eficiente e participação cidadã capaz de construir capital social, pode-se promover mudanças na cultura organizacional em prol da qualidade assistencial.

  17. O caminho, a experiência e a aventura

    Directory of Open Access Journals (Sweden)

    Marcelo Rodrigues Souza Ribeiro

    2009-01-01

    Full Text Available http://dx.doi.org/10.5007/2178-4582.2009v43n1p265 Acompanhando o itinerário demarcado pelas palavras do título, o artigo se divide em quatro partes. Na primeira, após um prelúdio sobre os escritos de Georg Simmel, o tema do milagre do caminho como diferença do humano em relação ao animal orienta, por meio de uma interrogação histórica, um questionamento sobre o conceito de vida na modernidade. Na segunda, a questão da modernidade é desdobrada em torno do motivo da destruição ou expropriação da experiência, tal como discutido por Simmel e Walter Benjamin (entre outros. Na terceira, uma leitura de A aventura, ensaio de 1911 de Simmel, possibilita interrogar a colonialidade como condição da modernidade. Na quarta, retomando a questão da diferença entre humano e animal em relação à discussão sobre aventura, colonialidade e modernidade, esboça-se uma compreensão do conjunto das narrativas de Tarzan como exemplo paradigmático de narrativas de aventura coloniais-modernas que, ademais, articulam discursos sobre a diferença entre humano e animal.

  18. Fast optical readout for Mu3e experiment

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Qinhua [Institut fuer Kernphysik, Universitaet Mainz, Mainz (Germany); Collaboration: Mu3e-Collaboration

    2016-07-01

    Charged lepton flavour violation is highly suppressed in the Standard Model, which results in a prediction for the branching ratio of μ{sup +}→e{sup +}e{sup +}e{sup -} below O(10{sup -54}). The Mu3e experiment will search for this rare decay with a sensitivity of 10{sup -16}. An observation would be a clear sign for new physics. A high muon stopping rate of 2.10{sup 9} Hz is required so that sufficient statistics can be accumulated in about one year of data taking. The high event rate and the requirement of a full online track reconstruction demand a fast readout system which should provide a bandwidth above 1 Tbit/s. Reconfigurable devices, namely FPGAs, can easily parallelise the data processing, so it becomes possible to sort, merge, pack and route the data with low latency at high throughput. Optical fibres are the only option for the interconnection between different FPGA-based boards. The fibres also reduce the crosstalk and signal attenuation, especially over long distance links. As part of the readout system prototyping, firmware for synchronous merging of different data streams is being developed. In addition, the optical links have been tested and show a bit error rate below O(10{sup -16}) at 6.4 Gbit/s for a single fibre.

  19. E-Cigarettes Use Behavior and Experience of Adults: Qualitative Research Findings to Inform E-Cigarette Use Measure Development.

    Science.gov (United States)

    Kim, Hyoshin; Davis, Andrew H; Dohack, Jaime L; Clark, Pamela I

    2017-02-01

    To gain a better understanding of electronic cigarette (e-cigarette) use behavior and experience among adult e-cigarette users, with the goal of informing development of future e-cigarette use measures. Between August and October 2014 six focus groups were conducted in Seattle. Participants (63% male; 60% >35 years old; 60% White): e-cigarette users who used combustible tobacco products either currently or in the past. E-cigarette discussion topics covered: their daily use pattern (eg, frequency), product-related characteristics (eg, nicotine levels), and perceptions about health risks and benefits. Participants' descriptions of daily use were so varied that no common "unit" of a "session" easily summarized frequency or quantity of typical e-cigarette use. Most users had difficulty in tracking their own use. Participants reported nicotine craving relief when using e-cigarettes, but described e-cigarettes use as less satisfying than combustible cigarettes. Valued characteristics included "ready availability" and the possibility of using indoors. A unique aspect of the e-cigarette use experience is the option of adding flavors and having the ability to exhale "big clouds" of vapor/aerosol. Most perceived e-cigarettes as a better and safer alternative to conventional cigarettes, yet still sought further information about health consequences and safety of e-cigarettes from trusted sources. E-cigarettes users are far from homogeneous in their behavior and motivation for adopting e-cigarettes. A range of use patterns arising from both hedonic and utilitarian factors, along with product characteristics (eg, variable nicotine levels and flavors) extending beyond those of conventional cigarettes, suggest that new, specific e-cigarette use measures must be developed. The current study provides timely information on adult e-cigarette use behavior, which is a crucial step in measuring this new phenomenon and assessing the risks associated with using e-cigarette products. Our

  20. Real remote physics experiments across Internet-- inherent part of Integrated e-Learning

    Directory of Open Access Journals (Sweden)

    Frantisek Lustig

    2008-05-01

    Full Text Available Abstract— The implementation of the real remote experiments across the Internet into teaching process, up till now not available, enables introduction of Integrated e-Learning, composed of three components: the real remote experiments across the Internet, the simulation applets and the electronic interactive textbooks. We present here the prospective remote laboratory system with data transfer using Intelligent School Experimental System (ISES as hardware and ISES WEB Control kit as software. This approach enables the simple construction of remote experiments without building any hardware and virtually no programming, only with paste and copy approach of pre-built typical blocks as camera view, controls, graphs, displays etc. In conclusion we summarize the achieved experience with remote experiments.

  1. Relação entre forma e vazio, com fantasia e imaginação : o vazio é forma, a forma é vazio : experiências fora e dentro da sala de aula

    OpenAIRE

    Guerra, Manuel Pereira Rodrigues

    2011-01-01

    Este trabalho Cria e Recria a Forma e Vazio com Fantasia e Imaginação,apresentando uma forte ligação entre a Forma e Vazio. Considerando mesmo,que o vazio é forma e a forma é vazio,por outro lado, é no vazio que as formas acontecem. Além das experiências que foram desenvolvidas individualmente, também trabalhei conjuntamente em grupos com os alunos. Este trabalho ajudou a uma boa cooperação entre o professor e os alunos. Estas experiências demonstram, que os pedagogos, os professores devem da...

  2. Bringing back the book through digital experiences: e-Books and ...

    African Journals Online (AJOL)

    Bringing back the book through digital experiences: e-Books and digital media as platforms for reading among school children. ... for technology has changed the format of books and reading platforms from print to ereaders. ... print. Findings further showed that there is no significant difference in the attitude of boys and girls ...

  3. Study on thermal and mechanical properties of U-tube materials for steam generator

    International Nuclear Information System (INIS)

    Rheu, Woo Suk; Kang, Young Hwan; Park, Jong Man; Joo, Ki Nam; Kim, Sung Soo; Maeng, Wan Young; Park, Se Jin

    1993-01-01

    Most of domestic nuclear plants have used I600 TT material for steam generator U-tube, and piled up the field experience. I600 HTMA and I690 TT, however, are recommended for an alternative of U-tube by ABB-CE since YK-3 and 4. Field experience of I600 HTMA and I690 TT have not compiled in the country, so it is concerned to select the future materials for U-tube. Thus, database on the thermal and mechanical properties of U-tube materials is very necessary for design documentations. In this study, the thermal, mechanical and metallugical properties were tested and evaluated to establish the database for steam generator U-tube. In addition, thermal conductivity of I600 and I690 was measured and compared statistically, providing a basic document for applying I690 to U-tube. The results will be used to improve the manufacturing process in order to increase the integrity of U-tube. (Author)

  4. The LYSO crystal calorimeter for the Mu2e experiment

    International Nuclear Information System (INIS)

    Pezzullo, G; Cervelli, F; Budagov, J; Davydov, Yu; Glagolev, V; Carosi, R; Cheng, C; Echenard, B; Hitlin, D; Ongmonkolkul, P; Porter, F; Cordelli, M; Corradi, G; Giovannella, S; Happacher, F; Luca, A; Martini, M; Miscetti, S; Saputi, A; Murat, P

    2014-01-01

    The Mu2e experiment at Fermilab searches the neutrino-less conversion of the muon into electron in the field of an Aluminum nucleus. If such a process will be observed, it will be a proof of the charged-lepton-flavor-violation (cLFV), otherwise Mu2e will set an upper limit of R μe < 6 × 10 −17 @ 90% C.L. (which represents an improvement by 3–4 order of magnitude over the existing limit). The Mu2e detector apparatus consists of a magnetic spectrometer, devoted to the measurement of the electrons momentum, and an electromagnetic calorimeter (EMC) which provides an independent measurement of the electron energy, time and position, used for validating or rejecting candidate tracks selected by the tracking system. In this paper, we describe the baseline project of the EMC and present results in terms of performances and R and D

  5. Vivenciando com o filho uma passagem difícil e reveladora: a experiência da mãe acompanhante Experiencing a difficult and revealing passage with her child: the live-in mother experience

    Directory of Open Access Journals (Sweden)

    Irma de Oliveira

    2000-06-01

    Full Text Available O presente estudo foi realizado com mães acompanhantes em um hospital escola. Os objetivos foram: compreender as interações vivenciadas, identificar os significados que o familiar acompanhante atribui à experiência de vivenciar a hospitalização da criança, identificar o que essa vivência provoca na vida do familiar e construir um modelo teórico representativo da experiência. Utilizou-se como Referencial Teórico o Interacionismo Simbólico e Referencial Metodológico a "Grounded Theory". Identificou-se os fenômenos Indo em busca de solução e Atravessando uma situação difícil. A partir desses fenômenos emergiu a categoria central Vivenciando com o filho uma passagem difícil e reveladora.This study was conducted with live-in mother in university hospital. The objectives were as follows: to understand the experienced interactions, to identify the meanings that a family attribute to the experience of going through the child's hospitalization, to identify what the experience of hospitalization provokes in the family life and construct a model theory representative of the experience. Reference Theory the Symbolic Interactionism and Reference Methodology Grounded Theory had been utilized. From results appeared the phenomenon Going in search of solution, and Going through a difficult situation. Through these phenomena, the main category Experiencing a difficult and revealing passage with her child was identified.

  6. Recherche de charginos et neutralinos dans le canal dimuon de meme signe aupres de l'experience DØ - FNAL

    Energy Technology Data Exchange (ETDEWEB)

    Lesne, Vincent [Blaise Pascal Univ, Aubiere (France)

    2006-07-01

    Dans le cadre du modele mSUGRA qui decrit un mecanisme de brisure simple de la supersym etrie, des sparticules avec des masses au-del a des limites fixees par les experiences de LEP II peuvent etre produites au Tevatron, collisionneur p$\\bar{p}$ delivrant une energie de 1.96 TeV dans le centre de masse. Un canal privilegie pour la d´ecouverte de la supersymetrie au Tevatron est la production associee du plus leger chargino, $\\tilde{χ}$$±\\atop{1}$ , et du second plus leger neutralino, $\\tilde{χ}$$0\\atop{2}$ . Les modes de desintegration leptoniques, $\\tilde{χ}$$0\\atop{2}$ → $\\tilde{χ}$$0\\atop{1}$ ℓ+- et $\\tilde{χ}$$±\\atop{1}$ → $\\tilde{χ}$$0\\atop{1}$ ℓ±νl, conduisent a une signature claire avec trois leptons et un quantite significative d’energie transverse manquante.

  7. E-st@r-I experience: Valuable knowledge for improving the e-st@r-II design

    Science.gov (United States)

    Corpino, S.; Obiols-Rabasa, G.; Mozzillo, R.; Nichele, F.

    2016-04-01

    Many universities all over the world have now established hands-on education programs based on CubeSats. These small and cheap platforms are becoming more and more attractive also for other-than-educational missions, such as technology demonstration, science applications, and Earth observation. This new paradigm requires the development of adequate technology to increase CubeSat performance and mission reliability, because educationally-driven missions have often failed. In 2013 the ESA Education Office launched the Fly Your Satellite! Programme which aims at increasing CubeSat mission reliability through several actions: to improve design implementation, to define best practices for conducting the verification process, and to make the CubeSat community aware of the importance of verification. Within this framework, the CubeSat team at Politecnico di Torino developed the e-st@r-II CubeSat as follow-on of the e-st@r-I satellite, launched in 2012 on the VEGA Maiden Flight. E-st@r-I and e-st@r-II are both 1U satellites with educational and technology demonstration objectives: to give hands-on experience to university students and to test an active attitude determination and control system based on inertial and magnetic measurements with magnetic actuation. This paper describes the know-how gained thanks to the e-st@r-I mission, and how this heritage has been translated into the improvement of the new CubeSat in several areas and lifecycle phases. The CubeSat design has been reviewed to reduce the complexity of the assembly procedure and to deal with possible failures of the on-board computer, for example re-coding the software in the communications subsystem. New procedures have been designed and assessed for the verification campaign accordingly to ECSS rules and with the support of ESA specialists. Different operative modes have been implemented to handle some anomalies observed during the operations of the first satellite. A new version of the on-board software is

  8. Desenvolvimento do curso de gerenciamento em enfermagem on-line: experiência exitosa entre Brasil e Portugal

    Directory of Open Access Journals (Sweden)

    Daisy Maria Rizatto Tronchin

    2015-12-01

    Full Text Available RESUMO Objetivo Descrever a experiência no planejamento e desenvolvimento de um Curso de Atualização On-Line em Gerenciamento em Enfermagem destinado a enfermeiros nos contextos Brasil e Portugal. Método O desenho instrucional do Curso fundamentou-se na Teoria da Aprendizagem Significativa, na Andragogia e na Metodologia Dialética, valorizando a interação entre os atores e privilegiando os cenários de prática e a aplicação dos conceitos abordados. Resultados O Curso está estruturado em nove unidades teóricas, quatro estudos de caso e prova dissertativa. Foi avaliado positivamente pelos participantes, os quais referiram oportunidades de aquisição de novos conhecimentos; interação e intercâmbio de experiência; motivação em estudar os temas e autoaprendizagem. Conclusão Espera-se que a experiência descrita estimule a proposição de novos cursos e programas na modalidade de Educação a Distância, incrementando os processos de ensino e de aprendizagem para subsidiar análises futuras do seu impacto no desenvolvimento e no aprimoramento de competências gerenciais em enfermagem.

  9. Test of the Behavioral Perspective Model in the Context of an E-Mail Marketing Experiment

    Science.gov (United States)

    Sigurdsson, Valdimar; Menon, R. G. Vishnu; Sigurdarson, Johannes Pall; Kristjansson, Jon Skafti; Foxall, Gordon R.

    2013-01-01

    An e-mail marketing experiment based on the behavioral perspective model was conducted to investigate consumer choice. Conversion e-mails were sent to two groups from the same marketing database of registered consumers interested in children's books. The experiment was based on A-B-A-C-A and A-C-A-B-A withdrawal designs and consisted of sending B…

  10. The Material Plasma Exposure eXperiment (MPEX)

    Science.gov (United States)

    Rapp, J.; Biewer, T. M.; Bigelow, T. S.; Canik, J.; Caughman, J. B. O.; Duckworth, R. C.; Goulding, R. H.; Hillis, D. L.; Lore, J. D.; Lumsdaine, A.; McGinnis, W. D.; Meitner, S. J.; Owen, L. W.; Shaw, G. C.; Luo, G.-N.

    2014-10-01

    Next generation plasma generators have to be able to access the plasma conditions expected on the divertor targets in ITER and future devices. The Material Plasma Exposure eXperiment (MPEX) will address this regime with electron temperatures of 1--10 eV and electron densities of 1021--1020 m-3. The resulting heat fluxes are about 10 MW/m2. MPEX is designed to deliver those plasma conditions with a novel Radio Frequency plasma source able to produce high density plasmas and heat electron and ions separately with Electron Bernstein Wave (EBW) heating and Ion Cyclotron Resonance Heating (ICRH). Preliminary modeling has been used for pre-design studies of MPEX. MPEX will be capable to expose neutron irradiated samples. In this concept targets will be irradiated in ORNL's High Flux Isotope Reactor (HFIR) or possibly at the Spallation Neutron Source (SNS) and then subsequently (after a sufficient long cool-down period) exposed to fusion reactor relevant plasmas in MPEX. The current state of the pre-design of MPEX including the concept of handling irradiated samples will be presented. ORNL is managed by UT-Battelle, LLC, for the U.S. DOE under Contract DE-AC-05-00OR22725.

  11. Interesse e conhecimento em cirurgia refrativa entre estudantes de medicina

    Directory of Open Access Journals (Sweden)

    Kara José Flávio Cotait

    2002-01-01

    Full Text Available Objetivo: Realizou-se um estudo em estudantes da Faculdade de Medicina do ABC a fim de analisar e relacionar a freqüência de usuários de correção óptica, o tipo de vícios de refração, o número de pessoas submetidas à cirurgia refrativa e o conhecimento e interesse por essa operação. Métodos: realizou-se um levantamento entre estudantes de medicina da Faculdade de Medicina do ABC, no período de 19 a 21 de junho de 2000. Foi utilizado um questionário auto-aplicável como instrumento de coleta de dados. Resultados: foi relatado que 62,7% dos estudantes usavam correção óptica, sendo que 53,3% desses apresentavam, como erro de refração, miopia simples ou associada ao astigmatismo. 92,8% do total dos entrevistados já tinham ouvido falar em cirurgia refrativa, contendo apenas 34,2% conhecedores dessa técnica cirúrgica e 17,6% conhecedores dos riscos e complicações pós-operatórios. Entre os 200 estudantes amétropes, 50,5% gostariam de ser submetidos à operação, sendo que 69,0% deles esperavam, através da cirurgia, a cura definitiva. Foi coletado, também, que 51,7% dos entrevistados tiveram a última consulta oftalmológica há menos de 1 ano; 32,0% entre 1 e 3 anos e 15,7% há mais de três anos. Apenas 5 estudantes já tinham sido submetidos à cirurgia refrativa. Conclusão: A maioria dos estudantes de Medicina (62,7% é portador de vício de refração corrigido, sendo os mais freqüentes a miopia simples e a miopia associada a astigmatismo. Há pouco conhecimento e falsa expectativa em relação à cirurgia, sendo que apenas 34,2% entrevistados conhecem o procedimento cirúrgico, 17,6% sabem dos riscos e das complicações e 69,0% esperam cura total. Diante das condições desse estudo, foi constatado que apesar de muitos se interessarem pela cirurgia refrativa, poucos se submeteram a ela, devido, principalmente, em ordem decrescente, a: contra-indicação médica, falta de oportunidade, falta de conhecimento e

  12. eXframe: reusable framework for storage, analysis and visualization of genomics experiments

    Directory of Open Access Journals (Sweden)

    Sinha Amit U

    2011-11-01

    Full Text Available Abstract Background Genome-wide experiments are routinely conducted to measure gene expression, DNA-protein interactions and epigenetic status. Structured metadata for these experiments is imperative for a complete understanding of experimental conditions, to enable consistent data processing and to allow retrieval, comparison, and integration of experimental results. Even though several repositories have been developed for genomics data, only a few provide annotation of samples and assays using controlled vocabularies. Moreover, many of them are tailored for a single type of technology or measurement and do not support the integration of multiple data types. Results We have developed eXframe - a reusable web-based framework for genomics experiments that provides 1 the ability to publish structured data compliant with accepted standards 2 support for multiple data types including microarrays and next generation sequencing 3 query, analysis and visualization integration tools (enabled by consistent processing of the raw data and annotation of samples and is available as open-source software. We present two case studies where this software is currently being used to build repositories of genomics experiments - one contains data from hematopoietic stem cells and another from Parkinson's disease patients. Conclusion The web-based framework eXframe offers structured annotation of experiments as well as uniform processing and storage of molecular data from microarray and next generation sequencing platforms. The framework allows users to query and integrate information across species, technologies, measurement types and experimental conditions. Our framework is reusable and freely modifiable - other groups or institutions can deploy their own custom web-based repositories based on this software. It is interoperable with the most important data formats in this domain. We hope that other groups will not only use eXframe, but also contribute their own

  13. Quality Assurance on Undoped CsI Crystals for the Mu2e Experiment

    Science.gov (United States)

    Atanov, N.; Baranov, V.; Budagov, J.; Davydov, Yu. I.; Glagolev, V.; Tereshchenko, V.; Usubov, Z.; Cervelli, F.; Di Falco, S.; Donati, S.; Morescalchi, L.; Pedreschi, E.; Pezzullo, G.; Raffaelli, F.; Spinella, F.; Colao, F.; Cordelli, M.; Corradi, G.; Diociaiuti, E.; Donghia, R.; Giovannella, S.; Happacher, F.; Martini, M.; Miscetti, S.; Ricci, M.; Saputi, A.; Sarra, I.; Echenard, B.; Hitlin, D. G.; Hu, C.; Miyashita, T.; Porter, F.; Zhang, L.; Zhu, R.-Y.; Grancagnolo, F.; Tassielli, G.; Murat, P.

    2018-02-01

    The Mu2e experiment is constructing a calorimeter consisting of 1,348 undoped CsI crystals in two disks. Each crystal has a dimension of 34 x 34 x 200 mm, and is readout by a large area silicon PMT array. A series of technical specifications was defined according to physics requirements. Preproduction CsI crystals were procured from three firms: Amcrys, Saint-Gobain and Shanghai Institute of Ceramics. We report the quality assurance on crystal's scintillation properties and their radiation hardness against ionization dose and neutrons. With a fast decay time of 30 ns and a light output of more than 100 p.e./MeV measured with a bi-alkali PMT, undoped CsI crystals provide a cost-effective solution for the Mu2e experiment.

  14. Department of Hadron Structure - Overview

    International Nuclear Information System (INIS)

    Eskreys, A.

    2000-01-01

    Full Text: The XII Department of the Institute of Nuclear Physics has been involved in 1999 in the following experiments and projects: -ZEUS experiment at HERA (DESY), which covered the main activity of the department. The group from department participating in this experiment consisted of physicists: J. Chwastowski, A. Eskreys, J. Figiel, K. Klimek, K. Olkiewicz, M.B. Przybycien, P. Stopa, M. Zachara, and L. Zawiejski and engineers and technicians: J. Andruszkow, W. Daniluk, B. Dabrowski, P. Jurkiewicz, A. Kotarba, K. Oliwa, W. Wierba, and A. Wlodarczyk; -D0 experiment at TEVATRON (FNAL), USA - one physicist: B. Pawlik from the department was involved in this experiment; -TESLA project at DESY - two engineers: J. Andruszkow and P. Jurkiewicz were participating in this project; -ATLAS project at LHC (CERN) - one physicist: K. Piotrzkowski from the department was participating in this project. 11 physicists and 8 engineers and technicians have been involved in carrying above programs. ZEUS experiment is the continuation of the investigation of e ± p interactions at HERA collider which has started over 10 years ago and has a perspective of another 5 years of activity. The upgrade of HERA and the expected 5-7 fold increase of luminosity makes the physics program very attractive. Cracow group is responsible for upgrade of the luminosity monitor to meet the new working conditions after HERA upgrade. An extended proposal for luminosity measurement after HERA upgrade, including the measurements of the Bremsstrahlung events rates by additional detectors apart from the photon calorimeter (i.e. 6m and 40m electron taggers and luminosity spectrometer), has been prepared and was accepted for realization by the ZEUS collaboration and the DESY Physics Research Committee (PRC). D0 is the (anti)pp experiment carried out at FNAL (Batavia), USA, and is now designed to deliver 100 times higher luminosity than has been achieved so far. In ATLAS project the preparation of the physics

  15. Cuidadores Principais Ante a Experiência da Morte: Seus Sentidos e Significados

    Directory of Open Access Journals (Sweden)

    Carolina Peres de Lima

    Full Text Available Resumo O presente trabalho teve como objetivo compreender os sentidos e significados atribuídos pelos cuidadores principais à experiência de acompanhamento de pacientes com câncer em Cuidados ao Fim de Vida. Com este intuito, foi realizada uma pesquisa qualitativa exploratória, utilizando a observação participante como recurso metodológico. A análise de conteúdo foi utilizada como método de avaliação dos resultados, no qual a Teoria Existencialista de Viktor Frankl e a literatura contemporânea sobre Cuidados Paliativos serviram de substrato teórico à compreensão da temática em questão. Após a análise do diário de campo, foram extraídas cinco categorias temáticas: A espiritualidade atribuindo sentido à experiência; O tempo de espera; Morte como alívio do sofrimento; Revisão da história de vida; Incerteza quanto ao futuro. Foi possível perceber reações e sentimentos expostos pelos cuidadores, que, apesar do esgotamento físico e emocional, desejavam permanecer ao lado de seu familiar até sua morte. Entendemos que a comunicação da equipe ao cuidador sobre a aproximação da morte pode contribuir para o processo de elaboração psíquica desta vivência. A compreensão da experiência subjetiva do cuidador viabiliza uma abordagem efetiva da equipe às reais necessidades de cuidado do familiar.

  16. Psicologia e Práticas Restaurativas na Socioeducação: Relato de Experiência

    Directory of Open Access Journals (Sweden)

    Iara da Silva Ferrão

    Full Text Available Resumo Este artigo tem como objetivo apresentar um relato de experiência de profissional da área da Psicologia, dentro de uma Unidade de Internação de adolescentes em conflito com a lei. Ainda pretendeu-se relacionar práticas restaurativas com possibilidade de experiência exitosa ao sistema socioeducativo. O relato tem como cenário uma unidade de Atendimento Socioeducativo de uma cidade no interior do estado do Rio Grande do Sul. Os dados obtidos são frutos da experiência profissional da autora e fazem parte de um estudo maior intitulado “Um Estudo dos Fatores de Risco e de Proteção em Jovens que Cumprem Medida Socioeducativa”. Os resultados mostraram que as práticas restaurativas realizadas nesta instituição foram apenas os círculos de compromisso. O tema da Justiça Restaurativa (JR, por ser novo e por não ter sido originalmente um modelo criado no cenário brasileiro, ainda é difícil de avaliar possíveis resultados e impactos. As experiências apresentadas sugerem que há possibilidade da JR ser uma experiência exitosa para o Sistema Socioeducativo. Indica-se a necessidade de realização de mais pesquisas com relação a essa temática.

  17. Study of antioxidant properties of a water-soluble Vitamin E derivative-tocopherol monoglucoside (TMG) by differential pulse voltammetry.

    Science.gov (United States)

    Korotkova, E I; Avramchik, O A; Kagiya, T V; Karbainov, Y A; Tcherdyntseva, N V

    2004-06-17

    Study of antioxidant properties of tocopherol monoglucoside (TMG), a water-soluble Vitamin E derivative, by differential pulse voltammetry has been carried out in this work. The pH influence on the antioxidant properties of TMG has been also investigated. It was observed that the antioxidant activity of TMG is greater at 6.90TMG and reactive oxygen species have been considered. Antioxidant activity of some standard antioxidants including Vitamin E was given for comparison. The results indicate that the TMG is an effective antioxidant in neutral solutions. The oxidation potential for TMG at pH 7.31 has been found (E=0.55+/-0.03V versus Ag|AgCl|KCl(sat) electrode). Finally the use of TMG for protection against oxidative stress has been recommended.

  18. Offline Software for the Mu2e Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Kutschke, Robert K. [Fermilab

    2012-01-01

    The Mu2e experiment at Fermilab is in the midst of its R&D and approval processes. To aid and inform this process, a small team has developed an end-to-end Geant4-based simulation package and has developed reconstruction code that is already at the stage of an advanced prototype. Having these tools available at an early stage allows design options and tradeoffs to be studied using high level physics quantities. A key to the success of this effort has been, as much as possible, to acquire software and customize it, rather than to build it in-house.

  19. Track reconstruction for the Mu3e experiment based on a novel Multiple Scattering fit

    Directory of Open Access Journals (Sweden)

    Kozlinskiy Alexandr

    2017-01-01

    Full Text Available The Mu3e experiment is designed to search for the lepton flavor violating decay μ+ → e+e+e−. The aim of the experiment is to reach a branching ratio sensitivity of 10−16. In a first phase the experiment will be performed at an existing beam line at the Paul-Scherrer Institute (Switzerland providing 108 muons per second, which will allow to reach a sensitivity of 2 · 10−15. The muons with a momentum of about 28 MeV/c are stopped and decay at rest on a target. The decay products (positrons and electrons with energies below 53MeV are measured by a tracking detector consisting of two double layers of 50 μm thin silicon pixel sensors. The high granularity of the pixel detector with a pixel size of 80 μm × 80 μm allows for a precise track reconstruction in the high multiplicity environment of the Mu3e experiment, reaching 100 tracks per reconstruction frame of 50 ns in the final phase of the experiment. To deal with such high rates and combinatorics, the Mu3e track reconstruction uses a novel fit algorithm that in the simplest case takes into account only the multiple scattering, which allows for a fast online tracking on a GPU based filter farm. An implementation of the 3-dimensional multiple scattering fit based on hit triplets is described. The extension of the fit that takes into account energy losses and pixel size is used for offline track reconstruction. The algorithm and performance of the offline track reconstruction based on a full Geant4 simulation of the Mu3e detector are presented.

  20. Psicologia Organizacional e do Trabalho: Relato de Experiência em Estágio Supervisionado

    Directory of Open Access Journals (Sweden)

    Priscilla de Oliveira Martins-Silva

    Full Text Available Resumo Trata-se de relato de experiência em estágio supervisionado em Psicologia Organizacional e do Trabalho (POT envolvendo um grupo de alunos de uma Instituição de Educação Superior (IES localizada no Estado do Espírito Santo. O objetivo central foi discutir os aspectos teóricos e práticos que influenciaram na formação profissional do discente em Psicologia, tendo como foco o estágio supervisionado. Além de relatar a experiência, foi realizado um levantamento junto aos ex-alunos sobre as contribuições do estágio na sua formação educacional e profissional. Da experiência relatada foi possível verificar que: a instituição das Diretrizes Curriculares Nacionais (DCN constituiu-se em um marco na flexibilização curricular dos cursos; o estágio é um componente curricular de integração entre ensino, pesquisa e prática; e o estágio em POT requer dos discentes conhecimentos multidisciplinares. Além desses aspectos, observou-se que a prática do estágio supervisionado indica o rompimento com a imagem negativa do psicólogo que atua em POT, limitada à aplicação de testes e psicotécnicas. De fato, a atividade do psicólogo em POT mostrou-se muito mais ampla e complexa, sobretudo em termos dos impactos de sua intervenção no ambiente organizacional.

  1. Métricas da qualidade da experiência do consumidor de bares e restaurantes: uma revisão comparada

    Directory of Open Access Journals (Sweden)

    Gisah Moreira Akel

    2012-11-01

    Full Text Available A busca pela compreensão do comportamento do consumidor tem sido amplamente discutida por acadêmicos e gestores. Considerando suas especificidades, o crescente setor de alimentos e bebidas, instiga investigadores em busca de caminhos que permitam ao empreendimento proporcionar serviços e experiências memoráveis, exigências da evolução da ótica de consumo moderna. Este panorama motiva a realização deste estudo que tem por objetivo analisar métricas da qualidade da experiência do consumidor de bares e restaurantes, por meio de uma revisão bibliográfica contemplando: o comportamento do consumidor de alimentos e bebidas, expectativa, qualidade, satisfação e os componentes da qualidade da experiência do consumidor deste nicho. Esta revisão culminou na comparação de três modelos principais de medição da qualidade da experiência, sendo eles: o SERVQUAL (PARASSURAMAN et al., 1988, o DINESERV (STEVENS et al., 1995 e Qualidade da Experiência (GIMENES et al., 2012. Constatou-se que os modelos oferecem visões distintas e de certo modo, complementares. No entanto, conclui-se que o suporte de Gimenes et al. (2012 compreende uma métrica mais extensa e focada neste segmento específico. Normal 0 21 false false false PT-BR X-NONE X-NONE

  2. ENSINO DE LÍNGUA INGLESA E LETRAMENTO CRÍTICO: uma experiência voltada para o engajamento dialógico e cidadão de adolescentes e jovens

    Directory of Open Access Journals (Sweden)

    Angélica Araújo Maia

    2016-05-01

    Full Text Available Nos dias atuais, as teorias fundamentadas nos Novos Letramentos representam uma importante referência para o ensino de Língua Inglesa no Brasil, propondo uma educação linguística que, ao mesmo tempo, possa fortalecer a consciência crítica e favorecer a agência cidadã. Nessa perspectiva, o presente artigo relata a experiência de um projeto de extensão voltado para o ensino de inglês para adolescentes e jovens, com foco na profissionalização e no letramento crítico, com o objetivo de evidenciar de que forma a proposta curricular e metodológica do projeto,além de promover o desenvolvimento do conhecimento da língua inglesa, constituiu-se um espaço de engajamento dialógico e de expansão de perspectiva dosparticipantes. O estudo foi desenvolvido com base na análise de fragmentos das aulas, registrados em vídeo, dos planos de aula e material didático utilizado, além das postagens dos jovens participantes acerca dos temas abordados em uma página do projeto em uma rede social. As categorias que guiaram a interpretação dos dados se referem a etapas constituintes das aulas e consistem em: preparação, exploração, problematização e expansão (EDMUNDO, 2012; e ainda: experiências com o conhecido, experiências com o novo, conceituações, conexões locais e globais, expansão de perspectiva, transformação (MONTE-MOR, 2010; DUBOC, 2015. No final, argumenta-se a favor da transposição dessa abordagem, desenvolvida em um espaço não escolar em João Pessoa - Paraíba (organização não-governamental, para o espaço da escola, de forma a ampliar,na educação básica, as possibilidades de uma aprendizagem da língua inglesa mais significativa e capaz de empoderaradolescentes e jovens no uso da linguagem.

  3. Preliminary results from FNAL E665 muon scattering at low. chi. sub Bj

    Energy Technology Data Exchange (ETDEWEB)

    Schellman, H.

    1991-11-01

    We present measurements of inelastic muon scattering cross section ratios at very low x{sub Bj}. The Xe/D{sub 2} cross section ratio has been measured for x{sub Bj} down to 2 {times} 10{sup 3}. We have also measured the n/p cross section ratio down to x{sub Bj} = 10{sup 3} and see no significant deviation from unity. 8 refs., 4 figs.

  4. SRF Cavity and Materials R&D at Fermilab

    CERN Document Server

    Khabiboulline, N; Bellantoni, L; Berenc, T; Boffo, C; Carcagno, R; Chapman, C; Edwards, H; Elementi, L; Foley, M; Hahn, E; Hicks, D; Mitchell, D; Rowe, A; Solyak, N; Terechkine, Yu

    2004-01-01

    Two 3.9 GHz superconducting RF cavities are under development at FNAL for use in the upgraded Photoinjector Facility. A TM110 mode cavity will provide streak capability for bunch slice diagnostics, and a TM010 mode cavity will provide linearization of the accelerating gradient before compression for better emittance. The status of these two efforts and a review of the FNAL infrastructure development will be given.

  5. The Effects of Brand Experiences on Quality, Satisfaction and Loyalty: An Empirical Study in the Telecommunications Multiple-play Service Market

    Directory of Open Access Journals (Sweden)

    António Carrizo Moreira

    2017-03-01

    Full Text Available This article seeks to add to the body of knowledge on the role played by brand experience and its relationship with satisfaction, trust and service quality in the development of loyalty. Structural Equation Modelling (sem is used to analyze 690 telecommunications multiple-play users in the Portuguese telecommunications market. Our conclusions show that brand experiences can be used to generate loyalty, trust and quality perceptions; although satisfaction was confirmed to be the main loyalty predictor, service quality has an important indirect effect. In order to build customer loyalty, marketers must manage brand experiences, service quality, satisfaction and trust. Brand experiences can be explored as a way to differentiate services, to change customers’ perceptions toward a brand and, ultimately, lead to customer retention. Furthermore, providing reliable services is of the utmost importance for service providers.

  6. Neutrino results from the Fermilab 15-foot bubble chamber using neon-hydrogen mixtures

    International Nuclear Information System (INIS)

    Burnett, T.H.

    1977-01-01

    Neutrino results from the FNAL 15-foot bubble chamber, using two different neon-hydrogen mixtures are reviewed. Included are the measurements from four different experiments of the dilepton, or μe rate, which appear to be consistent with the charm production interpretation for this process. Also mentioned is a study of the scaling variable distributions for antineutrinos, which shows no anomalous threshold, consistent with the usual four-quark model, but indicates a slight scale breaking. The ratio of anti νn to anti νp cross sections has been extracted from the same data and is also consistent with the quark model. A study of the hadronic state produced by electron (anti)neutrinos in neon is summarized, with the conclusion that nuclear rescattering effects are the same as for hadron interactions. (orig.) [de

  7. Arte, corpo e terapia ocupacional: experimentações inventivas / Art, body and occupational therapy: inventive experiments

    Directory of Open Access Journals (Sweden)

    Flavia Liberman

    2018-01-01

    Full Text Available A imagem da capa refere-se a uma experiência realizada em um curso no Congresso Brasileiro e Latino Americano de Terapia Ocupacional em 2013 que buscou oferecer aos participantes ferramentas relacionadas às abordagens corporais e às artes plásticas e visuais para a construção de estratégias de intervenção e cuidado com diferentes populações em terapia ocupacional. As propostas sensibilizaram para os estados de presença dos corpos, buscando uma maior agregação das partes e uma conexão mais potente com o presente e com os ambientes. A experiência promoveu um espaço de criação e interação grupal e expressou a singularidade dos processos de cada participante em meio a produção coletiva. AbstractThe cover image refers to an experiment conducted in a course at the Brazilian and Latin American Congress of Occupational Therapy in 2013 that sought to provide participants with tools related to body approaches and visual arts for the construction of intervention and care strategies with different populations in occupational therapy. The proposals sensitized the states of presence of the bodies, seeking a greater aggregation of the parts and a more powerful connection with the present and with the environments. The experience promoted a space of creation and group interaction and expressed the uniqueness of the processes of each participant in the midst of collective production.Key words:  Art; Body; Education; Group; Occupational Therapy.

  8. E-LEARNING SYSTEM DEVELOPMENT IN ACCORDANCE WITH THE REQUIREMENTS OF EFQUEL: VYATKA STATE UNIVERSITY EXPERIENCE

    Directory of Open Access Journals (Sweden)

    Elena Syrtsova

    2017-06-01

    Full Text Available The article is devoted to the study of various aspects of development and implementation of e-learning at higher education institutions. This system has been created according to the main approaches and criteria used by the European Foundation for quality assurance of e-learning (EFQUEL. The article presents the main results of the experiment on Vyatka State University's e-learning system development. The article reveals the feasibility of the development of e-learning in the region. The authors consider three main strategies of implementation of e-learning system at Vyatka State University. The authors substantiate the choice of the most effective and promising strategy of them based on the analysis and considering the peculiarities of the university and the region. In the article, the fundamental results of the experiment and description of the stages of the implementation of e-learning system are presented.

  9. FNAL Booster intensity, extraction, and synchronization control for collider operation

    International Nuclear Information System (INIS)

    Ducar, R.J.; Lackey, J.R.; Tawzer, S.R.

    1987-03-01

    Booster operation for collider physics is considerably different than for fixed target operation. Various scenarios for collider physics, machine studies, and P-Bar targeting may require that the intensity vary from 5E10 PPP to 3E12 PPP at a 15 Hertz machine cycle rate. In addition to the normal Booster single turn extraction mode, collider operations require that the Booster inject into the Main Ring a small number of beam bunches for coalescing into a single high intensity bunch. These bunches must be synchronized such that the center bunch arrives in the RF bucket which corresponds to the zero phase of the coalescing cavity. The system implemented has the ability to deliver a precise fraction of the available 84 Booster beam bunches to Main Ring or to the P-Bar Debuncher via the newly installed AP-4 beam line for tune-up and studies. It is required that all of the various intensity and extraction scenarios be accommodated with minimal operator intervention

  10. Diretrizes metodológicas para investigar estados alterados de consciência e experiências anômalas Methodological guidelines to explore altered states of consciousness and anomalous experiences

    Directory of Open Access Journals (Sweden)

    Alexander Moreira de Almeida

    2003-01-01

    Full Text Available As experiências anômalas (EA (vivências incomuns ou que se acredita diferentes do habitual e das explicações usualmente aceitas como realidade: alucinações, sinestesia e vivências interpretadas como telepáticas... e os estados alterados de consciência (EAC são descritos em todas as civilizações de todas as eras, constituindo-se elementos importantes na história das sociedades. Apesar disso, têm recebido pouca atenção da comunidade científica, ou são abordados de forma pouco rigorosa. As EA e os EAC podem ser estudados sem que se compartilhem as crenças envolvidas, sendo possível investigá-los enquanto experiências subjetivas e, como tais, correlacionados com quaisquer outros dados. Neste artigo, procurou-se apresentar algumas diretrizes metodológicas para um estudo rigoroso do tema, entre elas: evitar uma abordagem preconceituosa e a "patologização" do diferente, a necessidade de uma teoria e de uma revisão exaustiva da literatura existente, utilizar diversos critérios de normalidade e patologia, investigar populações clínicas e não clínicas, desenvolvimento de instrumentos adequados para avaliação, cuidados na escolha dos termos e no estabelecimento de nexos causais, distinguir entre a experiência vivenciada e suas interpretações, considerar o papel da cultura, avaliar a confiabilidade e a validade dos relatos, por fim, o desafio gerado pela necessidade de criatividade e diversidade na escolha dos métodos.Anomalous experiences (AE (uncommon experiences or one that is believed to deviate from the usually accepted explanations of reality: hallucinations, synesthesia, experiences interpreted as telepathic... and altered states of consciousness (ASC are described in all societies of all ages. Even so, the scientists have long neglected the studies on this theme. To study AE and ASC is not necessary to share the believes we discuss, they can be investigated as subjective experiences and correlated like any

  11. Nuclear E&T for Building and Sustaining Capacity from Korean Experience

    International Nuclear Information System (INIS)

    Nam, Youngmi

    2014-01-01

    Lessons learned: • A strong national initiative needs to be maintained, involving stakeholders with a staged national nuclear E&T plan and its execution together with an HRD plan. • An integrated competence based E&T for NEPIOs, operators, regulators, TSOs and etc. is an important element to become a knowledgeable customer or responsible vendor. • International cooperation is a useful mechanism by which long-term and widely ranged experience from others, including international organizations can be absorbed or transferred effectively in a relatively shorter term, minimizing trial and error

  12. Experience of e-learning implementation through massive open online courses

    Science.gov (United States)

    Ivleva, N. V.; Fibikh, E. V.

    2016-04-01

    E-learning is considered to be one of the most prospective directions in education development worldwide. To have a competitive advantage over other institutions offering a wide variety of educational services it is important to introduce information and communication technologies into the educational process to develop e-learning on the whole. The aim of the research is to reveal problems which prevent from full implementation of e-learning at the Reshetnev Siberian State Aerospace University (SibSAU) and to suggest ways on solving those problems through optimization of e-learning introduction process at the university by motivating students and teaching staff to participate in massive open online courses and formation of tailored platforms with the view to arrange similar courses at the premises of the university. The paper considers the introduction and development level of e-learning in Russia and at SibSAU particularly. It substantiates necessity to accelerate e-learning introduction process at an aerospace university as a base for training of highly-qualified specialists in the area of aviation, machine building, physics, info-communication technologies and also in other scientific areas within which university training is carried out. The paper covers SibSAU’s experience in e-learning implementation in the educational process through students and teaching staff participation in massive open online courses and mastering other up-to-date and trendy educational platforms and their usage in the educational process. Key words. E-learning, distance learning, online learning, massive open online course.

  13. "Haunting experiences: Ghosts in contemporary folklore," by Diane E. Goldstein et al.

    Directory of Open Access Journals (Sweden)

    Linda Levitt

    2010-03-01

    Full Text Available Diane E. Goldstein, Sylvia Ann Grider, and Jeannie Banks Thomas. Haunting experiences: Ghosts in contemporary folklore. Logan: Utah State University Press, 2007, paperback, $24.95 (272p ISBN 978-0-87421-636-3.

  14. Indivíduo e pessoa na experiência da saúde e da doença

    Directory of Open Access Journals (Sweden)

    Luiz Fernando Dias Duarte

    Full Text Available Revisão de uma linha de pesquisa no campo das ciências sociais em saúde no Brasil que se centra na hipótese metodológica de uma diferença cultural fundamental entre os modelos relacionais de "pessoa" e o modelo do "indivíduo" ocidental moderno (pensado como livre, autônomo e igual. Essa diferença cultural é de particular importância na caracterização das formas diferenciais de experiência da saúde e da doença entre as classes populares das sociedades nacionais modernas e os segmentos portadores dos saberes biomédicos eruditos, dominantes e oficiais. Estes últimos têm um compromisso originário com algumas características da ideologia do individualismo, tais como o universalismo/racionalismo e o cientificismo/fisicalismo. As representações, práticas e instituições dela dependentes ocupam um espaço de oposição à forma integrada, relacional, holista, como são pensadas e experimentadas as "doenças" (ou, como prefiro, as "perturbações físico-morais" mesmo nos segmentos "individualizados", quanto mais nos segmentos regidos por representações hierárquicas, relacionais, de "pessoa". Apresentam-se os fundamentos antropológicos dessa perspectiva analítica e as diferentes dimensões da produção acadêmica a ela associada, em comparação com as de outras tendências do campo.

  15. Diabetes mellitus juvenil: a experiência de familiares de adolescentes e pré-adolescentes Juvenile diabetes: the family's experience with diabetic adolescents and pre-adolescents

    Directory of Open Access Journals (Sweden)

    Thaís Basso de Brito

    2009-06-01

    Full Text Available Este estudo foi desenvolvido com o objetivo de investigar a experiência de cuidar de adolescentes e pré-adolescentes portadores de diabetes tipo I, na perspectiva dos seus familiares. Foi utilizada a abordagem fenomenológica, modalidade de pesquisa qualitativa que se propõe a compreender os significados das experiências vividas. Foram entrevistados dez pais (9 mães e 1 pai em hospital de ensino do interior paulista. A experiência de cuidar do filho com diabetes emerge das convergências das descrições dos participantes, sendo descrita em três temas principais: o universo da doença; relação com as pessoas; reflexão sobre a experiência vivida. Os participantes descrevem suas dificuldades e estratégias para manterem a família unida e ainda oferecer suporte aos filhos. Eles acreditam que têm que aceitar e enfrentar os desafios, além de estimularem os filhos para sua segurança e qualidade de vida. Os dados mostraram a necessidade de um suporte profissional, além de um espaço para a discussão de temas tanto para as crianças com diabetes como para seus familiares.This study aimed at investigating the experience of taking care of adolescents and pre-adolescents with type 1 diabetes from the standpoint of their family members. A phenomenological approach, i.e. a type of qualitative analysis aimed at understanding the meaning of life experiences, was used. Ten parents (9 mothers and 1 father were interviewed at a teaching hospital in the interior of São Paulo state. The experience of taking care of a child with diabetes emerged from the converging points reported under 3 main themes: the universe of the disease; personal relationships; reflections on the experience. The participants described their difficulties and the strategies they use for keeping the family together besides providing support to the children. They believe they have to accept and face the challenges, besides motivating their children in order to ensure their

  16. Genitourinary injuries after traffic accidents: Analysis of a registry of 162,690 victims.

    Science.gov (United States)

    Terrier, Jean-Etienne; Paparel, Philippe; Gadegbeku, Blandine; Ruffion, Alain; Jenkins, Lawrence C; N'Diaye, Amina

    2017-06-01

    Traffic accidents are the most frequent cause of genitourinary injuries (GUI). Kidney injuries after trauma have been well described. However, there exists a paucity of data on other traumatic GUI after traffic accidents. The objective of this study was to analyze the frequency and type of all GUI, by user category, after traffic accidents. Patient cases were extracted from the trauma registry of the French department of Rhone from 1996 to 2013. We assessed the urogenital injuries presented by each of road user's categories. Severity injuries were coded with the Abbreviated Injury Scale and the Injury Severity Score. Kidney trauma was mapped with the classification of the American Association for the Surgery of Trauma. Multivariate prediction models were used for analysis of data. Of 162,690 victims, 963 presented with GUI (0.59%). 47% were motorcyclists, 22% were in a car, 18% on bicycles, and 9% were pedestrians. The most common organ injury was kidney (41%) followed by testicular (23%). Among the 208 motorists with a GUI, kidney (70%), bladder (10%), and adrenal gland (9%) were the most frequent lesions. Among the 453 motorcyclist victims with GUI, kidney (35%) and testicular (38%) traumas were the most frequent and 62% of injuries involved external genitalia. There were 175 cyclists with GUI, 70% of injuries involved external genitalia; penile traumas (23%) were the most frequent. In total, there were 395 kidney injuries, most being low grade. According to the American Association for the Surgery of Trauma kidney injuries were grade I, 59%; grade II, 11%; grade III, 16%; grade IV, 9%; grade V, 3%; and indeterminate, 2%. GUI is an infrequent trauma after traffic accidents, with kidneys being the most commonly injured. Physicians must maintain a high awareness for external genitalia injuries in motorcyclists and cyclists. Prognostic and epidemiologic study, level III.

  17. JSC Case Study: Fleet Experience with E-85 Fuel

    Science.gov (United States)

    Hummel, Kirck

    2009-01-01

    JSC has used E-85 as part of an overall strategy to comply with Presidential Executive Order 13423 and the Energy Policy Act. As a Federal fleet, we are required to reduce our petroleum consumption by 2 percent per year, and increase the use of alternative fuels in our vehicles. With the opening of our onsite dispenser in October 2004, JSC became the second federal fleet in Texas and the fifth NASA center to add E-85 fueling capability. JSC has a relatively small number of GSA Flex Fuel fleet vehicles at the present time (we don't include personal vehicles, or other contractor's non-GSA fleet), and there were no reasonably available retail E-85 fuel stations within a 15-minute drive or within five miles (one way). So we decided to install a small 1000 gallon onsite tank and dispenser. It was difficult to obtain a supplier due to our low monthly fuel consumption, and our fuel supplier contract has changed three times in less than five years. We experiences a couple of fuel contamination and quality control issues. JSC obtained good information on E-85 from the National Ethanol Vehicle Coalition (NEVC). We also spoke with Defense Energy Support Center, (DESC), Lawrence Berkeley Laboratory, and US Army Fort Leonard Wood. E-85 is a liquid fuel that is dispensed into our Flexible Fuel Vehicles identically to regular gasoline, so it was easy for our vehicle drivers to make the transition.

  18. Experiências inovadoras de cuidado no Programa Saúde da Família (PSF: potencialidades e limites

    Directory of Open Access Journals (Sweden)

    Alice da Costa Uchôa

    2009-06-01

    Full Text Available Atualmente, o PSF convive com práticas do modelo biomédico e outras marcadoras de mudança. Este artigo aborda experiências inovadoras de cuidado baseada em pesquisa realizada em Natal no período de 2005 a 2007. Teve como objetivo compreender os sentidos da integralidade, discutir o papel da criatividade e sensibilidade dos profissionais e analisar as possibilidades de institucionalização e sustentabilidade. Utilizou análise documental; entrevista semi-estruturada com os protagonistas, observação das unidades e experiências. Dentre as concepções de integralidade encontradas destacam-se: promoção da saúde como mudança do estilo de vida; aproximações dialógicas entre saber científico e popular; fortalecimento da participação popular, auto-cuidado. Houve reconhecimento social expressos em ganho de prêmios, publicações e peças teatrais. Nenhum dos projetos contava com financiamento. Conclui-se que as experiências têm uma vocação para promoção e cuidado, mas ainda não têm sustentabilidade financeira e política.

  19. Representações e experiências das mulheres sobre a assistência ao parto vaginal e cesárea em maternidades pública e privada Women's representations and experiences with vaginal and cesarean delivery in public and private maternity hospitals

    Directory of Open Access Journals (Sweden)

    Andréa de Sousa Gama

    2009-11-01

    Full Text Available Este estudo analisa as diferentes representações e experiências quanto ao parto vaginal e cesárea de mulheres de diferentes estratos sócio-econômicos, bem como a natureza das relações profissionais de saúde/usuárias no contexto institucional em que estão inseridas. A pesquisa de natureza qualitativa foi desenvolvida em três maternidades do Município do Rio de Janeiro, Brasil, sendo uma pública, uma conveniada com o SUS e uma particular, com mulheres que tiveram os dois tipos de parto. Os resultados revelam que o modelo de organização dos serviços público e privado apresentam variações que produzem diferentes tipos de assistência e de relação entre os profissionais de saúde e as usuárias, dando forma a experiências distintas entre as mulheres pesquisadas. Todavia, ao empreendermos uma crítica assentada nas relações de gênero, podemos verificar que o modelo de assistência ao parto permanece submetendo quem deve ser sujeito e reproduzindo o projeto da medicalização - mesmo que este processo se manifeste de formas diferenciadas entre os grupos estudados -, o que reduz o campo da assistência e inviabiliza um lugar de poder diferenciado das usuárias.This study analyzes the different representations and experiences of women from different social classes, including issues related to their relations with hospital staff in different institutional settings. This qualitative study focused on women who had experienced both types of delivery, in three maternity hospitals in Rio de Janeiro, Brazil (one public, one fully private, and another private under an outsourcing agreement with the public health system. The study showed that variations in public and private service models result in different types of delivery care and different relations with staff, and are reflected in different birthing experiences for the women. However, a critical gender perspective shows that in both cases, the service models reproduce the

  20. Data acquisition system for Experiment E866 at the Brookhaven AGS

    International Nuclear Information System (INIS)

    Ashktorab, K.; LeVine, M.J.; Scheetz, R.A.

    1993-01-01

    Experiment E866 consists of two spectrometers and related detectors for investigations of collisions of relativistic beams of Au ions with fixed targets at the Brookhaven AGS. The data acquisition system, consisting of 11 CPUs in a single VME crate, gathers data from 8 Camac crates and 6 Fastbus crates

  1. Jefferson Lab E89-044 experiment: study of the quasi-elastic He3(e,e'p)d reaction in parallel kinematics

    International Nuclear Information System (INIS)

    Penel-Nottaris, E.

    2004-07-01

    The Jefferson Lab Hall A E89-044 experiment has measured the He 3 (e,e'p) reaction cross-sections. The extraction of the longitudinal and transverse response functions for the two-body break-up He 3 (e,e'p)d reaction in parallel kinematics allows the study of the bound proton electromagnetic properties inside the He 3 nucleus and the involved nuclear mechanisms beyond plane waves approximations, for missing momenta of 0 and +- 300 MeV/c and transferred momenta from 0.8 to 4.1 GeV 2 . Preliminary cross-sections have been obtained after calibration of the experimental setup by fitting theoretical models averaged over the experimental phase-space using a Monte-Carlo simulation. The 8% systematic error on cross-sections is linked mainly to the absolute normalization of the target density: the elastic scattering data analysis will allow to reduce this error. The preliminary results show some disagreement with theoretical predictions for the forward angles kinematics around 0 MeV/c missing momenta and sensitivity to final state interactions and He 3 waves functions for missing momenta of 300 MeV/c. The longitudinal and transverse separation should constraint theoretical models more strongly. (author)

  2. Energy spectra of hadrons and leptons in the atmosphere

    International Nuclear Information System (INIS)

    Butkevich, A.V.; Dedenko, L.G.; Zheleznykh, I.M.; Kiryushkin, V.P.; Sobolevskij, N.M.

    1982-01-01

    Differential energy spectra of hadrons were calculated in the energy range of 10 11 -10 15 eV in the Earth atmosphere at depths of 60, 260, 690 and 1000 gxcm -2 . The Nickolski spectrum has the best agreement with experiment at a depth of 60 gxcm -2 . At high depths the Grigorov spectrum is less intensive, and the Nickolski and Rayan spectra agree with experiment without errors. Calculations of low energy neutrino fluxes in the atmospehere are given. Total fluxes of muon and electron neutrinos at neutrino energies Esub(γ) -2 xs -1 , correspondingly

  3. Sustainable E-Participation through participatory experiences in education

    Directory of Open Access Journals (Sweden)

    Ursula Maier-Rabler

    2010-09-01

    Full Text Available Normal 0 21 false false false DE-AT X-NONE X-NONE The understanding of participation as a political matter has changed back and forth over the years. The latest twist back to appreciative attributions towards participation is fuelled by the development of the Internet, and especially the Social Web. Citizen participation is unanimously seen as an essential precondition for Deliberative-Collaborative eDemocracy (Petrik, 2010 enabled by Web 2.0. This paper considers participatory culture and its specific political, cultural, societal, and educational characteristics as a prerequisite for e-participation and argues that social media literacy is indispensable for e-participation to be sustainable. Young people’s affinity spaces (Jenkins, et.al., 2006 can only lay down the foundations for social media literacy, but their further development depends on education. Political Education would be well advised to adapt innovative pedagogical approaches to the acquirement of new media literacy. This paper introduces an exemplary educational tool – predominately but not exclusively for political/civic education – namely the website PoliPedia.at. Teachers can use it to deliberately create a balanced space for collaboration between Digital Immigrants and Digital Natives. PoliPedia – as a participative online tool – has the potential to facilitate participation experience in political/civic education and supports social media education. Thereby the embedding of technology in pedagogical and societal conceptualizations is crucial.

  4. Sustainable E-Participation through participatory experiences in education

    Directory of Open Access Journals (Sweden)

    Ursula Maier-Rabler

    2010-09-01

    Full Text Available The understanding of participation as a political matter has changed back and forth over the years. The latest twist back to appreciative attributions towards participation is fuelled by the development of the Internet, and especially the Social Web. Citizen participation is unanimously seen as an essential precondition for Deliberative-Collaborative eDemocracy (Petrik, 2010 enabled by Web 2.0. This paper considers participatory culture and its specific political, cultural, societal, and educational characteristics as a prerequisite for e-participation and argues that social media literacy is indispensable for e-participation to be sustainable. Young people’s affinity spaces (Jenkins, et.al., 2006 can only lay down the foundations for social media literacy, but their further development depends on education. Political Education would be well advised to adapt innovative pedagogical approaches to the acquirement of new media literacy. This paper introduces an exemplary educational tool – predominately but not exclusively for political/civic education – namely the website PoliPedia.at. Teachers can use it to deliberately create a balanced space for collaboration between Digital Immigrants and Digital Natives. PoliPedia – as a participative online tool – has the potential to facilitate participation experience in political/civic education and supports social media education. Thereby the embedding of technology in pedagogical and societal conceptualizations is crucial.

  5. As contribuições teórico-metodológicas de E. P. Thompson: experiência e cultura

    Directory of Open Access Journals (Sweden)

    Suely Aparecida Martins

    2006-01-01

    Full Text Available O artigo destaca as contribuições teórico-metodológicas do historiador marxista Edward Palmer Thompson e que podem ser úteis para a pesquisa sociológica. A partir de pesquisa bibliográfica, apresenta-se uma breve biografia do autor e em seguida algumas categorias importantes desenvolvidas por ele, como experiência e cultura. Ressalta-se também a ênfase de Thompson em tratar as categorias teóricas considerando-se a processualidade histórica. Por fim, são levantadas algumas possibilidades de análise da juventude do campo na atualidade a partir das contribuições teórico-metodológicas desse autor.

  6. FNAL Discovers New Physics

    Science.gov (United States)

    Discovery It is the dawn of a new era in particle physics. Physicists have incorporated decades of barriers of energy, precision and intensity to explore new frontiers in particle physics. Physicists look physics. The Standard Model is the current framework for our understanding of matter. Activities The

  7. The challenges of new nuclear projects. E.ON Experience; Los desafios de los nuevos proyectos nucleares. Experiencia de E.ON

    Energy Technology Data Exchange (ETDEWEB)

    Spechty, J.; Perez Rodriguez, J. L.

    2012-07-01

    E.ON is one of the largest privately-owned energy companies in the world. Its portfolio of nuclear assets in composed of 21 nuclear power plants on 13 sites located in Germany and Sweden, 9 of which are directly operated by E.ON. At present E.ON develops large-scale construction projects in two of the European countries willing to commit to new nuclear build-Finland and UK - for which its experience as the best nuclear power plant operator in Europe is key. (Author)

  8. Limits on likesign dilepton production in nu/sub μ/ interactions

    International Nuclear Information System (INIS)

    Baker, N.J.; Connolly, P.L.; Kahn, S.A.

    1985-01-01

    We have searched for the production of likesign dilepton events (nu/sub μ/ + Ne → μ - + e - + ...) in a wideband neutrino beam at FNAL using the 15' bubble chamber. We observe no signal above the background arising from conventional sources. We set 90% confidence level upper limits for the production rates of (nu/sub μ/ + Ne → μ - + e - + ...)/(nu/sub μ/ + Ne → μ - + ...) less than or equal to 8 * 10 -5 and (nu/sub μ/ + Ne → μ - + e - + ...)/(nu/sub μ/ + Ne → μ - + e + + ...) less than or equal to 6 * 10 -2

  9. Status and first results of BNL experiment 777: A search for K+ → π+μ+e- and a study of K+ → μ+e+e-

    International Nuclear Information System (INIS)

    Baker, N.J.; Gordon, H.A.; Lazarus, D.M.

    1987-01-01

    Results of our search for short lived neutral particles emitted in K + decay are given. We also seek to make an accurate measurement of the branching ratio for π 0 → e + e - by looking for the decay chain K + → π + π 0 , π 0 → e + e - . The world average branching ratio for this decay is (1.8 +- 0.7) x 10 -7 based on about 30 events from two experiments. Theory predicts that this branching ratio should be of order 6 x 10 -8 . If the branching ratio remains at the 2 x 10 -7 level when measured with smaller errors, this could be an indication of new physics. 24 refs., 7 figs

  10. Studies of Nu-mu to Nu-e Oscillation Appearance in the MINOS Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Pereira e Sousa, Alexandre Bruno [Tufts Univ., Medford, MA (United States)

    2006-02-01

    The MINOS experiment uses a long baseline neutrino beam, measured 1 km downstream from its origin in the Near Detector at Fermilab, and 734 km later in the large underground Far Detector in the Soudan mine. By comparing these two measurements, MINOS can probe the atmospheric domain of the neutrino oscillation phenomenology with unprecedented precision. Besides the ability to perform a world leading determination of the Δm$2\\atop{23}$ and θ23 parameters, via vμ flux disappearance, MINOS has the potential to make a leading measurement of vμ → ve oscillations in the atmospheric sector by looking for ve appearance at the Far Detector. The observation of ve appearance, tantamount to establishing a non-zero value of the θ13 mixing angle, opens the way to studies of CP violation in the leptonic sector, the neutrino spectral mass pattern ordering and neutrino oscillations in matter, the driving motivations of the next generation of neutrino experiments. In this thesis, we study the MINOS potential for measuring θ13 in the context of the MINOS Mock Data Challenge using a multivariate discriminant analysis method. We show the method's validity in the application to ve event classification and background identification, as well as in its ability to identify a ve signal in a Mock Data sample generated with undisclosed parameters. An independent shower reconstruction method based on three-dimensional hit matching and clustering was developed, providing several useful discriminator variables used in the multivariate analysis method. We also demonstrate that within 2 years of running, MINOS has the potential to improve the current best limit on θ13, from the CHOOZ experiment, by a factor of 2.

  11. Track following of Ξ"- hyperons in nuclear emulsion for the E07 experiment

    International Nuclear Information System (INIS)

    Mishina, Akihiro; Endo, Yoko; Hoshino, Kaoru

    2015-01-01

    The E07 experiment is expected to provide knowledge of S = -2 systems with ten times more statistics than that of the past E373 experiment. To achieve this in a reasonable time, an automated track following system is very important. This system consists of three techniques, 'emulsion surface detection', 'alignment of plate by plate connection with K"- beams' and 'followed track recognition in nuclear emulsion'. Ξ"- hyperon candidate tracks are followed from the entrance to the end point in the emulsion. If the system operates properly such that one track is processed in each plate within one minute, all Ξ"- candidate tracks can be followed successfully to their stopping points in a year. The development of softwares for the system is ongoing. (author)

  12. 8 June 2010 - South Dakota Governor M. Rounds signing the guest book with External Relations Office Adviser R. Voss, visiting the LHC superconducting Magnet test hall with Technology Department L. Bottura, in the CERN Control Centre with Beams Department Head P. Collier, ATLAS visitor Centre with Deputy Collaboration Spokesperson A. Lankford and visiting CMS Control Centre with Deputy Collaboration Spokesperson J. Incandela. LHC Communications and FNAL member K. Yurkewicz accompanies throughout (see complete delegation list below).

    CERN Multimedia

    Teams (M. Brice/J.C. Gadmer)

    2010-01-01

    CERN-HI-1006100 24: from left to right: Permanent Mission Representative A. Shybut; External Relations Office Adviser R. Voss; LHC Communications and FNAL K. Yurkewicz, Washington CSG Director for internationl programmes S. Sutcliffe-Stephenson; Technology Department Representative L. Bottura; South Dakota State Patrol D. Svendsen; CSG Executive Director and Former State Senator from Kansas D. Atkins;Office of the First Lady L. Svendsen; Office of the Governor K. Mueller; First Lady J. Rounds; South Dakota Governor M. Rounds; Washington State Senator T. Eide;Judge M. Eide; Assemblyman J. Oceguera and G. Oceguera (with son Jackson Oceguera, 5 months).

  13. SU-E-E-05: Initial Experience On Physics Rotation of Radiological Residents

    International Nuclear Information System (INIS)

    Zhang, J; Williams, D; DiSantis, D; Hardy, P; Oates, M

    2014-01-01

    Purpose: The new ABR core exam integrates physics into clinical teaching, with an emphasis on understanding image quality, image artifacts, radiation dose and patient safety for each modality and/or sub-specialty. Accordingly, physics training of radiological residents faces a challenge. A traditional teaching of physics through didactic lectures may not fully fulfill this goal. It is also difficult to incorporate physics teaching in clinical practice due to time constraints. A dedicated physics rotation may be a solution. This study is to evaluate a full week physics workshop developed for the first year radiological residents. Methods: The physics rotation took a full week. It included three major parts, introduction lectures, hand-on experiences and observation of technologist operation. An introduction of basic concepts was given to each modality at the beginning. Hand-on experiments were emphasized and took most of time. During hand-on experiments, residents performed radiation measurements, studied the relationship between patient dose and practice (i.e., fluoroscopy), investigated influence of acquisition parameters (i.g., kV, mAs) on image quality, and evaluated image quality using phantoms A physics test before and after the workshop was also given but not for comparison purpose. Results: The evaluation shows that the physics rotation during the first week of residency in radiology is preferred by all residents. The length of a full week of physics workshop is appropriate. All residents think that the intensive workshop can significantly benefit their coming clinical rotations. Residents become more comfortable regarding the use of radiation and counseling relevant questions such as a pregnant patient risk from a CE PE examination. Conclusion: A dedicated physics rotation, assisting with didactic lectures, may fulfill the requirements of physics of the new ABR core exam. It helps radiologists deeply understand the physics concepts and more efficiently use

  14. SU-E-E-05: Initial Experience On Physics Rotation of Radiological Residents

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, J; Williams, D; DiSantis, D; Hardy, P; Oates, M [University of Kentucky, Lexington, KY (United States)

    2014-06-01

    Purpose: The new ABR core exam integrates physics into clinical teaching, with an emphasis on understanding image quality, image artifacts, radiation dose and patient safety for each modality and/or sub-specialty. Accordingly, physics training of radiological residents faces a challenge. A traditional teaching of physics through didactic lectures may not fully fulfill this goal. It is also difficult to incorporate physics teaching in clinical practice due to time constraints. A dedicated physics rotation may be a solution. This study is to evaluate a full week physics workshop developed for the first year radiological residents. Methods: The physics rotation took a full week. It included three major parts, introduction lectures, hand-on experiences and observation of technologist operation. An introduction of basic concepts was given to each modality at the beginning. Hand-on experiments were emphasized and took most of time. During hand-on experiments, residents performed radiation measurements, studied the relationship between patient dose and practice (i.e., fluoroscopy), investigated influence of acquisition parameters (i.g., kV, mAs) on image quality, and evaluated image quality using phantoms A physics test before and after the workshop was also given but not for comparison purpose. Results: The evaluation shows that the physics rotation during the first week of residency in radiology is preferred by all residents. The length of a full week of physics workshop is appropriate. All residents think that the intensive workshop can significantly benefit their coming clinical rotations. Residents become more comfortable regarding the use of radiation and counseling relevant questions such as a pregnant patient risk from a CE PE examination. Conclusion: A dedicated physics rotation, assisting with didactic lectures, may fulfill the requirements of physics of the new ABR core exam. It helps radiologists deeply understand the physics concepts and more efficiently use

  15. Out-of-Time Beam Extinction in the MU2E Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Prebys, E. J. [Fermilab; Werkema, S. [Fermilab

    2015-06-01

    The Mu2e Experiment at Fermilab will search for the conversion of a muon to an electron in the field of an atomic nucleus with unprecedented sensitivity. The experiment requires a beam consisting of proton bunches 250 ns FW long, separated by 1.7 $\\mu$ sec, with no out-of-time protons at the $10^{10}$ fractional level. Satisfying this "extinction" requirement is very challenging. The formation of the bunches is expected to result in an extinction on the order of $10^5$. The remaining extinction will be accomplished by a system of resonant magnets and collimators, configured such that only in-time beam is delivered to the experiment. Our simulations show that the total extinction achievable by the system is on the order of $10^{12}$, with an efficiency for transmitting in-time beam of 99.6%.

  16. PREFACE: Workshop Photograph and Program

    Science.gov (United States)

    2011-07-01

    Workshop photograph Workshop Program Sunday 28 March 201019:00-21:00 Reception at Okura Frontier Hotel Tsukuba(Buffet style dinner with drink) Monday 29 March 2010Introduction (Chair: André Rubbia (ETH Zurich))09:00 Welcome address (05') Atsuto Suzuki (KEK)09:05 Message from CERN on neutrino physics (10') Sergio Bertolucci (CERN)09:15 Message from FNAL on neutrino physics (10') Young Kee Kim (FNAL)09:25 Message from KEK on neutrino physics (10') Koichiro Nishikawa (KEK)09:35 Introductory remark on GLA2010 (10') Takuya Hasegawa (KEK) Special session (Chair: Koichiro Nishikawa (KEK))09:45 The ICARUS Liquid Argon TPC (45') Carlo Rubbia (CERN)10:30-11:00 Coffee break Main goals of Giant Liquid Argon Charge Imaging Experiments I (Chair: Takashi Kobayashi (KEK))11:00 Results from massive underground detectors (non accelerator) (30') Takaaki Kajita (ICRR, U. of Tokyo)11:30 Present long baseline neutrino experiments (30') Chang Kee Jung (SUNY Stony Brook)12:00-12:10 Workshop picture12:10-14:00 Lunch break Main goals of Giant Liquid Argon Charge Imaging Experiments II (Chair: Takashi Kobayashi (KEK))14:00 Physics goals of the next generation massive underground experiments (30') David Wark (Imperial College London)14:30 Near detectors for long baseline neutrino experiments (20') Tsuyoshi Nakaya (Kyoto U.) Lessons on Liquid Argon Charge Imaging technology from ongoing developments (Chair: Chang Kee Jung (SUNY Stony Brook))14:50 WARP (30') Claudio Montanari (U. of Pavia)15:20 ArDM (30') Alberto Marchionni (ETH Zurich)15:50 From ArgoNeuT to MicroBooNE (30') Bonnie Fleming (Yale U.)16:20 250L (30') Takasumi Maruyama (KEK)16:50 The DEAP/CLEAN project (20') Mark Boulay (Queen's U.)17:10-17:40 Coffee break Lessons from Xe based Liquids Imaging detectors (Chair: Flavio Cavanna (U. of L'Aquilla))17:30 MEG (20') Satoshi Mihara (KEK)17:50 The XENON project (20') Elena Aprile (Columbia U.)18:10 XMASS (20') Hiroyuki Sekiya (ICRR, U. of Tokyo) Studies on physics performance (Chair

  17. IRPhE/STEK, Reactor Physics Experiments from Fast-Thermal Coupled Facility

    International Nuclear Information System (INIS)

    Dietze, Klaus; Klippel, Henk Th.; Koning, Arjan; Jacqmin, Robert

    2003-01-01

    1 - Description: The STEK-experiments have been performed to check neutron data of the most important reactor materials, especially of fission product nuclides, fuel isotopes and structural materials. The measured central reactivity worths (CRW) of small samples were compared with calculated values. These C/E-ratios have been used then for data corrections or in adjustment procedures. The reactors STEK (ECN Petten/ Netherlands) was a fast-thermal coupled facility of zero power. The annular thermal drivers were filled by fuel assemblies and moderated by water. The inner insertion lattices were loaded with pellets of fuel and other materials producing the fast neutron flux. The characteristics of the neutron and adjoint spectra were obtained by special arrangements of these pellets in unit cells. In this way, a hard or soft neutron spectrum or a special energy behavior of the adjoint function could be reached. The samples were moved by means of tubes to the central position (pile-oscillation technique). The original information about the facility and measurements is compiled in RCN-209, ECN-10 The 5 STEK configurations cover a broad energy range due to their increasing softness. The experiments are very valuable because of the extensive program of sample reactivity measurements with many fission product nuclides important in reactor burn-up calculations. At first, analyses of the experiments have been performed in Petten. Newer analyses were done later in Cadarache / CEA France using the European scheme for reactor calculation JEF-2.2 / ECCO / ERANOS (see Note Techniques and JEF/DOC-746). Furthermore, re-analyses were performed in O-arai / JNC Japan with the JNC standard route JENDL-3.2 / SLAROM / CITATION / PERKY. Results obtained with both code systems and different data evaluations (JEF-2.2 and JENDL-3.2) are compared in JEF/DOC-861. It contains the following documents: 31 Reports, 2 publications, 5 JEF documents, 4 conferences. 2 - Related or auxiliary programs

  18. Popis šablony ČSN ISO 690:2011 v jazyce CSL pro citační manažer Zotero

    OpenAIRE

    Ansorge Libor; Kratochvíl Jiří

    2013-01-01

    Necitování zdrojů použitých ve vlastní práci je považováno za porušení citační etiky a především je v rozporu s autorským zákonem. Ve světě existuje řada citačních stylů, jejichž množství se odvíjí od různých požadavků jednotlivých vydavatelů. V takovéto situaci autorům usnadňují citování různé citační manažery, z nichž některé využívají jazyk Citation Style Language (CSL). Jedním z nich je i aplikace Zotero, pro kterou je v současnosti optimalizována šablona citační normy ČSN ISO 690, jež je...

  19. Summary of sensor evaluation for the Fusion ELectromagnetic Induction eXperiment (FELIX)

    International Nuclear Information System (INIS)

    Knott, M.J.

    1982-08-01

    As part of the First Wall/Blanket/Shield Engineering Test Program, a test bed called FELIX (Fusion ELectromagnetic Induction eXperiment) is now under construction at ANL. Its purpose will be to test, evaluate, and develop computer codes for the prediction of electromagnetically induced phenomenon in a magnetic environment modeling that of a fusion reaction. Crucial to this process is the sensing and recording of the various induced effects. Sensor evaluation for FELIX has reached the point where most sensor types have been evaluated and preliminary decisions are being made as to type and quantity for the initial FELIX experiments. These early experiments, the first, flat plate experiment in particular, will be aimed at testing the sensors as well as the pertinent theories involved. The reason for these evaluations, decisions, and proof tests is the harsh electrical and magnetic environment that FELIX presents

  20. On the intrinsic charm and the recombination mechanisms in charm hadron production

    International Nuclear Information System (INIS)

    Anjos, J.C.; Magnin, J.; Herrera, G.

    2001-09-01

    We study Λ c ± production in pN and π - N interactions. Recent experimental data from the SELEX and E791 Collaborations at FNAL provide important information on the production mechanism of charm hadrons. In particular, the production of the Λ c baryon provides a good test of the intrinsic charm and the recombination mechanisms, which have been proposed to explain the so called leading particle effects. (author)

  1. First observation and study of $K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-$ decay at the NA48/2 experiment

    CERN Document Server

    Misheva, M H; Arcidiacono, R; Balev, S; Batley, J R; Behler, M; Bi­fani, S; Biino, C; Bizzeti, A; Bloch-Devaux, B; Bocquet, G; Cabibbo, N; Calvetti, M; Cartiglia, N; Ceccucci, A; Cenci, P; Cerri, C; Cheshkov, C; Cheze, J B; Ciemencic, M; Collazuol, G; Costantini, F; Cotta Ramusino, A; Coward, D; Cundy, D; Dabrowski, A; Dalpiaz, P; Damiani, C; De Beer, M; Derre, J; Dibon, H; Dilella, L; Doble, N; Eppard, K; Falaleev, V; Fantechi, R; Fidecaro, M; Fiorini, L; Fiorini, M; Fonseca, T; Martin, M; Frabetti, P L; Gatignon, L; Gersabeck, E; Gianoli, A; Giudici, S; Gonidec, A; Goudzovski, E; Goy Lopez, S; Holder, M; Hris­, P; Iacopini, E; Imbergamo, E; Jeitler, M; Kalmus, G; Kekelidze, V; Kleinknecht, K; Kozhuharov, V; Kubis­, W; Lamanna, G; Lazzeroni, C; Lenti, M; Litov, L; Madigozhin, D; Maier, A; Mannelli, I; Marchetto, F; Mare, G; Markytan, M; Marouelli, P; Martini, M; Masetti, L; Mazzucato, E; Michetti, A; Mikulec, I; Molokanova, N; Monnier, E; Moosbrugger, U; Morales Morales, C; Munday, D J; Nappi, A; Neuhofer, G; Norton, A; Pa­, M; Pepe, M; Peters, A; Petrucci, F; Petrucci, M C; Peyaud, B; Piccini, M; Pierazzini, G; Polenkevich, I; Potrebenikov, Yu; Raggi, M; Renk, B; Rubin, P; Ruggiero, G; Savrie, M; Scarpa, M; Shieh, M; Slater, M W; Sozzi, M; Stoynev, S; Swallow, E; Szleper, M; Valdata-Nappi, M; Vallage, B; Velasco, M; Veltri, M; Venditti, S; Wache, M; Wahl, H; Walker, A; Wanke, R; Widhalm, L; Winhart, A; Winston, R; Wood, M D; Wotton, S A; Yushchenko, A; Zinchenko, M; Ziolkowski, M

    2015-01-01

    A sample of almost 2000 $K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-$ rare decays with a background contamination below 3% is observed for the first time by the NA48/2 experiment at CERN/SPS. The preliminary branching ratio in the full kinematic region is obtained to be $BR(K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-)$ = (4.06 ± 0.17) x $10^{-6}$ by analyzing the data set recorded in 3-month NA48/2 run during 2003. The measured value is in agreement with the theoretical prediction within one standard deviation.

  2. Relação da experiência da marca e envolvimento na lealdade : estudo de caso das marcas Samsung e Apple

    OpenAIRE

    Barbosa, Tiago Manuel de Almeida

    2017-01-01

    Mestrado em Gestão Exame Público realizado em 20 de Dezembro de 2017 As crescentes mudanças e evoluções de tendências, produtos, serviços e tecnologias obrigam a que as organizações estejam atentas e preparadas para acompanhar essas transformações. O consumidor está ele também cada vez mais exigente e procura sobretudo as organizações que correspondam às suas expetativas. Através das Marcas as organizações têm a oportunidade de, pelas suas estratégias, potenciar Experiências aos seus co...

  3. Design and experiment of high-current low-pressure plasma-cathode e-gun

    International Nuclear Information System (INIS)

    Xie Wenkai; Li Xiaoyun; Wang Bin; Meng Lin; Yan Yang; Gao Xinyan

    2006-01-01

    The preliminary design of a new high-power low pressure plasma-cathode e-gun is presented. Based on the hollow cathode effect and low-pressure glow discharge empirical formulas, the hollow cathode, the accelerating gap, and the working gas pressure region are given. The general experimental device of the low-pressure plasma cathode electron-gun generating high current density e-beam source is shown. Experiments has been done in continuous filled-in gases and gases-puff condition, and the discharging current of 150-200 A, the width of 60 μs and the collector current of 30-80 A, the width of 60 μs are obtained. The results show that the new plasma cathode e-gun can take the place of material cathode e-gun, especially in plasma filled microwave tubes. (authors)

  4. Probing the eV-mass range for solar axions with the CAST experiment

    International Nuclear Information System (INIS)

    Vogel, J.

    2009-01-01

    The CERN Axion Solar Telescope (CAST) is searching for solar axions, which could be produced in the core of the Sun via the so-called Primakoff effect. For this purpose, CAST uses a decommissioned LHC prototype magnet. In its magnetic field of 9 Tesla axions could be reconverted into X-ray photons. The magnet is mounted on a structure built to follow the Sun during sunrise and sunset for a total of about 3 hours per day. The analysis of the data acquired during the first phase of the experiment with vacuum in the magnetic field region yielded the most restrictive experimental upper limit on the axion-to-photon coupling constant for axion masses up to about 0.02 eV. In order to extend the sensitivity of the experiment to a wider mass range, the CAST experiment continued its search for axions with helium in the magnet bores. In this way it is possible to restore coherence for larger masses. Changing the pressure of the helium gas enables the experiment to scan different axion masses. In the first part of this second phase of CAST, helium-4 has been used and the axion mass region was extended up to 0.4 eV. Therefore the experiment enters the regions favored by axion models. In CAST's ongoing helium-3 phase the studied mass range is now further extended. We will present the final results of CAST's helium-4 phase. Furthermore the latest upgrades of the experiments will be shown and an outlook on CAST's status and prospects will be given. (author)

  5. The Calibration System of the E989 Experiment at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Anastasi, Antonio [Univ. of Messina (Italy)

    2017-01-01

    The muon anomaly aµ is one of the most precise quantity known in physics experimentally and theoretically. The high level of accuracy permits to use the measurement of aµ as a test of the Standard Model comparing with the theoretical calculation. After the impressive result obtained at Brookhaven National Laboratory in 2001 with a total accuracy of 0.54 ppm, a new experiment E989 is under construction at Fermilab, motivated by the diff of aexp SM µ - aµ ~ 3σ. The purpose of the E989 experiment is a fourfold reduction of the error, with a goal of 0.14 ppm, improving both the systematic and statistical uncertainty. With the use of the Fermilab beam complex a statistic of × 21 with respect to BNL will be reached in almost 2 years of data taking improving the statistical uncertainty to 0.1 ppm. Improvement on the systematic error involves the measurement technique of ωa and ωp, the anomalous precession frequency of the muon and the Larmor precession frequency of the proton respectively. The measurement of ωp involves the magnetic field measurement and improvements on this sector related to the uniformity of the field should reduce the systematic uncertainty with respect to BNL from 170 ppb to 70 ppb. A reduction from 180 ppb to 70 ppb is also required for the measurement of ωa; new DAQ, a faster electronics and new detectors and calibration system will be implemented with respect to E821 to reach this goal. In particular the laser calibration system will reduce the systematic error due to gain fl of the photodetectors from 0.12 to 0.02 ppm. The 0.02 ppm limit on systematic requires a system with a stability of 10-4 on short time scale (700 µs) while on longer time scale the stability is at the percent level. The 10-4 stability level required is almost an order of magnitude better than the existing laser calibration system in particle physics, making the calibration system a very challenging item. In addition to the high level

  6. Detector system for e-d scattering experiments on the VEPP-3 storage ring

    International Nuclear Information System (INIS)

    Isaeva, L.G.; Lazarenko, B.A.; Nikolenko, D.M.; Popov, S.G.; Rachek, I.A.; Ukraintsev, Yu.G.; Tsentalovich, E.P.; Wojtsekhowski, B.B.; Nelubin, V.V.

    1993-01-01

    Experiments on electron scattering from polarized deuterons were carried out on the VEPP-3 storage ring at the Novosibirsk Institute for Nuclear Physics. The e-D coincidences were detected for elastic scattering experiments, and the p-n coincidences for photo disintegration studies. The tensor analyzing power of the elastic scattering was measured in the range of momentum transfer up to 3 f -1 , and of photo disintegration in the range of photon energy up to 500 MeV. The detector system created for these experiments and the data analysis procedures are described in this paper. (orig.)

  7. Notas sobre narração e experiência em Walter Benjamin

    Directory of Open Access Journals (Sweden)

    Wagner de Avila Quevedo

    2008-12-01

    Full Text Available O objetivo deste texto é o de elucidar alguns escritos clássicos sobre o conceito de experiência (Erfahrung em Walter Benjamin, mostrando sua relação com a narração (Erzählung e a memória.

  8. A relação mãe/criança com deficiência: sentimentos e experiências The relation mother/child with disabilities: feelings and experiences

    Directory of Open Access Journals (Sweden)

    Atos Prinz Falkenbach

    2008-12-01

    Full Text Available O presente estudo investiga os sentimentos e as experiências de pais e mães de crianças com deficiência. Surge das motivações em compreender o cotidiano dos pais e mães de crianças com deficiência integrante do Projeto de Psicomotricidade Relacional da UNIVATES. De corte qualitativo, trata-se de um estudo etnográfico. Os instrumentos utilizados para a coleta de informações são: entrevistas, diários de campo e análise documental. A temática aborda os seguintes aspectos teóricos: a relação primária, a relação do profissional da saúde e a relação social da criança com necessidades especiais. O processo de coleta de informações permitiu organizar as seguintes categorias: a sentimentos manifestos no nascimento de um filho com deficiência; b comportamento dos profissionais da área da saúde no ato de dar a notícia aos pais; c necessidades dos pais e mães na relação com os demais familiares e a sociedade e sentimentos e e necessidades envolvidas na perspectiva de educar uma criança com deficiência. Conclui-se que os pais e mães das crianças com necessidades especiais reavaliam seus conceitos iniciais, aprendem a valorizar as potencialidades da criança e requisitam contínuos reforços em suas estimas pessoais que os auxiliam no processo educativo de seus filhos.The present study aims at investigating the feelings and experiences of parents of children with disabilities. It was motivated by the idea of understanding the daily life of the parents of children that take part in the Relational Psychomotricity Project at UNIVATES. The protagonists of the study are the parents integrated in the project. The instruments used for data collection in this ethnographic qualitative study were interviews, field reports and analysis of documents. The study approached the following theoretical aspects: the primary relation, the medical relation and the social relation of the child with disability. The information is organized

  9. Nuclear structure at intermediate energies

    International Nuclear Information System (INIS)

    Bonner, B.E.; Mutchler, G.S.

    1991-01-01

    The theme that unites the sometimes seemingly disparate experiments undertaken by the Bonner Lab Medium Energy Group is a determination to understand in detail the many facets and manifestations of the strong interaction, that which is now referred to as nonperturbative QCD. Whether we are investigating the question of just what does carry the spin of baryons, or the extent of the validity of the SU(6) wavefunctions for the excited hyperons (as will be measured in their radiative decays in our CEBAF experiment), or questions associated with the formation of a new state of matter predicted by QCD (the subject of our BNL experiments E810, E854, as well as our approved experiment at RHIC), -- all these projects share this common goal. Our other experiments represent different approaches to the same broad undertaking. LAMPF E1097 will provide definitive answers to the question of the spin dependence of the inelastic channel of pion production in the n-p interaction. FNAL E683 may well open a new field of investigation in nuclear physics: that of just how quarks and gluons interact with nuclear matter as they transverse nuclei of different sizes. In most all of the experiments mentioned above, the Bonner Lab Group is playing major leadership roles as well as doing a big fraction of the hard work that such experiments require. We use many of the facilities that are unavailable to the intermediate energy physics community and we use our expertise to design and fabricate the detectors and instrumentation that are required to perform the measurements which we decide to do

  10. Observation of an excess of νe, νe events in a beam dump experiment at 400 GeV

    Directory of Open Access Journals (Sweden)

    P. Alibran

    1978-03-01

    Full Text Available A beam dump experiment has been performed at CERN in Gargamelle using the neutrino facility to look for penetrating particles produced either directly in the beam interaction or by prompt decay of new particles. A total of 32 interactions with a visible energy greater than 10 GeV has been found, classified, aftercorrections, into 18 charged current νμ or νμ, 5.1 neutral current and 8.9 νe or νe charged current events. An excess of νe events remains after all subtractions from any established sources. Results are presented in terms of the product of the cross section and the leptonic decay branching ratio of the possible source.

  11. E-learning in radiology: An Italian multicentre experience

    Energy Technology Data Exchange (ETDEWEB)

    Carriero, A., E-mail: profcarriero@virgilio.it [Istituto di Radiologia Diagnostica ed Interventistica, AOU Maggiore della Carità, Corso Mazzini 18, 28100 Novara (Italy); Bonomo, L., E-mail: lbonomo@rm.unicatt.it [Istituto di Radiologia, Università Cattolica del S.Cuore, Largo Gemelli 8, 00168 Roma (Italy); Calliada, F., E-mail: f.calliada@smatteo.pv.it [Istituto di Radiologia c/o IRCCS Policlinico San Matteo Ospedale Generale Regionale, Piazzale Golgi 27100, Pavia (Italy); Campioni, P., E-mail: paolo.campioni@unife.it [Dipartimento di Scienze Chirurgiche, Radiologiche e Anestesiologiche, Sezione di Diagnostica per Immagini, Università di Ferrara Corso della Giovecca No. 203, 44100, Ferrara (Italy); Colosimo, C., E-mail: colosimo@rm.unicatt.it [Istituto di Radiologia, Università Cattolica del S.Cuore, Largo Gemelli 8, 00168 Roma (Italy); Cotroneo, A., E-mail: ar.cotroneo@rad.unich.it [Istituto di Radiologia, Università degli Studi Di Chieti (Italy); Cova, M., E-mail: cova@gnbts.univ.trieste.it [UCO di Radiologia, Ospedale di Cattinara, Strada di Fiume 447, 34149 Trieste (Italy); Ettorre, G.C., E-mail: g.ettorre@unict.it [Dip. Materno-Infantile e Scienze Radiologiche, Az. Ospedaliero-Universitaria Policlinico, Via S. Sofia 86, 95123 Catania (Italy); Fugazzola, C., E-mail: carlo.fugazzola@uninsubria.it [Dipartimento di Radiologia Ospedale Di Circolo, Viale Borri, No. 57, 21100, Varese (Italy); Garlaschi, G., E-mail: giacomog@unige.it [Dipartimento di Medicina interna e Specialità mediche (DIMI) Via L.B. Alberti, 4, 16132 Genova (Italy); Macarini, L., E-mail: l.macarini@unifg.it [Radiologia Universitaria Ospedali Riuniti di Foggia, Viale Pinto, No. 1, 71100, Foggia (Italy); and others

    2012-12-15

    the band speed and technology of the Internet connection. Conclusions: Technological evolution is overcoming all barriers, and technology is also having a positive impact on the approach to teaching. Our multicentre teaching experience merits the following considerations: the quality of the teaching product was certified by the students’ judgements of its didactic content and the quality of reception; the economic cost of the teaching had a minimal impact on the post-graduate schools (€ 18 per lesson). In terms of breaking down national barriers, it is to be hoped that the coordination and integration of diagnostic imaging e-learning projects, with the participation of post-graduate schools in different European countries, can be developed not only in a spirit of “cultural sharing” and the exchange of teaching experiences.

  12. E-learning in radiology: An Italian multicentre experience

    International Nuclear Information System (INIS)

    Carriero, A.; Bonomo, L.; Calliada, F.; Campioni, P.; Colosimo, C.; Cotroneo, A.; Cova, M.; Ettorre, G.C.; Fugazzola, C.; Garlaschi, G.; Macarini, L.

    2012-01-01

    the band speed and technology of the Internet connection. Conclusions: Technological evolution is overcoming all barriers, and technology is also having a positive impact on the approach to teaching. Our multicentre teaching experience merits the following considerations: the quality of the teaching product was certified by the students’ judgements of its didactic content and the quality of reception; the economic cost of the teaching had a minimal impact on the post-graduate schools (€ 18 per lesson). In terms of breaking down national barriers, it is to be hoped that the coordination and integration of diagnostic imaging e-learning projects, with the participation of post-graduate schools in different European countries, can be developed not only in a spirit of “cultural sharing” and the exchange of teaching experiences.

  13. Políticas públicas: pontos de método e experiências

    Directory of Open Access Journals (Sweden)

    Sawaya Ana Lydia

    2006-01-01

    Full Text Available O ÊXITO das políticas públicas depende de diversos fatores. Entre esses, é fundamental o conhecimento da realidade para a definição do conteúdo e da gestão dos programas de utilidade pública. Fundamentar o conhecimento na realidade concreta, ou seja, nas circunstâncias que as pessoas vivem cotidianamente, centrando a atenção na "pessoa" e suas experiências de vida, permite maior eficiência de atuação e nova forma de intervenção, capaz de valorizar os aspectos positivos e as tentativas de resposta às necessidades já construídas pela pessoa e sua comunidade. Fortalecer essas tentativas pode então representar uma decisão importante e inovadora no panorama dos programas públicos.

  14. Indicators of malnutrition in children with cancer: A study of 690 patients from a tertiary care cancer center.

    Science.gov (United States)

    Srivastava, R; Pushpam, D; Dhawan, D; Bakhshi, S

    2015-01-01

    Large data pertaining to indicators of malnutrition in children with cancer is lacking from India. In view of this, we prospectively analyzed consecutive de novo childhood patients with cancer presenting at a tertiary care center. Height and weight of each child (n = 690) were compared with World Health Organization child growth standards-2006 for that particular age and sex to get weight-for-age, height-for-age, and weight-for-height indices and below 2SD of the reference median on these indices were considered as underweight, stunted, and wasted, respectively. Body mass index (BMI) for age was also analyzed for thinness and obesity. Prevalence of malnutrition based on Z-score for weight-for-age, height-for-age, weight-for-height, and BMI-for-age was 30%, 31%, 35%, and 41%, respectively. Weight-for-age (underweight) was significantly associated (P = 0.018) with solid tumors. Height-for-age, weight-for-age, and BMI-for-age were significantly associated (P = 0.007, P = 0.016, and P ≤ 0.001, respectively) with rural community. Malnutrition was observed in approximately one-third of children with cancer. Malnutrition is associated with solid tumors and those coming from rural community. Wasting has a higher prevalence in children with cancer in <5 years of age group.

  15. New tools for scientific learning in the EduSeis project: the e-learning experiment

    Directory of Open Access Journals (Sweden)

    A. Zollo

    2007-06-01

    Full Text Available The Educational Seismological Project (EduSeis is a scientific and educational project, the main aim of which is the development and implementation of new teaching methodologies in Earth Sciences, using seismology as a vehicle for scientific learning and awareness of earthquake risk. Within this framework, we have recently been experimenting with new learning and information approaches that are mainly aimed at a high school audience. In particular, we have designed, implemented and tested a model of an e-learning environment in a high school located in the surroundings of the Mt. Vesuvius volcano. The proposed e-learning model is built on the EduSeis concepts and educational materials (web-oriented, and is based on computer-supported collaborative learning. Ten teachers from different disciplines and fifty students at the I.T.I.S. “Majorana” technical high school (Naples have been taking part in a cooperative e-learning experiment in which the students have been working in small groups (communities. The learning process is assisted and supervised by the teachers. The evaluation of the results from this cooperative e-learning experiment has provided useful insights into the content and didactic value of the EduSeis modules and activities. The use of network utilities and the “Learning Community” approach promoted the exchange of ideas and expertises between students and teachers and allowed a new approach to the seismology teaching through a multidisciplinary study.

  16. Adubação da batatinha experiências com leucita, sulfato e cloreto de potássio Fertilizer experiments with potatoes sources of potassium

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1960-01-01

    Full Text Available Neste trabalho são relatados os resultados obtidos em sete experiências de adubação da batatinha (Solanum tuberosum L., conduzidas em 1952-53 e 1953-54 em várias localidades do Estado de São Paulo, e nas quais foram comparadas três formas de potássio na presença de nitrogênio e fósforo. O efeito da adubação potássica foi praticamente nulo em três experiências. Em média das outras quatro a produção com NP foi de 6,66 t/ha e os aumentos provocados pela adição de 30, 60 e 90 kg/ha de K(20 foram respectivamente de 20, 23 e 27% com sulfato e cloreto de potássio aumentaram um pouco o tamanho dos tubérculos, ao passo que leucíta o diminuiu consideravelmente. A incidência de manchas internas ("chocolate" nos tubérculos não foi modificada pela adubação potássica.This paper presents the results obtained in seven experiments conducted in 1952-53 and 1953-54 at various localities of the State of São Paulo, in which three sources of potassium were tested in the presence of nitrogen and phosphorus. No response to potassium was observed in three of the experiments. Based on the average results from the other four trials the yield with NP was 6.66 tons per hectare and the increases due to additions of 30, 60 and 90 kilograms of K(20 per hectare were respectively of 20, 23 and 27% with sulphate of potassium and 12, 17 and 17% with potassium chloride; equal K(20 applications in the form of leucite did not modify the yields. While potassium sulphate and chloride incfeased a little the size of the tubers, leucite decreased it considerably. Potassium applications did not modify the incidence of internal brown spots.

  17. SEEK-2 (Sporadic-E Experiment over Kyushu 2 − Project Outline, and Significance

    Directory of Open Access Journals (Sweden)

    R. Pfaff

    2005-10-01

    Full Text Available SEEK-2 (Sporadic-E Experiment over Kyushu 2 is an observation campaign to study the spatial structure of the field-aligned irregularity (FAI and sporadic-E(Es-layer by means of two sounding rockets and a ground-based observation network with radars and optical instruments. The experiment was successfully conducted on 3 August 2002, with successive launches of two sounding rockets from the Uchinoura Space Center (USC of the Japan Aerospace Exploration Agency (JAXA. The timing of the experiment was carefully selected, while intense quasi-periodic (QP echoes were observed with two radars in Tanegashima. The main Es-layer, with its double-layered structure, was observed at altitudes of 103–105 km, the presence of which was well accounted for by the ion accumulation due to neutral-wind shear. Several minor peaks were detected in the electron density profiles at altitudes of up to 130 km. The intensity of the electric field was 5–10 mV/m and showed intense fluctuations below 110 km. Wave-like variation of the electric field was seen above 110 km. From radar experiments, we found that QP echoes appeared around 105 km, which agreed well with the main Es-layer height. The QP echoes propagated to the west-northwest, with frontal structures elongated from north-northeast to south-southwest. Radar observations conduced throughout the SEEK-2 period, on the other hand, showed that frontal structures of the QP echoes were most frequently propagated to the southeast. This result was consistent with the direction of gravity-wave propagation observed with the OH imager during the same period. The rocket beacon experiment with the Es-layers revealed the spatial structure of the plasma densities. On the basis of these results and those from SEEK-1 in 1996, we examined the structures of the nighttime mid-latitude E-region. We concluded that the QP echoes reflect the horizontal structures of the main Es-layers. The source of the structures was not clearly

  18. SMOG programme version for np (E=1-5 GeV) experiment

    International Nuclear Information System (INIS)

    Kotorobaj, F.

    1975-01-01

    The SMOG program, which can be used for NPD robot scanning in the described experiment, is described. A new modifiaction, set up so as to ensure its reliable use on the CDC-1604A, is considered. The program was designed for and used in processing the np (E=1-5 GeV) experiment. SMOG uses three magnetic tapes at the input (one at the extension) and one at the output containing the assembled collected events. A new SMOG variant with origination of errors according to parity during the recording time is attempted in order to continue to write the given zone five times. A short description of the work with the new SMOG program version is given

  19. Alternative Mixed Assessment Project (ALT.A.: The Mexican E-Learning Experience

    Directory of Open Access Journals (Sweden)

    Mónica A. López-Campos

    2010-11-01

    Full Text Available The aim of this paper is to present an experiment of mixed evaluation (summative/formative of questions formulated by students in a distance-education environment carried out in the Total Quality Management course in the B.S. degree in Industrial Engineering offered by Mexican public universities. Questions generated by students were evaluated using a specially-designed quantitative tool: Matrix Observation of four criteria with binary scoring. The experiment showed: (1 how is it possible to enrich the evaluation process, and formalize students' skills hardly recognizable with traditional forms of assessment; and (2 how the teacher-student interaction can be increased significantly by the technique mixed evaluation of questions in reverse, i.e. by the students.

  20. The next phase of the Axion Dark Matter eXperiment

    Science.gov (United States)

    Carosi, Gianpaolo; Asztalos, S.; Hagmann, C.; Kinion, D.; van Bibber, K.; Hotz, M.; Lyapustin, D.; Rosenberg, L.; Rybka, G.; Wagner, A.; Hoskins, J.; Martin, C.; Sikivie, P.; Sullivan, N.; Tanner, D.; Bradley, R.; Clarke, J.; ADMX Collaboration

    2011-04-01

    Axions are a well motivated dark matter candidate which may be detected by their resonant conversion to photons in the presence of a large static magnetic field. The Axion Dark Matter eXperiment recently finished a search for DM axions using a new ultralow noise microwave receiver based on a SQUID amplifier. The success of this precursor experiment has paved the way for a definitive axion search which will see the system noise temperature lowered from 1.8 K to 100 mK, dramatically increasing sensitivity to even pessimistic axion models as well as increasing scan speed. Here we discuss the implementation of this next experimental phase. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Security, LLC, Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

  1. The websites of Japanese Ryokan and eWOM: their impacts on guests' expectation and experience.

    OpenAIRE

    Jimura, Takamitsu

    2011-01-01

    The research aims to investigate the impacts of the websites of ryokan and e-WordOf-Mouth (eWOM) available at the websites of Japanese e-travel agents on the guests' expectation for and experience at ryokan. The research stems from interpretivism and mainly adopts an inductive approach. Netnography is selected as a research strategy. The top three ryokan in terms of sales ranking are chosen. eWOM about these three are analysed, focusing on the impacts of websites and eWOM in developing the gu...

  2. Experiments with the MD-1 detector at the e+e- collider VEPP-4 in the energy region of Υ mesons

    International Nuclear Information System (INIS)

    Baru, S.E.; Blinov, A.E.; Blinov, V.E.; Bondar, A.E.; Bukin, A.D.; Groshev, V.R.; Eidelman, Yu.I.; Kiselev, V.A.; Klimenko, S.G.; Kolachev, G.M.; Mishnev, S.I.; Onuchin, A.P.; Panin, V.S.; Petrov, V.V.; Protopopov, I.Ya.; Shamov, A.G.; Sidorov, V.A.; Skovpen, Yu.I.; Skrinsky, A.N.; Tayursky, V.A.; Telnov, V.I.; Tikhonov, Yu.A.; Tumaikin, G.M.; Undrus, A.E.; Vorobiov, A.I.; Zhilich, V.N.

    1996-01-01

    This paper reviews physical results obtained at the e + e - collider VEPP-4 with the MD-1 detector. The results of experiments on the Υ meson physics and study of the hadron production in continuum in the energy region 7.2-10.3 GeV as well as the results of study of the two photon reactions are presented. Among results obtained in the upsilon physics: the precise measurement of the Υ(1S), Υ(2S), Υ(3S) masses and the precise determination of the Υ(1S) and Υ(2S) electronic widths. In the experiments on study of the hadron production in continuum the precise measurement of the R was carried out. The peculiarity of the detector is the magnetic field transverse to the orbit plane which provided the possibility to study two photon reactions with tagging one or both scattered electrons even at zero emission angle. Among results on the γγ reactions is the measurement of the two photon total hadronic cross section performed in the double-tag mode. In the QED experiments a new QED effect - the impact parameter cut-off in single bremsstrahlung was discovered. (orig.)

  3. Overview and performance of the FNAL KTeV DAQ system

    International Nuclear Information System (INIS)

    Nakaya, T.; O'Dell, V.; Hazumi, M.; Yamanaka, T.

    1995-11-01

    KTeV is a new fixed target experiment at Fermilab designed to study CP violation in the neutral kaon system. The KTeV Data Acquisition System (DAQ) is out of the highest performance DAQ's in the field of high energy physics. The sustained data throughput of the KTeV DAQ reaches 160 Mbytes/sec, and the available online level 3 processing power is 3600 Mips. In order to handle such high data throughput, the KTeV DAQ is designed around a memory matrix core where the data flow is divided and parallelized. In this paper, we present the architecture and test results of the KTeV DAQ system

  4. Compatibility tests of materials for a prototype ceramic melter for defense glass-waste products

    International Nuclear Information System (INIS)

    Wicks, G.G.

    1979-01-01

    Objective is to evaluate the corrosion/erosion resistance of melter materials. Materials tested were Monofrox K3 and E, Serv, Inconel 690, Pt, and SnO. Results show that Inconel 690 is the leading electrode material and Monofrox K3 the leading refractory candidate. Melter lifetime is estimated to be 2 to 5 years for defense waste

  5. Addition of photosensitive dopants to the D0 liquid argon calorimeter

    International Nuclear Information System (INIS)

    Amos, N.A.; Anderson, D.F.

    1992-10-01

    The addition of photosensitive dopants to liquid argon greatly enhances the signal from heavily ionizing particles. Since binding energy losses we correlated with the heavily ionizing component in hadronic showers, the addition of photosensitive dopants has been suggested as a mechanism to tune the e/π ratio in liquid argon calorimeters. A measurement was performed at the FNAL test beam, adding 4 ppM tetramethylgermanium to the Dφ uranium-liquid argon calorimeter. An increase in response for electromagnetic and hadronic showers was observed, with no net change in the e/π ratio

  6. Indivíduo e pessoa na experiência da saúde e da doença The notions of the person and the individual in the experience of health and illness

    Directory of Open Access Journals (Sweden)

    Luiz Fernando Dias Duarte

    2003-01-01

    Full Text Available Revisão de uma linha de pesquisa no campo das ciências sociais em saúde no Brasil que se centra na hipótese metodológica de uma diferença cultural fundamental entre os modelos relacionais de "pessoa" e o modelo do "indivíduo" ocidental moderno (pensado como livre, autônomo e igual. Essa diferença cultural é de particular importância na caracterização das formas diferenciais de experiência da saúde e da doença entre as classes populares das sociedades nacionais modernas e os segmentos portadores dos saberes biomédicos eruditos, dominantes e oficiais. Estes últimos têm um compromisso originário com algumas características da ideologia do individualismo, tais como o universalismo/racionalismo e o cientificismo/fisicalismo. As representações, práticas e instituições dela dependentes ocupam um espaço de oposição à forma integrada, relacional, holista, como são pensadas e experimentadas as "doenças" (ou, como prefiro, as "perturbações físico-morais" mesmo nos segmentos "individualizados", quanto mais nos segmentos regidos por representações hierárquicas, relacionais, de "pessoa". Apresentam-se os fundamentos antropológicos dessa perspectiva analítica e as diferentes dimensões da produção acadêmica a ela associada, em comparação com as de outras tendências do campo.This is a review of a research line present in Brazilian social science studies about health and illness, characterized by a methodological emphasis in the cultural distinction between relational models of the "person" and the modern Western model of the "individual" (conceived as free, autonomous and equal. That distinction is particularly important for the perception of different forms of the experience of health and illness, mostly between working classes in modern national societies and the social segments responsible for biomedical knowledge, as a learned, dominant or official ideology. This knowledge is fundamentally related to the

  7. Conversas com o fracasso escolar: marcas e experiências de uma travessia

    OpenAIRE

    Silva, Camila Josefina da

    2013-01-01

    Esta dissertação aborda a temática do Fracasso Escolar, enquanto marca-experiências-travessia produzidas numa escola pública da rede municipal de Juiz de Fora. A pesquisa foi realizada no Ensino Fundamental I (1º ao 5º ano) no segundo semestre do ano de 2011. Esta se configura numa problematização em torno do fracasso escolar, das marcas da experiência que constituem esse lugar e também dos acontecimentos do campo investigativo. Além de problematizar a temática em torno do fracasso escolar a ...

  8. Giant resonance spectroscopy of 40Ca with the (e,e'x) reaction (I): Experiments and overview of results

    International Nuclear Information System (INIS)

    Diesener, H.; Helm, U.; Neumann-Cosel, P. von; Richter, A.; Schrieder, G.; Stascheck, A.; Stiller, A.; Carter, J.

    2001-01-01

    The 40 Ca(e,e'x; x=p,α) reaction has been measured in the giant resonance excitation region for E x ≅8-26 MeV. The present article is the first out of three describing the experiments and giving an overview of the results. Data were taken at four momentum transfers in the range q=0.26-0.66 fm -1 . Angular correlations for decay to the ground state and low-lying states of 39 K and 36 Ar could be extracted as a function of excitation energy in 40 Ca. Excitation energy spectra integrated over the particle emission angle were generated for the various resolved decay channels. Comparisons of the giant resonance cross-section distributions with results using other electromagnetic or hadronic probes have been made and good agreement is found in most cases

  9. Os ideais da formação humanista e o sentido da experiência escolar

    Directory of Open Access Journals (Sweden)

    José Sérgio Fonseca de Carvalho

    Full Text Available Resumo A sensação de que a instituição escolar vive uma profunda crise é bastante generalizada, sobretudo entre intelectuais e profissionais da educação. O consenso acerca de sua existência, no entanto, não tem implicado qualquer concordância no que concerne aos elementos que a teriam precipitado ou às características de sua atual configuração. A hipótese que guia essas reflexões visa a associar a noção de uma crise na educação escolar a um aspecto que costuma permanecer oculto na maior parte dos discursos críticos acerca da escolarização contemporânea: o esvanecimento do sentido político e existencial da experiência escolar. A fim de desenvolver tal hipótese, debruçamo-nos, inicialmente, sobre a variedade de possíveis acepções do termo “crise”, rejeitando aquelas que a vinculam de forma imediata às noções de declínio, decadência ou ocaso. A partir dos escritos de Arendt e Koselleck, a noção de crise é, então, utilizada em sua acepção primeira: a da emergência de um momento crucial que, por romper com respostas cristalizadas na tradição, exige reflexão e decisão. O que se procura realizar é, pois, um exercício de pensamento que recuse as abordagens funcionais e econômicas do sistema escolar em favor da compreensão de um sentido intrínseco para a experiência escolar: o da iniciação dos mais novos em heranças simbólicas capazes de dar inteligibilidade à experiência humana e durabilidade ao mundo comum. Uma iniciação cujo significado transcende qualquer funcionalidade exterior à experiência escolar, já que reside na própria formação de um sujeito, e não em sua possível inserção em um sistema produtivo.

  10. Os ideais da formação humanista e o sentido da experiência escolar

    Directory of Open Access Journals (Sweden)

    José Sérgio Fonseca de Carvalho

    2016-11-01

    Full Text Available Resumo A sensação de que a instituição escolar vive uma profunda crise é bastante generalizada, sobretudo entre intelectuais e profissionais da educação. O consenso acerca de sua existência, no entanto, não tem implicado qualquer concordância no que concerne aos elementos que a teriam precipitado ou às características de sua atual configuração. A hipótese que guia essas reflexões visa a associar a noção de uma crise na educação escolar a um aspecto que costuma permanecer oculto na maior parte dos discursos críticos acerca da escolarização contemporânea: o esvanecimento do sentido político e existencial da experiência escolar. A fim de desenvolver tal hipótese, debruçamo-nos, inicialmente, sobre a variedade de possíveis acepções do termo “crise”, rejeitando aquelas que a vinculam de forma imediata às noções de declínio, decadência ou ocaso. A partir dos escritos de Arendt e Koselleck, a noção de crise é, então, utilizada em sua acepção primeira: a da emergência de um momento crucial que, por romper com respostas cristalizadas na tradição, exige reflexão e decisão. O que se procura realizar é, pois, um exercício de pensamento que recuse as abordagens funcionais e econômicas do sistema escolar em favor da compreensão de um sentido intrínseco para a experiência escolar: o da iniciação dos mais novos em heranças simbólicas capazes de dar inteligibilidade à experiência humana e durabilidade ao mundo comum. Uma iniciação cujo significado transcende qualquer funcionalidade exterior à experiência escolar, já que reside na própria formação de um sujeito, e não em sua possível inserção em um sistema produtivo.

  11. Oficina de informática com meninos e meninas de rua: relato de uma experiência

    Directory of Open Access Journals (Sweden)

    Claudia Rabello de Castro

    1999-01-01

    Full Text Available Há evidências, tanto da dificuldade de meninos e meninas de rua em conseguir escolarizar-se, como de que valorizam a escola, embora não sejam bem sucedidos nela, o que faz com que se sintam incapazes como aprendizes. O computador pode ser pensado como instrumento mental, com status de bem de consumo valorizado, associado a domínio da tecnologia e sofisticação intelectual, e ser uma via para reintroduzir a aprendizagem formal, de forma não associada a fracassos anteriores. Dez meninos e meninas, atendidos por uma instituição não governamental, participaram de uma oficina nesse sentido. A proposta - de aprender a usar o computador para escrever suas estórias, com a meta de elaborar uma publicação - visou propiciar mudanças sócio-cognitivas e no vínculo com a aprendizagem formal. A experiência parece ter sido bem sucedida em alguns aspectos e é relatada neste trabalho. Experiências como esta podem ser ampliadas e usadas como facilitadoras na reintegração de meninos e meninas de rua em ambientes de aprendizagem formal.

  12. The Midlatitude Continental Convective Clouds Experiment (MC3E)

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Mark P.; Petersen, Walt A.; Bansemer, Aaron; Bharadwaj, Nitin; Carey, Larry; Cecil, D. J.; Collis, Scott M.; Del Genio, Anthony D.; Dolan, Brenda A.; Gerlach, J.; Giangrande, Scott; Heymsfield, Andrew J.; Heymsfield, Gerald; Kollias, Pavlos; Lang, T. J.; Nesbitt, Steve W.; Neumann, Andrea; Poellot, M. R.; Rutledge, Steven A.; Schwaller, Mathew R.; Tokay, Ali; Williams, C. R.; Wolff, D. B.; Xie, Shaocheng; Zipser, Edward J.

    2016-10-18

    The Midlatitude Continental Convective Clouds Experiment (MC3E), a field program jointly led by the U.S. Department of Energy’s Atmospheric Radiation Measurement program and the NASA Global Precipitation Measurement (GPM) Mission, was conducted in south-central Oklahoma during April – May 2011. MC3E science objectives were motivated by the need to improve understanding of midlatitude continental convective cloud system lifecycles, microphysics, and GPM precipitation retrieval algorithms. To achieve these objectives a multi-scale surface- and aircraft-based in situ and remote sensing observing strategy was employed. A variety of cloud and precipitation events were sampled during the MC3E, of which results from three deep convective events are highlighted. Vertical structure, air motions, precipitation drop-size distributions and ice properties were retrieved from multi-wavelength radar, profiler, and aircraft observations for an MCS on 11 May. Aircraft observations for another MCS observed on 20 May were used to test agreement between observed radar reflectivities and those calculated with forward-modeled reflectivity and microwave brightness temperatures using in situ particle size distributions and ice water content. Multi-platform observations of a supercell that occurred on 23 May allowed for an integrated analysis of kinematic and microphysical interactions. A core updraft of 25 ms-1 supported growth of hail and large rain drops. Data collected during the MC3E campaign is being used in a number of current and ongoing research projects and is available through the DOE ARM and NASA data archives.

  13. Experiências de pesquisa: entre escolhas metodológicas e percursos individuais Research experiences: between methodological choices and individual paths

    Directory of Open Access Journals (Sweden)

    Ana Paula Serrata Malfitano

    2011-06-01

    Full Text Available O presente texto traz a apresentação de um relato de pesquisa, tendo como base a experiência metodológica desenvolvida em uma tese de doutorado. Objetiva-se discutir as possibilidades e os limites da realização de pesquisas por atores envolvidos com o objeto em estudo. Especificamente, parte-se da situação de ocupar o lugar de profissional participante da proposição, implementação e intervenção técnica em uma política social direcionada para crianças e adolescentes em situação de rua para, posteriormente, realizar uma pesquisa sobre a experiência em curso. Aportando-se na discussão sobre a metodologia materialista-histórica, a observação participante e a "objetivação participante", ou seja, a centralidade do método no ato de objetivar a participação para, consequentemente, compreender e buscar mudanças na realidade; defendem-se as potencialidades e as riquezas de investigações realizadas pelos próprios atores envolvidos no processo de trabalho. Faz-se importante, também, reconhecer a inexistência de imparcialidade no processo, inerente à compreensão de atuação da visão do pesquisador, bem como destacar a necessidade de embasamento teórico para possibilitar as reflexões que busquem ofertar uma apreensão aprofundada da realidade com a qual se está diretamente envolvido.The author of this text discusses the presentation of a research report, based on the methodological experience developed in a PhD dissertation. The aim is to discuss the possibilities and limitations of research being conducted by the actors involved with the object being studied. Specifically, the author departs from the situation of occupying the place of a professional who is a participant in the proposition, implementation and technical intervention in a social policy directed to children and teenagers living on the street, and then she carries out a research on the ongoing experience. By contributing to the discussion on the

  14. The Next Linear Collider Design: NLC 2001

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Alberta

    2001-08-21

    Recent studies in elementary particle physics have made the need for an e{sup +}e{sup -} linear collider able to reach energies of 500 GeV and above with high luminosity more compelling than ever. Observations and measurements completed in the last five years at the SLC (SLAC), LEP (CERN), and the Tevatron (FNAL) can be explained only by the existence of at least one particle or interaction that has not yet been directly observed in experiment. The Higgs boson of the Standard Model could be that particle. The data point strongly to a mass for the Higgs boson that is just beyond the reach of existing colliders. This brings great urgency and excitement to the potential for discovery at the upgraded Tevatron early in this decade, and almost assures that later experiments at the LHC will find new physics. But the next generation of experiments to be mounted by the world-wide particle physics community must not only find this new physics, they must find out what it is. These experiments must also define the next important threshold in energy. The need is to understand physics at the TeV energy scale as well as the physics at the 100-GeV energy scale is now understood. This will require both the LHC and a companion linear electron-positron collider.

  15. The Next Linear Collider Design: NLC 2001

    International Nuclear Information System (INIS)

    Larsen, Alberta

    2001-01-01

    Recent studies in elementary particle physics have made the need for an e + e - linear collider able to reach energies of 500 GeV and above with high luminosity more compelling than ever. Observations and measurements completed in the last five years at the SLC (SLAC), LEP (CERN), and the Tevatron (FNAL) can be explained only by the existence of at least one particle or interaction that has not yet been directly observed in experiment. The Higgs boson of the Standard Model could be that particle. The data point strongly to a mass for the Higgs boson that is just beyond the reach of existing colliders. This brings great urgency and excitement to the potential for discovery at the upgraded Tevatron early in this decade, and almost assures that later experiments at the LHC will find new physics. But the next generation of experiments to be mounted by the world-wide particle physics community must not only find this new physics, they must find out what it is. These experiments must also define the next important threshold in energy. The need is to understand physics at the TeV energy scale as well as the physics at the 100-GeV energy scale is now understood. This will require both the LHC and a companion linear electron-positron collider

  16. Search on neutrino oscillation νμ→νe in the NOMAD experiment

    International Nuclear Information System (INIS)

    Valuev, Viatcheslav

    1998-01-01

    The NOMAD experiment is a search for neutrino oscillations using the large band neutrino beams of SPS at CERN. It is dealing with the two oscillation modes: ν μ →ν τ and ν μ →ν e . This thesis presents the results obtained in the search of oscillations ν μ →ν e with the data produced by NOMAD in 1995 and 1996. The first two chapters deal with the short presentation of the neutrino oscillation phenomenology and a summary of the experimental situation. The third chapter describes the experimental setup of the NOMAD detector at CERN, designed to identify the interactions of ν e by means of the charged current. This is done with the transition radiation detector (TRD) designed to separate the electrons from pions with a rejection factor higher then 1000 at an electron efficiency of 90%, in the 1 - 50 GeV region. Details about the TRD operation are given in chapter four. The fifth chapter gives the algorithms of electron-pion separation as well as their performances. The last two chapters present the analysis of the ν μ →ν e data obtained in 1995 and 1996 and the final results. The conclusion is that the available data give no evidence for the neutrino oscillations. The upper limit obtained for the mixing angle is sin 2 (2θ) -3 (90% C.L.). This result eliminates completely the oscillation region of LSND experiment (Liquid Scintillator Neutrino Detector) at LAMPF for Δm 2 > 15 eV 2 and gives the most constraining world limit on sin 2 (2θ) for Δm 2 > 20 eV 2

  17. A WIMS E analysis of zero energy experiments performed on the Dragon reactor

    Energy Technology Data Exchange (ETDEWEB)

    Lancefield, M. J.; Broadhouse, B.; Woloch, F.

    1974-10-15

    UKAEA methods embodied in the WINS-E modular scheme of codes are described in their application to the analysis of zero energy experiments performed on the DRAGON reactor. Measured reactivity and reaction rate distributions are compared with the predictions of the analysis.

  18. Neutrino Oscillations Present Status and Future Plans

    CERN Document Server

    Thomas, Jennifer

    2008-01-01

    This book reviews the status of a very exciting field - neutrino oscillations - at a very important time. The fact that neutrinos have mass has only been proved in the last few years and the acceptance of that fact has opened up a whole new area of study to understand the fundamental parameters of the mixing matrix. The book summarizes the results from all the experiments which have played a role in the measurement of neutrino oscillations and briefly describes the scope of some new planned experiments. Contributions include a theoretical introduction by Stephen Parke from FNAL, as well as art

  19. Quench Performance of the First Twin-aperture 11 T Dipole for LHC upgrades

    CERN Document Server

    Zlobin, A V; Apollinari, G; Barzi, E; Chlachidze, G; Nobrega, A; Novitski, I; Stoynev, S; Turrioni, D; Auchmann, B; Izquierdo Bermudez, S; Karppinen, M; Rossi, L; Savary, F; Smekens, D

    2015-01-01

    FNAL and CERN are developing a twin-aperture 11 T Nb$_{3}$Sn dipole suitable for installation in the LHC. A single-aperture 2-m long dipole demonstrator and two 1-m long dipole models have been fabricated and tested at FNAL in 2012-2014. The two 1 m long collared coils were then assembled into the first twin-aperture Nb$_{3}$Sn demonstrator dipole and tested. Test results of this twin-aperture Nb$_{3}$Sn dipole model are reported and discussed.

  20. Georges Bataille, Michel Leiris e a experiência do sagrado no entreguerras

    Directory of Open Access Journals (Sweden)

    Júlia Vilaça Goyatá

    2014-12-01

    Full Text Available O presente artigo tem como objetivo elucidar os usos e sentidos da noção de sagrado nas formulações teóricas e nas trajetórias intelectuais de Georges Bataille (1897-1962 e Michel Leiris (1901-1990 na Paris dos anos 1930. Em meio às diversas experiências estético-políticas da época, que questionavam as possíveis formas da ação política tendo em vista sua ligação com a arte, destaca-se a proposta do Collège de Sociologie (1937-1939, associação animada pelos autores junto a Roger Caillois (1913-1978. O grupo toma o sagrado em dupla articulação: ao mesmo tempo que conceito descritivo, ele passa a ser entendido também como um operador político. Tal ideia é o ponto de partida para as reflexões conjugadas e ao mesmo tempo originais de Bataille e Leiris.

  1. Narcisismo reativo e experiência religiosa contemporânea: culpa substituída pela vergonha? Reactive narcissism and contemporary religious experience: a shift from guilt to shame?

    Directory of Open Access Journals (Sweden)

    Mary Rute Gomes Esperandio

    2007-08-01

    Full Text Available O texto apresenta um recorte da reflexão desenvolvida na tese de doutorado: "Narcisismo e sacrifício: Modo de subjetivação e religiosidade contemporânea" (Esperandio, 2006. Trata-se de uma análise da experiência religiosa promovida pela Igreja Universal do Reino de Deus (IURD a partir da sua proposta de sacrifício. A abordagem trabalha com a concepção de narcisismo ativo e reativo e defende a idéia de que a prática do sacrifício, tal como proposta pela IURD, articula elementos do narcisismo reativo e estabelece-se como uma tecnologia do eu, usada como remédio para lidar com a experiência contemporânea da vergonha.This text presents part of the reflection developed in my Doctoral Thesis on "Narcissism and sacrifice: Mode of subjectivation and contemporary religiosity" (Esperandio, 2006. It analyses the religious experience supported by the Universal Church of the Kingdom of God (UCKG on its proposal of sacrifice. This approach sustains the conception of active and reactive narcissism and defends the idea that such practice of sacrifice proposed by UCKG relates some elements of reactive narcissism and establishes itself as a Technology of Self used as a remedy to deal with the contemporary experience of shame.

  2. Modeling Laser and e-Beam Generated Plasma-Plume Experiments Using LASNEX

    CERN Document Server

    Ho, D

    1999-01-01

    The hydrodynamics code LASNEX is used to model the laser and e-beam generated plasma-plume experiments. The laser used has a wavelength of 1 (micro)m and the FWHM spot size is 1 mm. The total laser energy is 160 mJ. The simulation shows that the plume expands at a velocity of about 6 cm/(micro)s. The e-beam generated from the Experimental Test Accelerator (ETA) has 5.5 MeV and FWHM spot size ranges from 2 to 3.3 mm. From the simulations, the plasma plume expansion velocity ranges from about 3 to 6 mm/(micro)s and the velocity increases with decreasing spot size. All the simulation results reported here are in close agreement with experimental data.

  3. Success Factors for an E-Government Strategy: Austrian Experiences, Indonesian Challenges

    Directory of Open Access Journals (Sweden)

    Christoph Behrens

    2012-02-01

    Full Text Available Focus of this paper are success factors for the implementation of an E-Government strategy. While concepts for a sophisticated strategy process in Public Sector are delivered on a regular basis, the gap between ambitious planning and its implementation seems to get wider. Authors seek to define what makes a “good strategy” in order to enhance management capacity. Meanwhile some scholars from Political Science see limitation of Governments on announcements which are not followed up by sufficient action rather as systematic problems, challenging concept and rules of liberal western democracy, or owed to growing complexity of Governance under the conditions of globalization. In context of the introduction of New Public Management and its perception of citizens as customers and on the basis of new available technical options in Information Society, a key Governance reform project in European and other Countries over the last fifteen years has been the introduction of E-Government. European market leader in this field is Austria. The author reviews concept and implementation experiences of the Austrian E-Government strategy, analyzes key success factors and opens a discussion, under which conditions a successful implementation of E-Government can take place in Indonesia.

  4. Weak mixing and CP violation involving heavy quarks and possible measurements in e/sup +/e/sup -/ experiments. [Higgs exchange mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Ali, A; Aydin, Z Z [Hamburg Univ. (Germany, F.R.). 2. Inst. fuer Theoretische Physik

    1979-01-01

    The authors evaluate weak mass mixing among the neutral heavy mesons with a bottom (Q=-1/3) or top (Q=+2/3) quark and CP violation in this framework of six quark V-A models. It is argued that bottom and top mesons may distinguish the Higgs exchange mechanism of CP violation from a complex phase in the quark mass matrix, if bottom and top quark masses are sufficiently different. Estimates of weak mixing and CP violating effects for e/sup +/e/sup -/ experiments at PETRA, PEP and CESR energies are presented.

  5. Learning from High School Students' Lived Experiences of Reading E-Books and Printed Books

    Science.gov (United States)

    Evans, Ellen

    2017-01-01

    E-book sales are down nationwide, and younger readers are proving to be surprisingly persistent in their preference for printed books. Although 66% of schools nationwide offer e-books, adoption is growing at a slower than expected rate. This study takes a closer look at high school students' experiences as they read John Steinbeck's fictional…

  6. Search for supersymmetry and leptoquark states at FNAL

    International Nuclear Information System (INIS)

    Hagopian, S.

    1994-09-01

    Searches have been made for first generation scalar and vector leptoquarks by the D0 collaboration and for second generation scalar leptoquarks by the CDF collaboration. The data sample is from the 1992-93 p bar p run at √s = 1.8 TeV at the Fermilab Tevatron Collider. Assuming that leptoquarks are pair produced and decay into charged leptons and quarks with branching fraction β, mass limits at the 95% Confidence Level (CL) have been obtained. For first generation scalar leptoquarks the lower mass limit is 130 GeV/c 2 for β = 1.0 and 116 GeV/c 2 for β = 0.5. For first generation vector leptoquarks with κ, the anomalous coupling, of 1.0 and β = 1.0, the lower mass limit is 240 GeV/c 2 and for κ = 1.0, β = 0.5, the lower mass limit is 240 GeV/c 2 . For κ = 0 and β = 1.0, the lower mass limits is 190 GeV/c 2 and for κ = 0, β = 0.5, the lower mass limit is 185 GeV/c 2 . For second generation scalar leptoquarks, the mass limits are 133 GeV/c 2 for β = 1.0 and 98 GeV/c 2 for β = 0.5. A search for squarks and gluinos, predicted by Supersymmetric models, was made by D0 in the three or more jets plus E t channel. The number of events observed was consistent with background. For heavy squarks, a lower gluino mass limit of 146 GeV/c 2 was obtained, and for equal squark and gluino masses a mass limit of 205 GeV/c 2 was obtained at the 95% CL

  7. Theoretical and experimental studies of elementary physics

    International Nuclear Information System (INIS)

    Bodek, A.; Ferbel, T.; Melissinos, A.C.; Olsen, S.; Slattery, P.; Tipton, P.; Das, A.; Hagen, C.R.; Rajeev, S.G.; Okubo, S.

    1992-05-01

    The experimental high energy physics program is directed toward the execution of experiments that probe the basic constituents of matter and the forces between them. These experiments are carried out at national and international accelerator facilities. At the current time, we are primarily concentrating on the following projects: Direct photon production in hadronic reactions; production of hybrid mesons in the nuclear Coulomb field; the D-Zero experiment at the Tevatron collider; deep inelastic neutrino- and electron-nucleon scattering at FNAL and SLAC; nonlinear QED at critical field strengths at SLAC; the experiments at KEK (AMY, 17keV neutrino); the CDF experiment at the Tevatron collider; and SSC-related detector R ampersand D on scintillating tile- and diamond-based calorimetry and microstrip tracking detectors

  8. Spaceflight of HUVEC: An Integrated eXperiment- SPHINX Onboard the ISS

    Science.gov (United States)

    Versari, S.; Maier, J. A. M.; Norfini, A.; Zolesi, V.; Bradamante, S.

    2013-02-01

    The spaceflight orthostatic challenge can promote in astronauts inadequate cardiovascular responses defined as cardiovascular deconditioning. In particular, disturbance of endothelial functions are known to lead to altered vascular performances, being the endothelial cells crucial in the maintenance of the functional integrity of the vascular wall. In order to evaluate whether weightlessness affects endothelial functions, we designed, developed, and performed the experiment SPHINX - SPaceflight of HUVEC: an INtegrated eXperiment - where HUVEC (Human Umbilical Vein Endothelial Cells) were selected as a macrovascular cell model system. SPHINX arrived at the International Space Station (ISS) onboard Progress 40P, and was processed inside Kubik 6 incubator for 7 days. At the end, all of the samples were suitably fixed and preserved at 6°C until return on Earth on Soyuz 23S.

  9. Interface entre cidade e tecnologia: a experiência do espaço tecnológico Interface between city and technology: technological space experience

    Directory of Open Access Journals (Sweden)

    Polise Moreira de Marchi

    2011-09-01

    Full Text Available A experiência do espaço urbano tem sofrido alterações operadas por extensões, expansões e simulaçõesem virtude da incorporação do desenvolvimento tecnológico à própria constituição física e à linguagemda cidade. Entre cidade e experiência, a interface tecnológica se apresenta como possibilidade de reconhecimento,conhecimento e produção das relações espaciais reais e potenciais das cidades contemporâneas.Desde a concepção do mundo urbano, que, segundo Henri Lefebvre (1991, esteve relacionada diretamentecom o período industrial, a tecnologia tem delimitado e pontuado as diversas fases e consequentes camadasque formam a cidade, tanto em relação à dinâmica física do espaço, como em relação à sua representação.Se de fato a tecnologia sempre esteve vinculada diretamente à própria construção das cidades, por meio deiniciativas dos governos e de grandes empresas, é na sua condição atual que se potencializa como mediaçãoentre o indivíduo e o espaço urbano, este cada vez mais tecnologicamente hibridizado. Destarte, este artigotem por objetivo discutir de que modo a tecnologia tem estabelecido novas mediações e respectivas configuraçõesno espaço urbano das cidades contemporâneas, de modo a não ser mais possível dissociá-la destecontexto. Para tal propósito, tomam-se como referência projetos ou iniciativas de pesquisa que buscam nastecnologias de informação e comunicação (TICs novos meios de extensão da cidade, em interface com ambientesurbanos geolocalizados ou virtuais.

  10. Experiences with E-learning in Ophthalmology

    Directory of Open Access Journals (Sweden)

    Seema Dutt Bandhu

    2014-01-01

    Full Text Available Introduction: E-learning is the use of internet for the purpose of education. E-learning in medical education is at a nascent stage in our country. The present study was carried out with the purpose of introducing e-learning to third year medical students in the subject of Ophthalmology and taking feedback on their attitude towards the new methodology of teaching and evaluating. Materials and Methods: E-learning was introduced to the seventh semester students of MBBS in the subject of Ophthalmology. The topics were converted to web friendly format and used for teaching and evaluating. Feedback was taken from the students on completion of the term on their attitudes towards e-learning and their views on the scope of e-learning in medical education. Results: All the students agreed on the usefulness of e-learning in medical education. Eleven students (27.5% found the medium of e-learning to be interesting, 15 (37.5% considered it to be easy and accessible, 10 (25% found it to be fast and easy, 4 (10% considered it to be a medium which can give updated information. Twenty-three (57.5% students considered that e-learning should be a medium of instruction in all the subjects, 15 (37.5% students considered its usefulness in clinical subjects only. Twenty-eight students (70% desired that e-learning should be used to provide important notes, questions, MCQs on all topics. Conclusions: E-learning is well accepted as a medium of instruction by medical students.

  11. Experiência da UNICENTRO no Projeto Rondon em Irituia/PA: uma lição de vida e cidadania

    Directory of Open Access Journals (Sweden)

    Ana Paula Perardt Farias

    2017-06-01

    Full Text Available Esse artigo relata a experiência de extensão universitária na vida de cada estudante que se propôs a fazer o diferente e dar o melhor de si, desenvolvida na cidade Irituia – Pará, em Julho de 2013, na Operação Forte do Presépio do Projeto Rondon, cujo objetivo foi: Relatar e compartilhar as experiências obtidas pela equipe da Unicentro no Projeto Rondon. A proposta realizada foi construída pelos alunos da Universidade Estadual do Centro-Oeste (UNICENTRO e se baseou no Conjunto B, que trabalha com os temas Comunicação, Meio Ambiente, Tecnologia e Produção, e, Trabalho. O desenvolvimento das atividades consistiu na prática de ações participativas, que buscaram a participação de todos, bem como o direito de terem voz, onde se buscou a responsabilidade social e coletiva a favor da cidadania. Essa experiência extensionista foi de grande valia para todos os envolvidos, pois ampliou a visão e o conhecimento diante da realidade da comunidade, rompendo as barreiras do conhecimento e proporcionando a busca por estratégias e soluções para o trabalho contínuo, e também, para a melhoria da qualidade de vida no município e para as pessoas que vivem ali.

  12. Search on neutrino oscillation {nu}{sub {mu}}{yields}{nu}{sub e} in the NOMAD experiment; Recherches des oscillations de neutrinos {nu}{sub {mu}}{yields}{nu}{sub e} dans l`experience NOMAD

    Energy Technology Data Exchange (ETDEWEB)

    Valuev, Viatcheslav [Paris-7 Univ., 75 (France)

    1998-07-07

    The NOMAD experiment is a search for neutrino oscillations using the large band neutrino beams of SPS at CERN. It is dealing with the two oscillation modes: {nu}{sub {mu}}{yields}{nu}{sub {tau}} and {nu}{sub {mu}}{yields}{nu}{sub e}. This thesis presents the results obtained in the search of oscillations {nu}{sub {mu}}{yields}{nu}{sub e} with the data produced by NOMAD in 1995 and 1996. The first two chapters deal with the short presentation of the neutrino oscillation phenomenology and a summary of the experimental situation. The third chapter describes the experimental setup of the NOMAD detector at CERN, designed to identify the interactions of {nu}{sub e} by means of the charged current. This is done with the transition radiation detector (TRD) designed to separate the electrons from pions with a rejection factor higher then 1000 at an electron efficiency of 90%, in the 1 - 50 GeV region. Details about the TRD operation are given in chapter four. The fifth chapter gives the algorithms of electron-pion separation as well as their performances. The last two chapters present the analysis of the {nu}{sub {mu}}{yields}{nu}{sub e} data obtained in 1995 and 1996 and the final results. The conclusion is that the available data give no evidence for the neutrino oscillations. The upper limit obtained for the mixing angle is sin{sup 2}(2{theta}) < 1.3 {center_dot} 10{sup -3} (90% C.L.). This result eliminates completely the oscillation region of LSND experiment (Liquid Scintillator Neutrino Detector) at LAMPF for {Delta}m{sup 2} > 15 eV{sup 2} and gives the most constraining world limit on sin{sup 2}(2{theta}) for {Delta}m{sup 2} > 20 eV{sup 2} 123 refs., 82 figs., 37 tabs.

  13. 11 T Twin-Aperture Nb$_3$Sn Dipole Development for LHC Upgrades

    CERN Document Server

    Zlobin, A V; Apollinari, G; Auchmann, B; Barzi, E; Izquierdo Bermudez, S; Bossert, R; Buehler, M; Chlachidze, G; DiMarco, J; Karppinen, M; Nobrega, F; Novitski, I; Rossi, L; Smekens, D; Tartaglia, M; Turrioni, D; Velev, Genadi

    2015-01-01

    FNAL and CERN are developing a twin-aperture 11 T Nb$_{3}$Sn dipole suitable for installation in the LHC. This paper describes the design and parameters of the 11 T dipole developed at FNAL for the LHC upgrades in both single-aperture and twin-aperture configurations, and presents details of the constructed dipole models. Results of studies of magnet quench performance, quench protection and magnetic measurements performed using short 1 m long coils in the dipole mirror and single-aperture configurations are reported and discussed.

  14. 11 T Twin-Aperture Nb$_3$Sn Dipole Development for LHC Upgrades

    Energy Technology Data Exchange (ETDEWEB)

    Zlobin, A. V. [Fermilab; Andreev, N. [Fermilab; Apollinari, G. [Fermilab; Auchmann, B. [CERN; Barzi, E. [Fermilab; Izquierdo Bermudez, S. [CERN; Bossert, R. [Fermilab; Buehler, M. [Fermilab; Chlachidze, G. [Fermilab; DiMarco, J. [Fermilab; Karppinen, M. [CERN; Nobrega, F. [Fermilab; Novitski, I. [CERN; Rossi, L. [CERN; Smekens, D. [CERN; Tartaglia, M. [Fermilab; Turrioni, D. [Fermilab; Velev, Genadi [Fermilab

    2015-01-01

    FNAL and CERN are developing a twin-aperture 11 T Nb3Sn dipole suitable for installation in the LHC. This paper describes the design and parameters of the 11 T dipole developed at FNAL for the LHC upgrades in both single-aperture and twin-aperture configurations, and presents details of the constructed dipole models. Results of studies of magnet quench performance, quench protection and magnetic measurements performed using short 1 m long coils in the dipole mirror and single-aperture configurations are reported and discussed.

  15. Nação e nacionalismo a partir da experiência brasileira Nation and nationalism based on the Brazilian experience

    Directory of Open Access Journals (Sweden)

    Carlos Lessa

    2008-04-01

    Full Text Available Pensar nação e nacionalismo a partir da experiência brasileira exige um mergulho desde as raízes coloniais até a modernidade. Essa trajetória é marcada por descompassos, e desde o Estado Nacional até a sedimentação da nação e o sentimento de auto-estima com uma "identidade brasileira" transcorre-se mais de um século. Tanto o conceito de Brasil-nação quanto as versões nacionalistas jamais têm alta dramaticidade; as passagens históricas fundamentais - abolição, proclamação da República, Estado Novo - se sucedem com poucos traumas preliminares e, em seqüência, a trajetória opera uma rápida "conservatização". Do ponto de vista econômico, as forças produtivas se desenvolvem dinâmica e intensamente. Apesar da expansão demográfica, da ocupação territorial, da transformação e emergência de novos grupos sociais no campo e na cidade, é preservada a exclusão social de amplas frações da nacionalidade dos benefícios do dinamismo econômico. É ciclotímica a leitura dos nacionais de suas próprias características. A cultura, tanto das elites quanto a popular, fornece chaves para entender as mutações do pensar nacional em relação ao Brasil e o desdobramento de múltiplas características.This essay aims to analyze both Nation and Nationalism concepts according to the viewpoint of brazilian experience, from colonial roots to our times, from national state’s birth to the settlement of the Nation and national self-stee. The main historical landmarks happen with few preliminary traumas and are "conservative-zed". Productive forces develop dynamically; demographic expansion and territory occupation continue as society changes and new groups emerge; however, large population segments keep excluded from the welfare economic development should provide. Natives' self-perception is rather cyclothymical. Both popular and elite’s culture provide the keys to understand the mutations of national thinking about Brazil, as

  16. An elastic lidar system for the H.E.S.S. Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bregeon, J.; Compin, M.; Rivoire, S.; Sanguillon, M.; Vasileiadis, G., E-mail: george.vasileiadis@lupm.in2p3.fr

    2016-05-21

    The H.E.S.S. experiment in Namibia, Africa, is a high energy gamma ray telescope sensitive in the energy range from ~100 Gev to a few tens of TeV, via the use of the atmospheric Cherenkov technique. To minimize the systematic errors on the derived fluxes of the measured sources, one has to calculate the impact of the atmospheric properties, in particular the extinction parameter of the Cherenkov light (~300–650 nm) exploited to observe and reconstruct atmospheric particle showers initiated by gamma-ray photons. A lidar can provide this kind of information for some given wavelengths within this range. In this paper we report on the hardware components, operation and data acquisition of such a system installed at the H.E.S.S. site.

  17. Search for Tau Neutrinos in the τ → e Decay Channel in the OPERA Experiment

    OpenAIRE

    Hosseini, Behzad

    2015-01-01

    The OPERA (Oscillation Project with Emulsion tRacking Apparatus) experiment is a long baseline neutrino oscillation experiment that was designed to perform a conclusive test of the νμ → ντ oscillations hypothesis. The main aim of this experiment is a direct observation of τ leptons in ντ charged-current interactions. A good electromagnetic shower reconstruction is important for the τ detection in the τ → e decay channel. So far, 4 ντ candidates have been observed in the OPERA detector wi...

  18. Intervenção grupal em pacientes com obesidade e seus familiares: relato de experiência

    Directory of Open Access Journals (Sweden)

    Aline Attene de Almeida Bayer

    Full Text Available A modalidade de atendimento em grupo no hospital é uma forma de trabalho que permite interação e troca entre os participantes, caracterizando-se como espaço de acolhimento às angústias frente a um quadro clínico. A experiência relatada consistiu na realização simultânea de dois grupos, um de pacientes entre 8-15 anos, com quadro de obesidade e sobrepeso, e outro de pais/responsáveis. O objetivo geral foi proporcionar espaço para abordar aspectos emocionais e comportamentais associados ao quadro clínico e estabelecer relações com as dificuldades na adesão ao tratamento. Realizaram-se sete encontros semanais, com atividades que propiciaram reflexão sobre questões como: autoestima, ansiedade, limites e dificuldades na manutenção das dietas e das atividades físicas regulares. A proposta possibilitou compartilhar vivências, debater atitudes, abordar insatisfações e desconfortos e perceber a necessidade de se responsabilizarem pelo tratamento através da mudança de determinados comportamentos. A opção por grupos paralelos permitiu notar mudanças nas relações entre pais/responsáveis e pacientes que contribuíram para melhor resposta ao tratamento. Tal experiência ilustrou a importância de considerar os aspectos emocionais envolvidos na obesidade, favorecendo uma visão mais abrangente do paciente.

  19. The E142 SLAC experiment: measurement of the neutron gn1(x) spin structure function

    International Nuclear Information System (INIS)

    Roblin, Y.

    1995-01-01

    This thesis describes the E142 experiment which has been carried out at the Stanford Linear Accelerator (SLAC), USA, from October to December 1992. This experiment of polarized inelastic scattering of a 22.6 GeV electron beam on a polarized helium 3 target has allowed the first measurement of the neutron g n 1 (x) spin structure function. The knowledge of this structure function gives informations on the nucleon spin structure. On the other hand, the g n 1 (x) structure function integral value on the 0 2 mean value of 2 GeV 2 after some extrapolations. This value is at about two standard deviations away from the theoretical predictions of the Ellis-Jaffe rule. Thanks to the existing experimental results for the proton (E143 experiment), the Bjorken sum rule has been precisely tested and is perfectly compatible with the theoretical value. The results have allowed to estimate the nucleon spin fraction carried by the quarks. (J.S.). 86 refs., 58 figs., 13 tabs

  20. Representações e experiências sobre aborto legal e ilegal dos ginecologistas-obstetras trabalhando em dois hospitais maternidade de Salvador da Bahia Representations and experiences of obstetrician/gynecologists with legal and illegal abortion in two maternity-hospitals in Salvador da Bahia

    Directory of Open Access Journals (Sweden)

    Silvia De Zordo

    2012-07-01

    Full Text Available O objetivo deste estudo qualitativo, realizado em dois hospitais-maternidade de Salvador da Bahia, foi investigar a experiência e as representações do aborto legal, analisadas em contraste com as representações do aborto ilegal, dos profissionais de saúde, em particular dos ginecologistas-obstetras.Usou-se como instrumentos um questionário e entrevistas semi-estruturadas com 25 profissionais de saúde (dos quais 13 ginecologistas-obstetras num hospital que oferece um serviço de aborto legal (P, e 20 profissionais de saúde (dos quais 9 ginecologistas-obstetras em outro hospital, que não oferece este serviço (F. Os fatores que mais influenciam as representações dos ginecologistas-obstetras entrevistados acerca do aborto e que explicam a alta taxa de objeção de consciencia no hospital P foram: 1- a criminalização do aborto e o medo de serem denunciados; 2- a estigmatização do aborto por certos grupos religiosos e pelos proprios médicos; 3- o treinamento em obstetrícia e a falta de uma formação boa no campo da epidemiologia da morbi-mortalidade materna e do aborto; 4- as representações acerca das relações de gênero. Os fatores principais associados à atitudes liberais foram: a idade - abaixo de 30/acima de 45 anos - a experiência com altas taxas de mortalidade materna devidas ao aborto e a experiência com o aborto legal.The objective of this qualitative study, carried out in two maternity-hospitals in Salvador da Bahia, was to investigate the experience and representations of health professionals, and particularly obstetricians-gynecologists, regarding legal abortion in comparison with their representations and experience with illegal abortion. A questionnaire was distributed and semi-structured interviews were conducted with 25 health professionals (13 obstetricians-gynecologists in a hospital providing legal abortion (P and with 20 health professionals (9 obstetricians-gynecologists in another hospital that does not

  1. ARIEL E-linac Cryogenic System: Commissioning and First Operational Experience

    International Nuclear Information System (INIS)

    Koveshnikov, A; Bylinskii, I; Hodgson, G; Kishi, D; Laxdal, R; Ma, Y; Nagimov, R; Yosifov, D

    2015-01-01

    The Advanced Rare IsotopE Laboratory (ARIEL) is a major expansion of the Isotope Separator and Accelerator (ISAC) facility at TRIUMF. A key part of the ARIEL project is a 10 mA 50 MeV continuous-wave superconducting radiofrequency (SRF) electron linear accelerator (e-linac). The 1.3 GHz SRF cavities are operated at 2 K. HELIAL LL helium liquefier by Air Liquide Advanced Technologies (ALAT) with a tuneable liquid helium (LHe) production was installed and commissioned in Q4’2013 [1]. It provides 4 K liquid helium to one injector and one accelerator cryomodules that were installed and tested in 2014. The 4 K to 2 K liquid helium transition is achieved on-board of each cryomodule. The cryoplant, LHe and LN2 distributions, sub-atmospheric (S/A) system and cryomodules were successfully commissioned and integrated into the e-linac cryogenic system. Required pressure regulation for both 4 K cryoplant in the Dewar and 2 K with the S/A system was achieved under simulated load. Final integration tests confirmed overall stable performance of the cryogenic system with two cryomodules installed. The paper presents details of the cryogenic system commissioning tests as well as highlights of the initial operational experience. (paper)

  2. Angular dependence of high-p/sub T/ pi /sup 0/ production

    CERN Document Server

    Lloyd-Owen, D; Bellettini, G; Braccini, Pier Luigi; Castaldi, R; Cavasinni, V; Del Prete, T; Finocchiaro, G; Grannis, P D; Jöstlein, H; Kephart, R D; Laurelli, P; Sanguinetti, G; Thun, R; Valdata-Nappi, M

    1981-01-01

    The authors have measured inclusive pi /sup 0/ production cross- sections at the CERN ISR for p/sub T/ <5 GeV/c at c.m. angles of theta =90 degrees and 5< theta <22 degrees at c.m. energies square root s=23 and 53 GeV. The data are in agreement with previous measurements of pi degrees production at FNAL and the ISR. The authors have compared these data with the hypothesis of radial scaling, which asserts that the inclusive cross section should be a function of x/sub R/ and p/sub T/ alone. Here x/sub R/ is the fraction of available energy carried by the produced particle. They find that radial scaling is not satisfactory over the energy and angle range of this experiment. Comparing their data with radial scaling fits to mainly FNAL data, the authors find that their cross sections approach ten times the prediction at large p/sub T/ and x/sub R/. As a more direct test of the hypothesis, the authors compare their data for which x/sub R/ variation occurs as theta varies at fixed s, with that from ISR expe...

  3. Enfrentamento de estresse no trabalho: relações entre idade, experiência, autoeficácia e agência

    Directory of Open Access Journals (Sweden)

    Arlete Portella Fontes

    Full Text Available Este trabalho constitui um estudo descritivo que investigou as relações entre as estratégias de enfrentamento de estresse no trabalho e o estresse percebido, a idade, o cargo e a experiência de trabalho, mediadas pelas crenças de autoeficácia e de agência, entre 71 líderes de uma companhia. Método: o trabalho incluiu um questionário de dados sociodemográficos, de escalas de avaliação do grau de estresse percebido, do enfrentamento no trabalho, de crenças de autoeficácia e de agência. O grau de estresse percebido foi 7(0-10. As estratégias de controle foram frequentemente utilizadas (M = 3,73 ; DP = ,49, esquiva, algumas vezes (M = 2,07 ; DP = ,50, e manejo de sintomas, raramente (M = 1,86 ; DP = ,44. A autoeficácia foi moderada (3,23, DP= 3,37. Foram encontradas correlações positivas entre experiência de trabalho e autoeficácia (,27, autoeficácia e controle (,53, crenças de agência pessoal e controle e autoeficácia (,67 e ,57, respectivamente. A análise de regressão logística multivariada mostrou que líderes com escores mais altos em estratégias de controle apresentaram escores mais altos em autoeficácia e agência. Conclusão: os resultados apontam o valor da experiência de trabalho, da autoeficácia e da agência para o envelhecimento e o enfrentamento dos estressores de trabalho, principalmente em tarefas que envolvem risco de vida, mostrando que as organizações deveriam valorizar sua mão de obra madura.

  4. Intercâmbio acadêmico cultural internacional: uma experiência de crescimento pessoal e científico

    Directory of Open Access Journals (Sweden)

    Indiara Sartori Dalmolin

    2013-06-01

    Full Text Available Este estudo objetivou descrever a experiência discente ao integrar um programa de mobilidade acadêmica internacional, durante a graduação em enfermagem. Trata-se de relato da vivência acadêmica em Portugal, na Universidade do Algarve, viabilizada pela Universidade Federal de Santa Maria, Rio Grande do Sul, Brasil. A experiência de intercâmbio realizada no período de seis meses, possibilitou a aquisição de novos conhecimentos científicos e culturais, inclusive inovações de tecnologias em saúde, desenvolvimento de pesquisa e vínculos acadêmicos. Como contribuições, espera-se estimular e intensificar a mobilidade internacional especialmente no âmbito da graduação, considerando a sua importância para o aperfeiçoamento da formação acadêmica e a excelência do ensino superior brasileiro por meio do intercâmbio científico e cultural no exterior.

  5. Biopoder e UPPs: alteridade na experiência do policiamento permanente em comunidades cariocas

    Directory of Open Access Journals (Sweden)

    Thiago Benedito Livramento Melicio

    2012-12-01

    Full Text Available O artigo visa refletir sobre a experiência do efetivo policial permanente em dois conjuntos de comunidades cariocas, inserido no escopo das Unidades de Polícia Pacificadora (UPP. Foram realizados dois estudos exploratórios, em agosto e dezembro de 2010. Na esteira do conceito foucaultiano de biopoder, discute-se a UPP como rede de relações de poder que a compõe e a legitima, pensando-se o local em que se instala, a política de Estado a que responde, os atores com que opera e as produções históricas das relações entre Estado e territórios populares. O campo de análise constitui-se, assim, nas práticas e saberes localizados no cotidiano e nos efeitos produzidos com a presença do policial na paisagem da favela. Se novas regras são trazidas com as UPPs, novas identificações são mobilizadas e as modulações de conjunto abrem lacunas, o governo de si não se produz sozinho, mas combina-se com diversidades na gestão da vida.

  6. Homens e abortamento espontâneo: narrativas das experiências compartilhadas Hombres y aborto espontáneo: narrativas de experiencias compartidas Men and miscarriage: narratives of shared experiences

    Directory of Open Access Journals (Sweden)

    Márcia Melo de Laet Rodrigues

    2005-09-01

    Full Text Available Maior envolvimento masculino na saúde reprodutiva é um desafio da atualidade; em âmbito nacional e internacional existem recomendações para desenvolver pesquisas sob a perspectiva masculina. Objetivo: Compreender a experiência de homens que compartilharam do processo de abortamento espontâneo de suas parceiras. Método: Utilizou-se a abordagem qualitativa e a análise da narrativa foi o método empregado. Foram identificadas as similaridades nas experiências de nove homens entrevistados, que permitiram elaborar as seguintes categorias descritivas: Vivenciando a notícia da gravidez; identificando as possíveis causas do abortamento; expressando sentimentos relativos à experiência do abortamento; tomando atitudes em decorrência do abortamento; ponderando sobre a experiência vivida. Conclusão: Homens que compartilham da experiência do abortamento espontâneo requerem sensibilidade e envolvimento dos profissionais que os assistem, expressaram o desejo do acolhimento, o recebimento de suporte emocional e informações completas e precisas sobre o conjunto do processo.Un mayor involucramiento masculino en la salud reproductiva es un desafío de la actualidad. En el ámbito nacional e internacional existen recomendaciones para desarrollar investigaciones bajo la perspectiva masculina. Objetivo: Comprender la experiencia de hombres que comparten el proceso del aborto espontáneo de sus parejas. Método: Se utilizó el abordaje cualitativo y el análisis de la narrativa. Fueron identificadas las similaridades en las experiencias de nueve hombres entrevistados, que permitieron elaborar las siguientes categorías descriptivas: Vivenciando la noticia del embarazo; identificando las posibles causas del aborto; expresando sentimientos relativos a la experiencia del aborto; tomando actitudes en consecuencia del aborto; ponderando sobre la experiencia vivida. Conclusión: los hombres que comparten la experiencia del aborto espontáneo requieren

  7. Turismo Cultural, Educação Patrimonial e Cidadania: Uma Experiência entre Universidade, Escola e Museu Em Sergipe

    Directory of Open Access Journals (Sweden)

    Mariana Selister Gomes

    2015-10-01

    Full Text Available O case relata a experiência de um roteiro educativo ao Museu da Gente Sergipana, acompanhado de uma oficina de educação patrimonial, com alunos de uma escola pública, inserido no Projeto de Extensão “Trilhas Urbanas em Aracaju: os múltiplos olhares sobre a cidade”, do Núcleo de Turismo da Universidade Federal de Sergipe. Buscou-se desenvolver o turismo cultural para a comunidade local a fim de contribuir para a educação patrimonial e para a cidadania, bem como, refletir sobre a possibilidade de o Turismo atuar como um mediador cultural. A metodologia utilizada foi a da pesquisa-ação, tendo como base a realização da ação, somada às técnicas de coletas de dados através de questionários e de observação. Percebeu-se que os estudantes desconheciam equipamentos culturais da cidade e não valorizavam o patrimônio cultural local, ao passo que conheciam e valorizavam patrimônios culturais que se tornaram hegemônicos na cultura ocidental; sendo que a ação contribuiu para reverter esta situação. Evidenciou-se o potencial do turismo cultural em despertar a cidadania e o pertencimento, bem como, sua responsabilidade em atuar como mediador cultural de lógicas diversas. Palavras-chave: Turismo Cultural. Educação Patrimonial. Cidadania. Museu da Gente Sergipana. Aracaju, SE. Cultural Tourism, Heritage Education and Citizenship: An Experiment among University, School and Museum in Sergipe - The case reports the experience of an educational route to the "Museu da Gente Sergipana", accompanied by a workshop on heritage education, with students from a public school, inserted into the Extension Project "Trilhas Urbanas em Aracaju",  Núcleo de Turismo of the Universidade Federal de Sergipe. We sought to develop cultural tourism to the local community in order to contribute to heritage interpretation and education and citizenship, as well as reflect on the possibility of tourism be a cultural mediator. The methodology was action

  8. Who Wants to Be an E-tailpreneur? Experiences from an Electronic Retailing Course

    Science.gov (United States)

    Kumar, Archana; Mukherjee, Avinandan; McGinnis, John

    2015-01-01

    This paper outlines the experiences of developing a new hands-on marketing course. The objective of the course was to simulate the real-world scenario of starting an online retailing business and let students become entrepreneurs. Students were challenged to assimilate and apply relevant e-retailing knowledge while being responsible for designing,…

  9. Experiences with E-learning in Ophthalmology

    OpenAIRE

    Seema Dutt Bandhu; Swati Raje

    2014-01-01

    Introduction: E-learning is the use of internet for the purpose of education. E-learning in medical education is at a nascent stage in our country. The present study was carried out with the purpose of introducing e-learning to third year medical students in the subject of Ophthalmology and taking feedback on their attitude towards the new methodology of teaching and evaluating. Materials and Methods: E-learning was introduced to the seventh semester students of MBBS in the subject of Ophthal...

  10. Aprendizagem, linguagem e infância: educação e a (des)via pedagógica – reflexões sobre a experiência e a sala de aula

    OpenAIRE

    Leite, César

    2010-01-01

    Este texto busca, a partir de uma situação de sala de aula, interpretar a realidade dos processos de aprendizagem e constituição de sentidos de uma criança em fase inicial de aquisição da língua escrita. Este percurso será construído a partir da noção de semelhança, linguagem e experiência em Benjamin e Agamben. Para tanto a noção de uma ‘inversão’ de lógica no modo freqüente que pensamos a educação e que olhamos a escola parece necessário, nesta perspectiva alguns eixos se tornam centrais, ...

  11. Performance of prototypes for the ALICE electromagnetic calorimeter

    International Nuclear Information System (INIS)

    Allen, J.; Awes, T.; Badala, A.; Baumgart, S.; Bellwied, R.; Benhabib, L.; Bernard, C.; Bianchi, N.; Blanco, F.; Bortoli, Y.; Bourdaud, G.; Bourrion, O.; Boyer, B.; Bruna, E.; Butterworth, J.; Caines, H.; Calvo Diaz Aldagalan, D.; Capitani, G.P.; Carcagno, Y.; Casanova Diaz, A.

    2010-01-01

    The performance of prototypes for the ALICE electromagnetic sampling calorimeter has been studied in test beam measurements at FNAL and CERN. A 4x4 array of final design modules showed an energy resolution of about 11%/√(E(GeV))+1.7% with a uniformity of the response to electrons of 1% and a good linearity in the energy range from 10 to 100 GeV. The electromagnetic shower position resolution was found to be described by 1.5mm+5.3mm/√(E(GeV)). For an electron identification efficiency of 90% a hadron rejection factor of >600 was obtained.

  12. Experiments on Li pellet injection into Heliotron E

    International Nuclear Information System (INIS)

    Sergeev, V.Yu.; Khlopenkov, K.V.; Kuteev, B.V.; Sudo, S.; Kondo, K.; Zushi, H.; Besshou, S.; Sano, F.; Okada, H.; Mizuuchi, T.; Nagasaki, K.; Obiki, T.; Kurimoto, Y.

    1998-01-01

    Li pellets of large size were injected into electron cyclotron resonance (ECR) heated plasmas and neutral beam injection (NBI) heated plasmas of Heliotron E. The discharge behaviour, pellet ablation and wall conditioning were studied. The electron pressure is doubled after injection into the NBI plasma and remains unchanged in the case of ECR heating. This may be due to the energy exchange between the electrons and thermal ions with the fast ions from the neutral beam. The observed discrepancy between the experimental and modelled ablation rates may be caused by both the plasma cooling due to pellet ablatant and the ablation stimulated by the fast ions in the NBI-heated regime and by the fast electrons in the ECR-heated regime. In preliminary experiments on wall conditioning by Li pellet injection, no improvement of plasma performance after Li pellet injection was observed in the divertor or limiter configuration, with the limiter radii r L =24-25cm. (author)

  13. Produção de sentidos sobre a maternidade: uma experiência no Programa Mãe Canguru Senses production upon motherhood: an experience at the Kangaroo Mother Program

    Directory of Open Access Journals (Sweden)

    Solange Maria Sobottka Rolim de Moura

    2005-04-01

    Full Text Available Este artigo analisa, sob a perspectiva da relação entre a família e instituições de saúde, os sentidos produzidos sobre a maternidade em um programa de saúde neonatal desenvolvido na rede pública - o Programa Mãe Canguru. A partir de entrevistas e observações feitas com usuárias durante sua participação no programa, buscamos apreender como as práticas discursivas e não discursivas sobre maternidade e maternagem, difundidas nesse processo, se articulam com as experiências concretas dessas mulheres para produzir novas configurações subjetivas. Na interpretação dos dados, realizada através de análise do discurso, os aspectos mais significativos das falas das entrevistadas foram agrupados em quatro núcleos de sentido: família e religião; o impacto do nascimento prematuro; desconfiança e resistência nas relações com instituições e profissionais de saúde; e a experiência com o Programa Mãe Canguru. Ao final, procurou-se identificar as principais estratégias e formas de singularização utilizadas por essas mulheres ao atribuírem sentidos ao papel materno.This article analises, under the perspective of the relationship between the family and health institutions, the senses produced upon motherhood on a neonatal health program developed at the public system - The Kangaroo Mother Program. As from interviews and observations made with users during their involvement on the program, we tried to perceive how discursive and non discursive practices about motherhood and maternal care, spreaded on this process, become linked with the factual experiences of this women in order to produce new subjective configurations. On data interpretation, realized through speech analysis, the most significant aspects of interviewees talks were gathered in four senses nucleus: family and religion; the impact of a premature birth; distrust and resistance on relations with institutions and health professionals; and the experience with the

  14. Developing the Precision Magnetic Field for the E989 Muon g{2 Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Matthias W. [Washington U., Seattle

    2017-01-01

    The experimental value of $(g\\hbox{--}2)_\\mu$ historically has been and contemporarily remains an important probe into the Standard Model and proposed extensions. Previous measurements of $(g\\hbox{--}2)_\\mu$ exhibit a persistent statistical tension with calculations using the Standard Model implying that the theory may be incomplete and constraining possible extensions. The Fermilab Muon g-2 experiment, E989, endeavors to increase the precision over previous experiments by a factor of four and probe more deeply into the tension with the Standard Model. The $(g\\hbox{--}2)_\\mu$ experimental implementation measures two spin precession frequencies defined by the magnetic field, proton precession and muon precession. The value of $(g\\hbox{--}2)_\\mu$ is derived from a relationship between the two frequencies. The precision of magnetic field measurements and the overall magnetic field uniformity achieved over the muon storage volume are then two undeniably important aspects of the e xperiment in minimizing uncertainty. The current thesis details the methods employed to achieve magnetic field goals and results of the effort.

  15. Results and future plans of the Lithium Tokamak eXperiment (LTX)

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, J.C., E-mail: jschmitt@pppl.gov [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Abrams, T. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Baylor, L.R. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Berzak Hopkins, L. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Biewer, T. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Bohler, D.; Boyle, D.; Granstedt, E. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Gray, T. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Hare, J.; Jacobson, C.M.; Jaworski, M.; Kaita, R.; Kozub, T.; LeBlanc, B.; Lundberg, D.P.; Lucia, M. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Maingi, R. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Majeski, R.; Merino, E. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); and others

    2013-07-15

    The Lithium Tokamak eXperiment (LTX) is a spherical tokamak with the unique capability of studying the low-recycling regime by coating nearly 90% of the first wall with lithium in either solid or liquid form. Several grams of lithium are evaporated onto the plasma-facing side of the first wall. Without lithium coatings, the plasma discharge is limited to less than 5 ms and only 10 kA of plasma current, and the first wall acts as a particle source. With cold lithium coatings, plasma discharges last up to 20 ms with plasma currents up to 70 kA. The lithium coating provides a low-recycling first wall condition for the plasma and higher fueling rates are required to realize plasma densities similar to that of pre-lithium walls. Traditional puff fueling, supersonic gas injection, and molecular cluster injection (MCI) are used. Liquid lithium experiments will begin in 2012.

  16. Results and future plans of the Lithium Tokamak eXperiment (LTX)

    International Nuclear Information System (INIS)

    Schmitt, J.C.; Abrams, T.; Baylor, L.R.; Berzak Hopkins, L.; Biewer, T.; Bohler, D.; Boyle, D.; Granstedt, E.; Gray, T.; Hare, J.; Jacobson, C.M.; Jaworski, M.; Kaita, R.; Kozub, T.; LeBlanc, B.; Lundberg, D.P.; Lucia, M.; Maingi, R.; Majeski, R.; Merino, E.

    2013-01-01

    The Lithium Tokamak eXperiment (LTX) is a spherical tokamak with the unique capability of studying the low-recycling regime by coating nearly 90% of the first wall with lithium in either solid or liquid form. Several grams of lithium are evaporated onto the plasma-facing side of the first wall. Without lithium coatings, the plasma discharge is limited to less than 5 ms and only 10 kA of plasma current, and the first wall acts as a particle source. With cold lithium coatings, plasma discharges last up to 20 ms with plasma currents up to 70 kA. The lithium coating provides a low-recycling first wall condition for the plasma and higher fueling rates are required to realize plasma densities similar to that of pre-lithium walls. Traditional puff fueling, supersonic gas injection, and molecular cluster injection (MCI) are used. Liquid lithium experiments will begin in 2012

  17. Ensaio sobre arte e testemunho: Rodrigo Braga e a invenção da experiência

    Directory of Open Access Journals (Sweden)

    Tania Rivera

    2016-04-01

    Full Text Available Resumo O ensaio enfoca o testemunho como uma posição discursiva e explora seu papel na simbolização do trauma. Considerando-o como transmissão de centelhas do Real, defende que uma de suas modalidades seria a invenção da experiência, tal como aponta parte da produção contemporânea em artes visuais. Para melhor explorar essa hipótese, propõe um diálogo com alguns dos trabalhos apresentados pelo artista brasileiro Rodrigo Braga em sua exposição Mais Força que o Necessário, realizada na Bélgica em 2010.

  18. Agentes Comunitários de Saúde: experiências e modelos do Brasil Community health agents: Brazilian experiences and models

    Directory of Open Access Journals (Sweden)

    Maria Ruth Santos

    2010-12-01

    Full Text Available O presente artigo é parte da tese de doutorado Perfil dos Agentes Comunitários de Saúde da Região de Juiz de Fora-MG e apresenta o perfil dos Agentes Comunitários de Saúde (ACS sob a ótica das equipes de saúde da família, dos usuários e deles próprios. Discute os modelos e experiências sobre os ACS praticadas no Brasil antes da iniciativa do Ceará, na década de 80. Contextualiza os movimentos ocorridos para o sucesso da reforma dos ACS, que caracterizam um recurso humano central e estratégico para a implementação de ações de promoção da saúde, viabilizando o desenvolvimento de ações básicas voltadas para a comunidade. Demonstra que o agente comunitário de saúde constitui fator chave para viabilizar o apoio, a implementação e o desenvolvimento de ações básicas voltadas para a comunidade, de forma a expandi-las e a fortalecê-las em nível nacional, porém a promoção da saúde não concerne exclusivamente ao próprio setor e nem a um único profissional de saúde. Ela é resultado de ações intersetoriais, agindo nos determinantes gerais e da qualidade de vida.This paper is part of the doctoral thesis Profile of Community Health Workers in the region of Juiz de Fora, MG, and presents a profile of Community Health Agents (CHA from the perspective of family health teams, of users and themselves. It discusses the models and experiences on the CHA practiced in Brazil before the initiative of Ceará State, in the 1980's. It contextualizes the movements for the successful reform of the CHA, which characterize a central human resource and strategic for the implementation of health promotion actions, enabling the development of basic community-related actions. It shows that community health agents are a key factor to enable the support, implementation and development of basic community-related actions, to expand them and strengthen them nationwide, but health promotion concerns not only the sector itself nor a single

  19. Observation of an excess of nu$_{e}$, n$\\overline{u}_{e}$ events in a beam dump experiment at 400 GeV

    CERN Document Server

    Alibran, P; Arnold, R; Bartley, J H; Bellotti, E; Bertrand, D; Blaes, R; Blondel, A; Blum, D; Bolognese, T; Bonetti, S; Bonneaud, G R; Bourotte, J; Bullock, F W; Burmeister, H; Carnesecchi, G; Cavalli, D; Conforto, G; Degrange, B; Dewit, M; Erriquez, O; Escoubés, B; Fiorini, Ettore; Frodesen, A G; Gillespie, J; Haguenauer, Maurice; Heusse, P; Jacquet, F; Jones, T W; Lutz, A M; Matteuzzi, C; Morfín, J G; Muciaccia, M T; Musset, P; Natali, S; Nguyen-Khac, U; Nuzzo, S; Pascaud, C; Pattison, B; Paty, M; Petitjean, P; Price, M; Pullia, Antonio; Riester, J L; Rognebakke, A; Rollier, M; Romano, F; Sacton, J; Skjeggestad, O; Sleeman, J C; Van Doninck, W K; Vialle, J P; Weerts, H; Welch, L; Willutzky, M; Zanotti, L

    1978-01-01

    A beam dump experiment has been performed at CERN in Gargammelle using the neutrino facility to look for penetrating particles produced either directly in the beam interaction or by prompt decay of new particles. A total of 32 interactions with a visible energy greater than 10 GeV has been found, classified, after corrections, into 18 charged current nu /sub mu / or nu /sub mu /, 5.1 neutral current and 8.9 nu /sub e/ or nu /sub e/ charged current events. An excess of nu /sub e/ events remains after all subtractions from any established sources. Results are presented in terms of the product of the cross section and the leptonic decay branching ratio of the possible source. (11 refs).

  20. Sou do mundo, sou Minas Gerais: o ser da experiência em "Para Lennon e McCartney"

    Directory of Open Access Journals (Sweden)

    Rafael Senra Coelho

    2018-04-01

    Full Text Available RESUMO: A canção “Para Lennon e McCartney” imagina um diálogo entre músicos latino americanos e anglo-saxões. Os dois cantores citados no título tornam-se uma metonímia de toda a indústria musical do eixo Europa/EUA. Nessa composição, a condição simultânea rural e urbana que compõe o espaço da periferia permite que o sujeito da experiência persista na modernidade. A voz do narrador experiente confronta todo o projeto de identidade supostamente coerente da metrópole, baseado no acúmulo de informação. PALAVRAS-CHAVE: Identidade, Globalização, Experiência, Música Popular. ___________________________________   ABSTRACT: The song "Para Lennon e McCartney" imagines a dialogue between Latin American and Anglo-Saxon musicians. The two singers mentioned in the title symbolize the entire music industry from Europe and United States. In this composition, the simultaneous rural and urban condition of poor countries allows the permanence of the experienced person in modernity. The voice of the experienced narrator confronts the coherent identity project from people in North metropolis, based in accumulation of information. KEYWORDS: Identity, Globalization, Experience, Popular Music.

  1. The abstract geometry modeling language (AgML): experience and road map toward eRHIC

    International Nuclear Information System (INIS)

    Webb, Jason; Lauret, Jerome; Perevoztchikov, Victor

    2014-01-01

    The STAR experiment has adopted an Abstract Geometry Modeling Language (AgML) as the primary description of our geometry model. AgML establishes a level of abstraction, decoupling the definition of the detector from the software libraries used to create the concrete geometry model. Thus, AgML allows us to support both our legacy GEANT 3 simulation application and our ROOT/TGeo based reconstruction software from a single source, which is demonstrably self- consistent. While AgML was developed primarily as a tool to migrate away from our legacy FORTRAN-era geometry codes, it also provides a rich syntax geared towards the rapid development of detector models. AgML has been successfully employed by users to quickly develop and integrate the descriptions of several new detectors in the RHIC/STAR experiment including the Forward GEM Tracker (FGT) and Heavy Flavor Tracker (HFT) upgrades installed in STAR for the 2012 and 2013 runs. AgML has furthermore been heavily utilized to study future upgrades to the STAR detector as it prepares for the eRHIC era. With its track record of practical use in a live experiment in mind, we present the status, lessons learned and future of the AgML language as well as our experience in bringing the code into our production and development environments. We will discuss the path toward eRHIC and pushing the current model to accommodate for detector miss-alignment and high precision physics.

  2. Promotion of critical thinking in e-learning: a qualitative study on the experiences of instructors and students

    Science.gov (United States)

    Gharib, Mitra; Zolfaghari, Mitra; Mojtahedzadeh, Rita; Mohammadi, Aeen; Gharib, Atoosa

    2016-01-01

    Background With the increasing popularity of e-learning programs, educational stakeholders are attempting to promote critical thinking in the virtual education system. This study aimed to explore the experiences of both the instructors and the students about critical thinking promotion within the virtual education system. Methods This qualitative study recruited the instructors and students from four academic disciplines provided by the Virtual School of Tehran University of Medical Sciences (Tehran, Iran). All programs were master’s degree programs and utilized a blended (combination of e-learning and face to face) training. Semistructured interviews with the participants were used to collect data. Results The participants had a variety of experiences about how to promote critical thinking. These experiences were conceptualized in four main themes, namely, instructional design, educational leadership and management, local evidence, and belief systems. Conclusion The present study clarified the factors affecting critical thinking promotion in e-learning. Not only the instructors but also the educational designers and leaders can benefit from our findings to improve the quality of virtual education programs and promote critical thinking. PMID:27217807

  3. Promotion of critical thinking in e-learning: a qualitative study on the experiences of instructors and students.

    Science.gov (United States)

    Gharib, Mitra; Zolfaghari, Mitra; Mojtahedzadeh, Rita; Mohammadi, Aeen; Gharib, Atoosa

    2016-01-01

    With the increasing popularity of e-learning programs, educational stakeholders are attempting to promote critical thinking in the virtual education system. This study aimed to explore the experiences of both the instructors and the students about critical thinking promotion within the virtual education system. This qualitative study recruited the instructors and students from four academic disciplines provided by the Virtual School of Tehran University of Medical Sciences (Tehran, Iran). All programs were master's degree programs and utilized a blended (combination of e-learning and face to face) training. Semistructured interviews with the participants were used to collect data. The participants had a variety of experiences about how to promote critical thinking. These experiences were conceptualized in four main themes, namely, instructional design, educational leadership and management, local evidence, and belief systems. The present study clarified the factors affecting critical thinking promotion in e-learning. Not only the instructors but also the educational designers and leaders can benefit from our findings to improve the quality of virtual education programs and promote critical thinking.

  4. A experiência em família de uma pessoa com diabetes mellitus e em tratamento por hemodiálise

    Directory of Open Access Journals (Sweden)

    Magda de Mattos

    2009-12-01

    Full Text Available A experiência de adoecimento incorpora processos biológicos, mas também processos subjetivos, que devem serabordados nas práticas de atenção em saúde. No entanto, revelar os processos subjetivos da experiência tem sido umdesafio aos profissionais de saúde. A antropologia interpretativa tem subsídiado a compreensão deste processo namedida que integra aspectos socioculturais ao adoecimento. Estudo de natureza qualitativa, tipo Estudo de Caso tevepor objetivo compreender a experiência em família de uma pessoa com diabetes mellitus, insuficiência renal crônicaem tratamento por hemodiálise. O estudo foi realizado com um usuário em hemodiálise, em uma clínica no Estado deMato Grosso e com sua esposa, no período de fevereiro a julho de 2008, por meio da entrevista. A análise dos dadosnos permitiu apreender que vivenciar o adoecimento é uma experiência no qual os significados são reconstruídos evividos com base nas experiências anteriores e nas perspectivas de vida, tendo a família como referência. Aspectosimportantes do adoecimento marcaram a experiência de Moisés e sua esposa como o significado atribuído a famílianuclear, a fragmentação da estrutura social, as limitações e restrições, o reflexo da doença na vida em família, oscomportamentos, a construção da subjetividade masculina e o transplante renal.

  5. Um um caminho de liberdade: a experiência da disciplina semiologia e semiotécnica

    Directory of Open Access Journals (Sweden)

    Ademilda Maria Gomes de Sousa Garcia

    1998-06-01

    Full Text Available O trabalho relata a vivência da construção da disciplina Semiologia e Semiotécnica, integrante do novo currículo de Enfermagem. Os objetivos foram: incentivar a criatividade e a sensibilidade que o cuidar comporta no desenvolvimento de técnicas; valorizar os sentimentos e emoções no estabelecimento do relacionamento enfermeira-cliente; possibilitar uma reflexão e auto-conhecimento na vivência coletiva; e estabelecer uma interação docentediscente permeada pela parceria, compromisso e no sentir/aprender/fazer mútuos. A trajetória metodológica privilegiou a sensibilização como etapa necessária para o processo de formação e concomitante a este, desenvolvida a partir da arte e criatividade, e compreendeu a realização de oficinas e dinâmicas de grupos. Os resultados validam a experiência como oportunidade de desenvolver o potencial crítico, criativo e técnico rumo à consciência que conduz à liberdade na Enfermagem.

  6. Design and development of RF system for vertical test stand for characterization of superconducting RF cavities

    International Nuclear Information System (INIS)

    Mohania, Praveen; Rajput, Vikas; Baxy, Deodatta; Agrawal, Ankur; Mahawar, Ashish; Adarsh, Kunver; Singh, Pratap; Shrivastava, Purushottam

    2011-01-01

    RRCAT is developing a Vertical Test Stand (VTS) to test and qualify 1.3 GHz/650 MHz, SCRF Cavities in collaboration with Fermi National Accelerator Laboratory (FNAL) under Indian Institutions' Fermilab Collaboration. The technical details for VTS is being provided by FNAL, USA. The RF System of VTS needs to provide stable RF power to SCRF cavity with control of amplitude, relative phase and frequency. The incident, reflected, transmitted power and field decay time constant of the cavity are measured to evaluate cavity performance parameters (E, Qo). RF Power is supplied via 500 W Solid State amplifier, 1270-1310 MHz being developed by PHPMS, RRCAT. VTS system is controlled by PXI Platform and National Instruments LabVIEW software. Low Level RF (LLRF) system is used to track the cavity frequency using Phase Locked Loop (PLL). The system is comprised of several integrated functional modules which would be assembled, optimized, and tested separately. Required components and instruments have been identified and procurement for the same is underway. Inhouse development for the Solid State RF amplifier and instrument interfacing is in progress. This paper describes the progress on the development of the RF system for VTS. (author)

  7. Efeito do branqueamento, processo osmótico, tratamento térmico e armazenamento na estabilidade da vitamina C de pedúnculos de caju processados por métodos combinados Effect of bleaching, osmotic process, heat treatment and storage on ascorbic acid stability of cashew apple processed by combined methods

    Directory of Open Access Journals (Sweden)

    Men de Sá M. SOUZA FILHO

    1999-05-01

    Full Text Available Pedúnculos de caju foram processados por métodos combinados. As principais mudanças verificadas nas características físico-químicas foram redução do pH, aumento no teor de sólidos solúveis e de açúcares redutores. Observaram-se, também, perdas percentuais de ácido ascórbico, em relação ao pedúnculo "in natura", de 23,3% após o branqueamento, 31,7% após o primeiro dia de osmose, 35,5% após o quinto dia de osmose, 69,0% após o tratamento térmico e 87,3% ao final de 60 dias de armazenamento à temperatura ambiente (~ 28° C.Cashew apples were processed by combined methods. Major physical and chemical changes were pH decrease, soluble solids and reducing sugars increase. Ascorbic acid loss was 23,3% after bleaching, 31,7% after one day osmosis, 35,5% after five day osmosis, 69,0% after heat treatment and 87,3% after 60 days storage at ambient temperature (~ 28° C.

  8. Midlatitude Continental Convective Clouds Experiment (MC3E)

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E

    2010-04-01

    Convective processes play a critical role in the Earth’s energy balance through the redistribution of heat and moisture in the atmosphere and subsequent impacts on the hydrologic cycle. Global observation and accurate representation of these processes in numerical models is vital to improving our current understanding and future simulations of Earth’s climate system. Despite improvements in computing power, current operational weather and global climate models are unable to resolve the natural temporal and spatial scales that are associated with convective and stratiform precipitation processes; therefore, they must turn to parameterization schemes to represent these processes. In turn, the physical basis for these parameterization schemes needs to be evaluated for general application under a variety of atmospheric conditions. Analogously, space-based remote sensing algorithms designed to retrieve related cloud and precipitation information for use in hydrological, climate, and numerical weather prediction applications often rely on physical “parameterizations” that reliably translate indirectly related instrument measurements to the physical quantity of interest (e.g., precipitation rate). Importantly, both spaceborne retrieval algorithms and model convective parameterization schemes traditionally rely on field campaign data sets as a basis for evaluating and improving the physics of their respective approaches. The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the April–May 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administration’s (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States

  9. Quality Assurance on a Custom SiPMs Array for the Mu2e Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Atanov, N.; et al.

    2017-11-20

    The Mu2e experiment at Fermilab will search for the coherent $\\mu \\to e$ conversion on aluminum atoms. The detector system consists of a straw tube tracker and a crystal calorimeter. A pre-production of 150 Silicon Photomultiplier arrays for the Mu2e calorimeter has been procured. A detailed quality assur- ance has been carried out on each SiPM for the determination of its own operation voltage, gain, dark current and PDE. The measurement of the mean-time-to-failure for a small random sample of the pro-production group has been also completed as well as the determination of the dark current increase as a function of the ioninizing and non-ioninizing dose.

  10. Natureza e cultura na paisagem amazônica: uma experiência fotográfica com ressonâncias na cosmologia ameríndia e na ecologia histórica

    Directory of Open Access Journals (Sweden)

    Patrick Pardini

    Full Text Available Enquanto experiência artística, o projeto fotográfico "Arborescência - fisionomia do vegetal na paisagem amazônica" proporciona ao autor uma série de descobertas: a paisagem como entrelaçamento de Natureza e Cultura (a presença indireta do homem; o face a face com 'sujeitos vegetais'; as relações de continuidade, indiferenciação e equivalência entre o 'natural' (heterogêneo, espontâneo, nativo, rural e o 'cultural' (homogêneo, cultivado, exótico, urbano na experiência da paisagem vegetal; a arborescência como "imagem cósmica" (Gaston Bachelard, onde o alto (céu, luz, galhos, água celeste e o baixo (terra, sombra, raízes, água terrestre são pólos equivalentes e reversíveis. Tal experiência encontra ressonâncias na eco-cosmologia das sociedades da floresta amazônica. A cosmologia ameríndia é uma "ecologia simbólica" (Philippe Descola, pois elabora "uma complexa dinâmica de trocas e transformações entre sujeitos humanos e não humanos, visíveis e invisíveis" (Bruce Albert; a ecologia ameríndia é uma "cosmologia posta em prática" (Kaj Århem, na qual animais caçados e plantas cultivadas são 'parentes' que é preciso seduzir ou coagir. Tal modelo constitui uma forma de "socialização da natureza" (Descola, de "humanização da floresta" (Evaristo Eduardo de Miranda e de "antropização indireta" dos ecossistemas amazônicos (Descola, geradora de "matas culturais" (William Balée.

  11. Design of experiments (DoE) in pharmaceutical development.

    Science.gov (United States)

    N Politis, Stavros; Colombo, Paolo; Colombo, Gaia; M Rekkas, Dimitrios

    2017-06-01

    At the beginning of the twentieth century, Sir Ronald Fisher introduced the concept of applying statistical analysis during the planning stages of research rather than at the end of experimentation. When statistical thinking is applied from the design phase, it enables to build quality into the product, by adopting Deming's profound knowledge approach, comprising system thinking, variation understanding, theory of knowledge, and psychology. The pharmaceutical industry was late in adopting these paradigms, compared to other sectors. It heavily focused on blockbuster drugs, while formulation development was mainly performed by One Factor At a Time (OFAT) studies, rather than implementing Quality by Design (QbD) and modern engineering-based manufacturing methodologies. Among various mathematical modeling approaches, Design of Experiments (DoE) is extensively used for the implementation of QbD in both research and industrial settings. In QbD, product and process understanding is the key enabler of assuring quality in the final product. Knowledge is achieved by establishing models correlating the inputs with the outputs of the process. The mathematical relationships of the Critical Process Parameters (CPPs) and Material Attributes (CMAs) with the Critical Quality Attributes (CQAs) define the design space. Consequently, process understanding is well assured and rationally leads to a final product meeting the Quality Target Product Profile (QTPP). This review illustrates the principles of quality theory through the work of major contributors, the evolution of the QbD approach and the statistical toolset for its implementation. As such, DoE is presented in detail since it represents the first choice for rational pharmaceutical development.

  12. The design and basic performance of a Spiral Fiber Tracker for the J-PARC E36 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Mineev, O., E-mail: oleg@inr.ru [Institute for Nuclear Research of RAS, Moscow (Russian Federation); Bianchin, S. [Canada' s National Laboratory for Particle and Nuclear Physics (TRIUMF) (Canada); Hasinoff, M.D. [University of British Columbia (Canada); Horie, K. [Osaka University (Japan); Igarashi, Y.; Imazato, J. [High Energy Accelerator Research Organization (KEK) (Japan); Ito, H.; Kawai, H.; Kodama, S. [Chiba University (Japan); Kohl, M. [Hampton University (United States); Kudenko, Yu. [Institute for Nuclear Research of RAS, Moscow (Russian Federation); National Research Nuclear University MEPhI, Moscow (Russian Federation); Moscow Institute of Physics and Technology (Russian Federation); Shimizu, S. [Osaka University (Japan); Tabata, M. [Chiba University (Japan); Toyoda, A. [High Energy Accelerator Research Organization (KEK) (Japan); Yershov, N. [Institute for Nuclear Research of RAS, Moscow (Russian Federation)

    2017-03-01

    A spiral fiber tracker (SFT) has been designed and produced for the J-PARC E36 experiment as an element of the tracking system for conducting a high-resolution momentum measurement of charged particles from kaon decays. A novel technique to wind the pre-made fiber ribbons spirally was employed for the configuration with four detector layers made of 1 mm diameter plastic scintillating fibers. Good position alignment and sufficiently high detection efficiency for charged particles with minimum ionizing energy were confirmed in cosmic ray test. The tracker was successfully used in the E36 experiment.

  13. An analytical comparative exercise on the OECD-SETH PKL E2.2 experiment

    International Nuclear Information System (INIS)

    Reventos, F.; Freixa, J.; Batet, L.; Pretel, C.; Luebbesmeyer, D.; Spaziani, D.; Macek, J.; Lahovsky, F.; Kasahara, F.; Umminger, K.; Wegner, R.

    2008-01-01

    The 'First Workshop on Analytical Activities related to the SETH-OECD project' was held in Barcelona at the UPC's Institute of Energy Technologies (INTE), from 2nd to 3rd September 2003. The workshop gave the participants an opportunity to present the main results of the calculations performed as pre- and post-test simulations of SETH experiments. Among all the post-tests that were both presented and discussed, PKL experiment E2.2 holds special interest as it has been widely studied. Test E2.2 examined the most conservative case in terms of the maximum size that condensate slugs can reach and how far boron concentration can drop on resumption of natural circulation following a cold-side SB-LOCA. The analyses were performed by different working groups belonging to different countries and different codes were used. This paper goes deeper into the comparison of results of the different authors. Its aim is to both show and compare the results obtained by different working groups in their simulation of the experiment and to analyse the main parameters involved in order to draw conclusions on improvements that can be made in the analytical approach to such tests. All the participants managed to successfully predict the overall thermal-hydraulic system behaviour. Vessel fill-up together with slug build-up by reflux-condensation are phenomena that were correctly predicted, while simulation of natural circulation restart and transport of low-borated water slugs still need some improvement

  14. Studies of the Impact of Magnetic Field Uncertainties on Physics Parameters of the Mu2e Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bradascio, Federica [Pisa U.

    2016-01-01

    The Mu2e experiment at Fermilab will search for a signature of charged lepton flavor violation, an effect prohibitively too small to be observed within the Standard Model of particle physics. Therefore, its observation is a signal of new physics. The signature that Mu2e will search for is the ratio of the rate of neutrinoless coherent conversion of muons into electrons in the field of a nucleus, relative to the muon capture rate by the nucleus. The conversion process is an example of charged lepton flavor violation. This experiment aims at a sensitivity of four orders of magnitude higher than previous related experiments. The desired sensitivity implies highly demanding requirements of accuracy in the design and conduct of the experiment. It is therefore important to investigate the tolerance of the experiment to instrumental uncertainties and provide specifications that the design and construction must meet. This is the core of the work reported in this thesis. The design of the experiment is based on three superconducting solenoid magnets. The most important uncertainties in the magnetic field of the solenoids can arise from misalignments of the Transport Solenoid, which transfers the beam from the muon production area to the detector area and eliminates beam-originating backgrounds. In this thesis, the field uncertainties induced by possible misalignments and their impact on the physics parameters of the experiment are examined. The physics parameters include the muon and pion stopping rates and the scattering of beam electrons off the capture target, which determine the signal, intrinsic background and late-arriving background yields, respectively. Additionally, a possible test of the Transport Solenoid alignment with low momentum electrons is examined, as an alternative option to measure its field with conventional probes, which is technically difficult due to mechanical interference. Misalignments of the Transport Solenoid were simulated using standard

  15. Zirconium metal-water oxidation kinetics. V. Oxidation of Zircaloy in high pressure steam

    International Nuclear Information System (INIS)

    Pawel, R.E.; Cathcart, J.V.; Campbell, J.J.; Jury, S.H.

    1977-12-01

    A series of scoping tests to determine the influence of steam pressure on the isothermal oxidation kinetics of Zircaloy-4 PWR tubing was undertaken. The oxidation experiments were conducted in flowing steam at 3.45, 6.90, and 10.34 MPa (500, 1000, and 1500 psi) at 905 0 C (1661 0 F), and at 3.45 and 6.90 MPa at 1101 0 C (2014 0 F). A comparison of the results of these experiments with those obtained for oxidation in steam at atmospheric pressure under similar conditions indicated that measurable enhancement of the oxidation rate occurred with increasing pressure at 905 0 C, but not at 1100 0 C

  16. Electrochemical impedance spectrometry using Inconel 690, zircaloy 4, 316Ti steel, 17-4-PH, UR52N et URSB8. Simulation in tritiated water. Tome 2

    International Nuclear Information System (INIS)

    Bellanger, G.

    1994-11-01

    The redox potential of 3 H 2 O, as well as the corrosion potentials in this medium are found, abnormally, in the trans-passive region. This is completely different from behavior in the chemical industry or in the water in nuclear powers. With such behavior, there will be breakdowns of the protective oxide layers, and in the presence of chloride there will be immediate pitting. Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the kinetics of different stainless steel alloys. These corrosion kinetics and the corrosion potentials provide a classification of the steels studied here: Inconel 690, zircaloy 4, 316 Ti steel, 17-4-PH, UR52N et URSB8. From the results it can be concluded that URSB8 has the best corrosion resistance. (author). 13 refs., 522 figs., tabs

  17. Electrochemical impedance spectrometry using Inconel 690, zircaloy 4, 316Ti steel, 17-4-PH, UR52N et URSB8. Simulation in tritiated water. Tome 1

    International Nuclear Information System (INIS)

    Bellanger, G.

    1994-11-01

    The redox potential of 3 H 2 O, as well as the corrosion potentials in this medium are found, abnormally, in the trans-passive region. This is completely different from the behavior in the chemical industry or in the water in nuclear powers. With such behavior, there will be breakdowns of the protective oxide layers, and in the presence of chloride there will be immediate pitting. Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the kinetics of different stainless alloys. These corrosion kinetics and the corrosion potentials provide a classification of the steels studied here: Inconel 690, zircaloy 4, 316 Ti steel, 17-4-PH, UR52N et URSB8. From the results it can be concluded that URSB8 has the best corrosion resistance. (author). 279 figs., tabs

  18. Gene : CBRC-DRER-22-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 102920926 /ug=Dr.79541 /len=690 4e-72 87% MECAARSGDEKELENSKAGVVAARVLNSGVVARVLISCVVARVLSSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVDARVLNSGVVARVLISCVVARVLNSGVVAR...VLISCVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVAR...VLISCVDARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVARVLNSGVVSTLFRLMQT ...

  19. An ultrahigh-vacuum apparatus for resonant diffraction experiments using soft x rays (hν=300-2000 eV)

    International Nuclear Information System (INIS)

    Takeuchi, T.; Chainani, A.; Takata, Y.; Tanaka, Y.; Oura, M.; Tsubota, M.; Senba, Y.; Ohashi, H.; Mochiku, T.; Hirata, K.; Shin, S.

    2009-01-01

    We have developed an ultrahigh-vacuum instrument for resonant diffraction experiments using polarized soft x rays in the energy range of hν=300-2000 eV at beamline BL17SU of SPring-8. The diffractometer consists of modified differentially pumped rotary feedthroughs for θ-2θ stages, a sample manipulator with motor-controlled x-y-z-, tilt (χ)-, and azimuth (φ)-axes, and a liquid helium flow-type cryostat for temperature dependent measurements between 30 and 300 K. Test results indicate that the diffractometer exhibits high reproducibility (better than 0.001 deg.) for a Bragg reflection of α-quartz 100 at a photon energy of hν=1950 eV. Typical off- and on-resonance Bragg reflections in the energy range of 530-1950 eV could be measured using the apparatus. The results show that x-ray diffraction experiments with energy-, azimuth-, and incident photon polarization-dependence can be reliably measured using soft x rays in the energy range of ∼300-2000 eV. The facility can be used for resonant diffraction experiments across the L-edge of transition metals, M-edge of lanthanides, and up to the Si K-edge of materials.

  20. Essential results of analyses accompanying the leak rate experiments E22 at HDR

    International Nuclear Information System (INIS)

    Grebner, H.; Hoefler, A.; Hunger, H.

    1994-01-01

    Under the E22 test group of phase III of the HDR safety programme, experiments were performed on the crack opening and leak rate behaviour of pipe components of smaller nominal bores. The experiments were complemented by computations, in particular verifications, to qualify the computation models as one of the main aims of the HDR safety programme. Most of the analyses to determine crack openings were performed by means of the finite-element method, including elastic-plastic materials behaviour and, complementarily, assessing engineering methods. The leak rate was calculated by means of separate 2-phase computation models. Altogether, it may be concluded from the structural and fracture mechanical experiments with pipes, elbows and branch pieces, that crack openings and incipient cracks at loading with internal pressure or bending moment can be described with good accuracy by means of the finite-element programme ADINA and the developed FE-models. (orig.) [de