Data acquisition for FNAL E665
International Nuclear Information System (INIS)
Geesaman, D.F.; Green, M.C.; Kaufman, S.
1989-01-01
The data acquisition system for FNAL E665, an experiment to study deep inelastic muon scattering from nucleons and nuclei, is described. The system is built with the FNAL VAXONLINE and RSX DA building blocks. The structure, capabilities and limitations for data flow, control and monitoring are discussed. 20 refs., 1 fig
High luminosity muon scattering at FNAL
International Nuclear Information System (INIS)
Bazizi, K.; Conrad, J.; Fang, G.; Erdmann, M.; Geesaman, D.; Jackson, H.; Guyot, C.; Virchaux, M.; Holmgren, H.; Malensek, A.; Melanson, H.; Morfin, J.; Schellman, H.; Nickerson, R.
1990-02-01
The charge of this group was to evaluate the physics that can be done with a high luminosity μ scattering experiment at FNAL using the upgraded Tevatron muon beam, and consider the apparatus required. In this report, the physics that can be accomplished with a high luminosity μ scattering experiment is evaluated. The CERN and FNAL μ beams are compared in the context of such an experiment. The expected muon flux with the upgraded machine is estimated. Two possible detectors are compared: the air-core toroid experiment proposed by Guyot et al., and an upgraded version of the E665 double-diode apparatus now in place at FNAL. The relative costs of the detectors are considered. A list of detailed questions that need to be answered regarding the double-diode experiment has be compiled. 2 refs., 10 figs., 2 tabs
Color transparency after the NE18 and E665 experiments: Outlook and perspectives at CEBAF
Energy Technology Data Exchange (ETDEWEB)
Nemchik, J. [Inst. of Experimental Physicals, Kosice (Czechoslovakia); Nikolaev, N.N.; Zakharov, B.G. [L.D. Landau Inst. for Theoretical Physics, Moscow (Russian Federation)
1994-04-01
CEBAF is a high-luminocity factory of virtual photons with variable virtuality Q{sup 2} and transverse size. This makes CEBAF, in particular after the energy upgrade to (8-12)GeV, an ideal facility for uncovering new phenomena, and opening new windows, at the interface of the perturbative and nonperturbative QCD. The authors discuss color transparency as the case for a broad program on electroproduction of vector mesons {rho}{sup 0}, {omega}{sup 0}, {phi}{sup 0} and their radial excitations {rho}{prime}, {omega}{prime}, {phi}{prime} at CEBAF. They also comment on the second generation of experiments on color transparency in {sup 4}He(e, e{prime}p) scattering, which are also feasible at CEBAF. In 1994, they can make more reliable projections into future because their understanding of the onset of color transparency has greatly been augmented by two experiments completed in 1993: (i) no effect of CT was seen in the SLAC NE18 experiment on A(e, e{prime}p) scattering at virtualities of the exchanged photon Q{sup 2} {approx_lt} 7 GeV{sup 2}, (ii) strong signal of CT was observed in the FNAL E665 experiment on exclusive {rho}{sup 0}-meson production in deep inelastic scattering in the same range of Q{sup 2}. They discuss the impact of these observations on the CEBAF experimental program. They argue they both are good news, both were anticipated theoretically, and both rule in the correct QCD mechanism of the onset of CT.
The NESSiE way to searches for sterile neutrinos at FNAL
Stanco, L.; NESSiE Collaboration
2016-04-01
Neutrino physics is nowadays receiving more and more attention as a possible source of information for the long-standing problem of new physics beyond the Standard Model. The recent measurement of the mixing angle θ13 in the standard mixing oscillation scenario encourages us to pursue the still missing results on leptonic CP violation and absolute neutrino masses. However, puzzling measurements exist that deserve an exhaustive evaluation. The NESSiE Collaboration has been setup to undertake conclusive experiments to clarify the muon-neutrino disappearance measurements at small L/E, which will be able to put severe constraints to models with more than the three-standard neutrinos, or even to robustly measure the presence of a new kind of neutrino oscillation for the first time. To this aim the use of the current FNAL-Booster neutrino beam for a Short-Baseline experiment has been carefully evaluated. Its recent proposal refers to the use of magnetic spectrometers at two different sites, Near and Far ones. Their positions have been extensively studied, together with the possible performances of two OPERA-like spectrometers. The proposal is constrained by availability of existing hardware and a time-schedule compatible with the undergoing project of a multi-site Liquid-Argon detectors at FNAL. The experiment to be possibly setup at Booster will allow to definitively clarify the current νμ disappearance tension with νe appearance and disappearance at the eV mass scale.
ANL stochastic-cooling experiments using the FNAL 200-MeV cooling ring
International Nuclear Information System (INIS)
Hogrefe, R.L.; Kellogg, K.D.; Konecny, R.S.; Kramer, S.L.; Simpson, J.D.; Suddeth, D.E.; Hardek, T.W.
1981-01-01
Studies of stochastic momentum cooling are being conducted on the FNAL 200-MeV Storage Ring. The specific goal of the activity is to establish confidence in the theory and simulation methods used to describe the cooling process, and to develop techniques and devices suitable for use in the antiproton-accumulation scheme now planned for construction at FNAL. A summary of the activity, including hardware design, results of experiments, comparison with theory, and implications for the antiproton accumulator are presented
The NESSiE way to searches for sterile neutrinos at FNAL
Stanco, L.; Benettoni, M.; Bernardini, P.; Brugnera, R.; Calabrese, M.; Cecchetti, A.; Cecchini, S.; Chernyavskiy, M.; Creti, P.; Dal Corso, F.; Dalkarov, O.; Del Prete, A.; De Robertis, G.; De Serio, M.; Esposti, L.Degli; Di Ferdinando, D.; Dusini, S.; Dzhatdoev, T.; Fanin, C.; Fini, R.A.; Fiore, G.; Garfagnini, A.; Golovanov, S.; Guerzoni, M.; Klicek, B.; Jakovcic, K.; Laurenti, G.; Lippi, I.; Loddo, F.; Longhin, A.; Malenica, M.; Mancarella, G.; Mandrioli, G.; Margiotta, A.; Marsella, G.; Mauri, N.; Medinaceli, E.; Mengucci, A.; Mingazheva, R.; Morgunova, O.; Muciaccia, M.T.; Orecchini, D.; Paoloni, A.; Papadia, G.; Paparella, L.; Pasqualini, L.; Pastore, A.; Patrizii, L.; Polukhina, N.; Pozzato, M.; Roda, M.; Roganova, T.; Rosa, G.; Sahnoun, Z.; Simone, S.; Sirignano, C.; Sirri, G.; Spurio, M.; Stanko, L.; Starkov, N.; Stipcevic, M.; Surdo, A.; Tenti, M.; Togo, V.; Ventura, M.; Vladymyrov, M.; Kose, U.; Nessi, M.
2016-01-01
Neutrino physics is nowadays receiving more and more attention as a possible source of information for the long-standing problem of new physics beyond the Standard Model. The recent measurement of the mixing angle $\\theta_{13}$ in the standard mixing oscillation scenario encourages us to pursue the still missing results on leptonic CP violation and absolute neutrino masses. However, puzzling measurements exist that deserve an exhaustive evaluation. The NESSiE Collaboration has been setup to undertake conclusive experiments to clarify the muon-neutrino disappearance measurements at small $L/E$, which will be able to put severe constraints to models with more than the three-standard neutrinos, or even to robustly measure the presence of a new kind of neutrino oscillation for the first time. To this aim the use of the current FNAL-Booster neutrino beam for a Short-Baseline experiment has been carefully evaluated. Its recent proposal refers to the use of magnetic spectrometers at two different sites, Near and Far...
Antonello, M; Bellini, V.; Bilokon, H.; Boffelli, F.; Bonesini, M.; Calligarich, E.; Centro, S.; Cieslik, K.; Cline, D.B.; Cocco, A.G.; Curioni, A.; Dermenev, A.; Dolfini, R.; Falcone, A.; Farnese, C.; Fava, A.; Ferrari, A.; Gibin, D.; Gninenko, S.; Guber, F.; Guglielmi, A.; Haranczyk, M.; Holeczek, J.; Ivashkin, A.; Kirsanov, M.; Kisiel, J.; Kochanek, I.; Kurepin, A.; Lagoda, J.; Mammoliti, F.; Mania, S.; Mannocchi, G.; Matveev, V.; Menegolli, A.; Meng, G.; Mills, G.B.; Montanari, C.; Noto, F.; Otwinowski, S.; Palczewski, T.J.; Picchi, P.; Pietropaolo, F.; Plonski, P.; Potenza, R.; Rappoldi, A.; Raselli, G.L.; Rossella, M.; Rubbia, C.; Sala, P.; Scaramelli, A.; Segreto, E.; Stefan, D.; Stepaniak, J.; Sulej, R.; Sutera, C.M.; Tlisov, D.; Torti, M.; Van de Water, R.G.; Varanini, F.; Ventura, S.; Vignoli, C.; Wang, H.G.; Yang, X.; Zani, A.; Zaremba, K.
2013-01-01
The INFN and the ICARUS collaboration originally developed the technology of the LAr-TPC. Located the underground LNGS Hall-B, the ICARUS T600 detector has been performed over three years with remarkable detection efficiency featuring a smooth operation, high live time, and high reliability. About 3000 CNGS neutrino events have been collected and are being actively analyzed. ICARUS will now be moved to CERN for an extensive R&D program. The T600 detector will be overhauled and complemented with a similar T150 detector. These improvements are performed in collaboration with the LBNE experiment, of which several INFN Institutions are now members. As a novelty, a SC magnetic field of about 1 T will be introduced. During 2016 it is proposed to move the experiment to FNAL where short base line neutrino beams are available, complementing the approved MicroBooNe experiment which will start operation in 2014. The ICARUS detectors at FNAL will be an important addition since, in absence of anomalies, the signals of...
Sterile searches with Liquid Argon at FNAL
Raselli, Gian Luca
2017-01-01
A new Short Baseline Neutrino (SBN) experiment is in preparation at FNAL to definitely prove or exclude the existence of non-standard neutrino oscillations into sterile states. The program foresees the deployment along the Booster Neutrino Beam (BNB) of three detectors, all based on the liquid-argon time projection chamber technique. This technology has been taken to full maturity with ICARUS T600, which will act as far detector after the completion of the overhauling at CERN and its transportation to FNAL. The program foresees the data taking for three years.
Search for Sterile Neutrinos in the Muon Neutrino Disappearance Mode at FNAL
Anokhina, A.; Benettoni, M.; Bernardini, P.; Brugnera, R.; Calabrese, M.; Cecchetti, A.; Cecchini, S.; Chernyavskiy, M.; Dal Corso, F.; Dalkarov, O.; Prete, A.; De Robertis, G.; De Serio, M.; Di Ferdinando, D.; Dusini, S.; Dzhatdoev, T.; Fini, R.A.; Fiore, G.; Garfagnini, A.; Guerzoni, M.; Klicek, B.; Kose, U.; Jakovcic, K.; Laurenti, G.; Lippi, I.; Loddo, F.; Longhin, A.; Malenica, M.; Mancarella, G.; Mandrioli, G.; Margiotta, A.; Marsella, G.; Mauri, N.; Medinaceli, E.; Mingazheva, R.; Morgunova, O.; Muciaccia, M.T.; Nessi, M.; Orecchini, D.; Paoloni, A.; Papadia, G.; Paparella, L.; Pasqualini, L.; Pastore, A.; Patrizii, L.; Polukhina, N.; Pozzato, M.; Roda, M.; Roganova, T.; Rosa, G.; Sahnoun, Z.; Shchedrina, T.; Simone, S.; Sirignano, C.; Sirri, G.; Spurio, M.; Stanco, L.; Starkov, N.; Stipcevic, M.; Surdo, A.; Tenti, M.; Togo, V.; Vladymyrov, M.
2017-01-01
The NESSiE Collaboration has been setup to undertake a conclusive experiment to clarify the {\\em muon--neutrino disappearance} measurements at short baselines in order to put severe constraints to models with more than the three--standard neutrinos, or even to robustly establish the presence of a new kind of neutrino oscillation for the first time. To this aim the use of the current FNAL--Booster neutrino beam for a Short--Baseline experiment was carefully evaluated by considering the use of magnetic spectrometers at two sites, near and far ones. The detector locations were extensively studied, together with the achievable performances of two OPERA--like spectrometers. The study was constrained by the availability of existing hardware and a time--schedule compatible with the undergoing project of multi--site Liquid--Argon detectors at FNAL. \
Search for sterile neutrinos in muon neutrino disappearance mode at FNAL
International Nuclear Information System (INIS)
Anokhina, A.; Dzhatdoev, T.; Morgunova, O.; Roganova, T.; Bagulya, A.; Chernyavskiy, M.; Dalkarov, O.; Mingazheva, R.; Shchedrina, T.; Starkov, N.; Vladymyrov, M.; Benettoni, M.; Dal Corso, F.; Dusini, S.; Lippi, I.; Longhin, A.; Bernardini, P.; Mancarella, G.; Marsella, G.; Brugnera, R.; Garfagnini, A.; Medinaceli, E.; Roda, M.; Sirignano, C.; Calabrese, M.; Fiore, G.; Surdo, A.; Cecchetti, A.; Orecchini, D.; Paoloni, A.; Cecchini, S.; Di Ferdinando, D.; Guerzoni, M.; Laurenti, G.; Mandrioli, G.; Mauri, N.; Patrizii, L.; Pozzato, M.; Sahnoun, Z.; Sirri, G.; Togo, V.; Del Prete, A.; Papadia, G.; De Robertis, G.; Fini, R.A.; Loddo, F.; Pastore, A.; De Serio, M.; Paparella, L.; Simone, S.; Klicek, B.; Jakovcic, K.; Malenica, M.; Stipcevic, M.; Kose, U.; Nessi, M.; Margiotta, A.; Pasqualini, L.; Spurio, M.; Muciaccia, M.T.; Polukhina, N.; Rosa, G.; Stanco, L.; Tenti, M.
2017-01-01
The NESSiE Collaboration has been setup to undertake a conclusive experiment to clarify the muon-neutrino disappearance measurements at short baselines in order to put severe constraints to models with more than the three-standard neutrinos. To this aim the current FNAL-Booster neutrino beam for a Short-Baseline experiment was carefully evaluated by considering the use of magnetic spectrometers at two sites, near and far ones. The detector locations were studied, together with the achievable performances of two OPERA-like spectrometers. The study was constrained by the availability of existing hardware and a time-schedule compatible with the undergoing project of multi-site Liquid-Argon detectors at FNAL. The settled physics case and the kind of proposed experiment on the Booster neutrino beam would definitively clarify the existing tension between the ν μ disappearance and the ν e appearance/disappearance at the eV mass scale. In the context of neutrino oscillations the measurement of ν μ disappearance is a robust and fast approach to either reject or discover new neutrino states at the eV mass scale. We discuss an experimental program able to extend by more than one order of magnitude (for neutrino disappearance) and by almost one order of magnitude (for antineutrino disappearance) the present range of sensitivity for the mixing angle between standard and sterile neutrinos. These extensions are larger than those achieved in any other proposal presented so far. (orig.)
Search for sterile neutrinos in muon neutrino disappearance mode at FNAL
Anokhina, A.; Bagulya, A.; Benettoni, M.; Bernardini, P.; Brugnera, R.; Calabrese, M.; Cecchetti, A.; Cecchini, S.; Chernyavskiy, M.; Dal Corso, F.; Dalkarov, O.; Del Prete, A.; De Robertis, G.; De Serio, M.; Di Ferdinando, D.; Dusini, S.; Dzhatdoev, T.; Fini, R. A.; Fiore, G.; Garfagnini, A.; Guerzoni, M.; Klicek, B.; Kose, U.; Jakovcic, K.; Laurenti, G.; Lippi, I.; Loddo, F.; Longhin, A.; Malenica, M.; Mancarella, G.; Mandrioli, G.; Margiotta, A.; Marsella, G.; Mauri, N.; Medinaceli, E.; Mingazheva, R.; Morgunova, O.; Muciaccia, M. T.; Nessi, M.; Orecchini, D.; Paoloni, A.; Papadia, G.; Paparella, L.; Pasqualini, L.; Pastore, A.; Patrizii, L.; Polukhina, N.; Pozzato, M.; Roda, M.; Roganova, T.; Rosa, G.; Sahnoun, Z.; Shchedrina, T.; Simone, S.; Sirignano, C.; Sirri, G.; Spurio, M.; Stanco, L.; Starkov, N.; Stipcevic, M.; Surdo, A.; Tenti, M.; Togo, V.; Vladymyrov, M.
2017-01-01
The NESSiE Collaboration has been setup to undertake a conclusive experiment to clarify the muon-neutrino disappearance measurements at short baselines in order to put severe constraints to models with more than the three-standard neutrinos. To this aim the current FNAL-Booster neutrino beam for a Short-Baseline experiment was carefully evaluated by considering the use of magnetic spectrometers at two sites, near and far ones. The detector locations were studied, together with the achievable performances of two OPERA-like spectrometers. The study was constrained by the availability of existing hardware and a time-schedule compatible with the undergoing project of multi-site Liquid-Argon detectors at FNAL. The settled physics case and the kind of proposed experiment on the Booster neutrino beam would definitively clarify the existing tension between the ν _{μ } disappearance and the ν e appearance/disappearance at the eV mass scale. In the context of neutrino oscillations the measurement of ν _{μ } disappearance is a robust and fast approach to either reject or discover new neutrino states at the eV mass scale. We discuss an experimental program able to extend by more than one order of magnitude (for neutrino disappearance) and by almost one order of magnitude (for antineutrino disappearance) the present range of sensitivity for the mixing angle between standard and sterile neutrinos. These extensions are larger than those achieved in any other proposal presented so far.
Search for sterile neutrinos in muon neutrino disappearance mode at FNAL
Energy Technology Data Exchange (ETDEWEB)
Anokhina, A.; Dzhatdoev, T.; Morgunova, O.; Roganova, T. [Lomonosov Moscow State University (MSU SINP), Moscow (Russian Federation); Bagulya, A.; Chernyavskiy, M.; Dalkarov, O.; Mingazheva, R.; Shchedrina, T.; Starkov, N.; Vladymyrov, M. [Lebedev Physical Institute of Russian Academy of Sciences, Moscow (Russian Federation); Benettoni, M.; Dal Corso, F.; Dusini, S.; Lippi, I.; Longhin, A. [INFN, Sezione di Padova, Padua (Italy); Bernardini, P.; Mancarella, G.; Marsella, G. [Universita del Salento, Dipartimento di Matematica e Fisica, Lecce (Italy); INFN, Sezione di Lecce, Lecce (Italy); Brugnera, R.; Garfagnini, A.; Medinaceli, E.; Roda, M.; Sirignano, C. [INFN, Sezione di Padova, Padua (Italy); Universita di Padova, Dipartimento di Fisica e Astronomia, Padua (Italy); Calabrese, M.; Fiore, G.; Surdo, A. [INFN, Sezione di Lecce, Lecce (Italy); Cecchetti, A.; Orecchini, D.; Paoloni, A. [INFN, Laboratori Nazionali di Frascati, Frascati, RM (Italy); Cecchini, S.; Di Ferdinando, D.; Guerzoni, M.; Laurenti, G.; Mandrioli, G.; Mauri, N.; Patrizii, L.; Pozzato, M.; Sahnoun, Z.; Sirri, G.; Togo, V. [INFN, Sezione di Bologna, Bologna (Italy); Del Prete, A.; Papadia, G. [INFN, Sezione di Lecce, Lecce (Italy); Universita del Salento, Dipartimento di Ingegneria dell' Innovazione, Lecce (Italy); De Robertis, G.; Fini, R.A.; Loddo, F.; Pastore, A. [INFN, Sezione di Bari, Bari (Italy); De Serio, M.; Paparella, L.; Simone, S. [INFN, Sezione di Bari, Bari (Italy); Universita di Bari, Dipartimento di Fisica, Bari (Italy); Klicek, B.; Jakovcic, K.; Malenica, M.; Stipcevic, M. [Rudjer Boskovic Institute, Zagreb (Croatia); Kose, U.; Nessi, M. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Margiotta, A.; Pasqualini, L.; Spurio, M. [INFN, Sezione di Bologna, Bologna (Italy); Universita di Bologna, Dipartimento di Fisica e Astronomia, Bologna (Italy); Muciaccia, M.T. [Universita di Bari, Dipartimento di Fisica, Bari (Italy); Polukhina, N. [Lebedev Physical Institute of Russian Academy of Sciences, Moscow (Russian Federation); National Research Nuclear University MEPhI, Moscow (Russian Federation); Rosa, G. [INFN, Sezione di Roma, Rome (Italy); Stanco, L. [INFN, Sezione di Padova, Padua (Italy); Tenti, M. [Universita di Bologna, Dipartimento di Fisica e Astronomia, Bologna (Italy); NFN-CNAF, Bologna (Italy)
2017-01-15
The NESSiE Collaboration has been setup to undertake a conclusive experiment to clarify the muon-neutrino disappearance measurements at short baselines in order to put severe constraints to models with more than the three-standard neutrinos. To this aim the current FNAL-Booster neutrino beam for a Short-Baseline experiment was carefully evaluated by considering the use of magnetic spectrometers at two sites, near and far ones. The detector locations were studied, together with the achievable performances of two OPERA-like spectrometers. The study was constrained by the availability of existing hardware and a time-schedule compatible with the undergoing project of multi-site Liquid-Argon detectors at FNAL. The settled physics case and the kind of proposed experiment on the Booster neutrino beam would definitively clarify the existing tension between the ν{sub μ} disappearance and the ν{sub e} appearance/disappearance at the eV mass scale. In the context of neutrino oscillations the measurement of ν{sub μ} disappearance is a robust and fast approach to either reject or discover new neutrino states at the eV mass scale. We discuss an experimental program able to extend by more than one order of magnitude (for neutrino disappearance) and by almost one order of magnitude (for antineutrino disappearance) the present range of sensitivity for the mixing angle between standard and sterile neutrinos. These extensions are larger than those achieved in any other proposal presented so far. (orig.)
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics. DØ Collaboration at FNAL, USA. Articles written in Pramana – Journal of Physics. Volume 62 Issue 3 March 2004 pp 561-563 Experimental Particle Physics. Search for narrow-width t t ¯ resonances in p p ¯ collisons at ( s ) = 1.8 TeV · Supriya Jain DØ Collaboration at FNAL, ...
Why a NESSiE-like experiment at SBL is needed?
Pasqualini, Laura
2015-01-01
The NESSiE experiment is designed to perform an accurate measurement of muon-neutrino disappearance at small L/E, in order to severely constrain models with more than three-standard neutrinos, or even determine for the first time the presence of a new kind of neutrino oscillation. NESSiE is a Short-Baseline experiment with magnetic spectrometers at two different sites on the FNAL-Booster neutrino beam. The experiment would allow to definitively solve the existing tension of the muon-neutrino ...
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false State. 84.665 Section 84.665 Education Office of the...) Definitions § 84.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. (Authority: E.O.s 12549 and...
Prospects for the measurement of muon-neutrino disappearance at the FNAL-Booster
Anokhina, A; Benettoni, M; Bernardini, P; Brugnera, R; Calabrese, M; Cecchetti, A; Cecchini, S; Chernyavskiy, M; Creti, P; Corso, F Dal; Dalkarov, O; Del Prete, A; De Robertis, G; De Serio, M; Esposti, L Degli; Di Ferdinando, D; Dusini, S; Dzhatdoev, T; Fanin, C; Fini, R A; Fiore, G; Garfagnini, A; Golovanov, S; Guerzoni, M; Klicek, B; Kose, U; Jakovcic, K; Laurent, G; Lippi, I; Loddo, F; Longhin, A; Malenica, M; Mancarella, G; Mandrioli, G; Margiotta, A; Marsella, G; Mauri, N; Medinaceli, E; Mengucci, A; Mingazheva, R; Morgunova, O; Muciaccia, M T; Nessi, M; Orecchini, D; Paoloni, A; Papadia, G; Paparella, L; Pasqualini, L; Pastore, A; Patrizii, L; Polukhina, N; Pozzato, M; Roda, M; Roganova, T; Rosa, G; Sahnoun, Z; Simone, S; Sirignano, C; Sirri, G; Spurio, M; Stanco, L; Starkov, N; Stipcevic, M; Surdo, A; Tenti, M; Togo, V; Ventura, M; Vladymyrov, M
2014-01-01
Neutrino physics is nowadays receiving more and more attention as a possible source of information for the long-standing problem of new physics beyond the Standard Model. The recent measurement of the mixing angle $\\theta_{13}$ in the standard mixing oscillation scenario encourages us to pursue the still missing results on leptonic CP violation and absolute neutrino masses. However, puzzling measurements exist that deserve an exhaustive evaluation. The NESSiE Collaboration has been setup to undertake conclusive experiments to clarify the muon-neutrino disappearance measurements at small $L/E$, which will be able to put severe constraints to models with more than the three-standard neutrinos, or even to robustly measure the presence of a new kind of neutrino oscillation for the first time. To this aim the use of the current FNAL-Booster neutrino beam for a Short-Baseline experiment has been carefully evaluated. This proposal refers to the use of magnetic spectrometers at two different sites, Near and Far. Thei...
Energy Technology Data Exchange (ETDEWEB)
Soleti, S. [Sapienza Univ. of Rome (Italy)
2015-06-15
In this thesis we discuss the simulation and tests carried out for the optimization and design of the electromagnetic calorimeter for the Mu2e (Muon to electron conversion) experiment, which is a proposed experiment part of the Muon Campus hosted at Fermi National Accelerator Laboratory (FNAL) in Batavia, United States.
Energy Technology Data Exchange (ETDEWEB)
Schmidt, Jack; Lilianstrom, Al; Pasetes, Ray; Hill, Kevin; /Fermilab
2004-10-01
The FNAL Email System is the primary point of entry for email destined for an employee or user at Fermilab. This centrally supported system is designed for reliability and availability. It uses multiple layers of protection to help ensure that: (1) SPAM messages are tagged properly; (2) All mail is inspected for viruses; and (3) Valid mail gets delivered. This system employs numerous redundant subsystems to accomplish these tasks.
Charmonium formation in p anti p annihilation by experiment E760
International Nuclear Information System (INIS)
Armstrong, T.A.; Bettoni, D.; Bharadwaj, V.; Biino, C.; Borreani, G.; Broemmelsiek, D.; Buzzo, A.; Calabrese, R.; Ceccucci, A.; Cester, R.; Church, M.; Dalpiaz, P.; Dalpiaz, P.F.; Dibenedetto, R.; Dimitroyannis, D.; Fabbri, M.G.; Fast, J.; Gianoli, A.; Ginsburg, C.M.; Gollwitzer, K.; Hahn, A.; Hasan, M.; Hsueh, S.; Lewis, R.; Luppi, E.; Macri, M.; Majewska, A.M.; Mandelkern, M.; Marchetto, F.; Marinelli, M.; Marques, J.; Marsh, W.; Martini, M.; Masuzawa, M.; Menichetti, E.; Migliori, A.; Mussa, R.; Pallavicini, M.; Palestini, S.; Pastrone, N.; Patrignani, C.; Peoples, J. Jr.; Pesando, L.; Petrucci, F.; Pia, M.G.; Pordes, S.; Rapidis, P.; Ray, R.; Reid, J.; Rinaudo, G.; Roccuzzo, B.; Rosen, J.; Santroni, A.; Sarmiento, M.; Savrie, M.; Scalisi, A.; Schultz, J.; Seth, K.K.; Smith, A.; Smith, G.A.; Sozzi, M.; Trokenheim, S.; Weber, M.F.; Werkema, S.; Zhang, Y.; Zhao, J.; Zioulas, G.
1993-01-01
Experiment E760, at the FNAL anti p Accumulator, is dedicated to the study of charmonium formation in p anti p annihilation. New measurements of the total width and mass of narrow ( anti cc) states and of the partial width of the χ 2 state to γγ are presented. The first evidence for the h c ( 1 P 1 ) singlet state is discussed in detail. (orig.)
Operation of the DC current transformer intensity monitors at FNAL during run II
Energy Technology Data Exchange (ETDEWEB)
Crisp, J.; Fellenz, B.; Heikkinen, D.; Ibrahim, M.A.; Meyer, T.; Vogel, G.; /Fermilab
2012-01-01
Circulating beam intensity measurements at FNAL are provided by five DC current transformers (DCCT), one per machine. With the exception of the DCCT in the Recycler, all DCCT systems were designed and built at FNAL. This paper presents an overview of both DCCT systems, including the sensor, the electronics, and the front-end instrumentation software, as well as their performance during Run II.
Overview of recent studies and design changes for the FNAL magnetron ion source
Bollinger, D. S.; Sosa, A.
2017-08-01
This paper presents several studies and design changes that will eventually be implemented to the Fermi National Accelerator Laboratory (FNAL) magnetron ion source. The topics include tungsten cathode insert, solenoid gas valves, current controlled arc pulser, cesium boiler redesign, gas mixtures of hydrogen and nitrogen, and duty factor reduction. The studies were performed on the FNAL test stand described in [1], with the aim to improve source lifetime, stability, and reducing the amount of tuning needed.
Overview of Recent Studies and Design Changes for the FNAL Magnetron Ion Source
Energy Technology Data Exchange (ETDEWEB)
Bollinger, D. S. [Fermilab; Sosa, A. [Fermilab
2016-09-06
This paper will cover several studies and design changes that will eventually be implemented to the Fermi National Accelerator Laboratory (FNAL) magnetron ion source. The topics include tungsten cathode insert, solenoid gas valves, current controlled arc pulser, cesium boiler redesign, gas mixtures of hydrogen and nitrogen, and duty factor reduction. The studies were performed on the FNAL test stand described in [1], with the aim to improve source lifetime, stability, and reducing the amount of tuning needed.
Electron-Cloud Build-up in the FNAL Main Injector
International Nuclear Information System (INIS)
Furman, M.A.
2007-01-01
We present a summary on ongoing simulation results for the electron-cloud buildup in the context of the proposed FNAL Main Injector (MI) intensity upgrade [1] in a fieldfree region at the location of the RFA electron detector [2]. By combining our simulated results for the electron flux at the vacuum chamber wall with the corresponding measurements obtained with the RFA we infer that the peak secondary electron yield (SEY) (delta) max is ∼> 1.4, and the average electron density is n e ∼> 10 10 m -3 at transition energy for the specific fill pattern and beam intensities defined below. The sensitivity of our results to several variables remains to be explored in order to reach more definitive results. Effects from the electron cloud on the beam are being investigated separately [3
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false State. 147.665 Section 147.665... WORKPLACE (NONPROCUREMENT) Definitions § 147.665 State. State means any of the States of the United States... United States. ...
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Definitions. 665.221 Section 665.221..., DEPARTMENT OF COMMERCE (CONTINUED) FISHERIES IN THE WESTERN PACIFIC Hawaii Fisheries § 665.221 Definitions...) Man grey reef shark Carcharhinus amblyrhynchos. Man galapagos shark Carcharhinus galapagensis. Man...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true State. 312.665 Section 312.665 Foreign Relations....665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false State. 133.665 Section 133.665 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 133.665 State. State means any of the States of the United States, the District of...
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false State. 83.665 Section 83.665 Judicial...) Definitions § 83.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true State. 94.665 Section 94.665 Labor Office of the Secretary....665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false State. 1472.665 Section 1472.665 Labor Regulations Relating...-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1472.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false State. 21.665 Section 21.665... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (GRANTS) Definitions § 21.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false State. 1155.665 Section 1155.665 Public Welfare...) Definitions § 1155.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false State. 26.665 Section 26.665 National Defense... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 26.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false State. 20.665 Section 20.665 Money...-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 20.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession...
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false State. 439.665 Section 439.665 Employees... ASSISTANCE) Definitions § 439.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false State. 607.665 Section 607.665 Energy DEPARTMENT OF ENERGY...) Definitions § 607.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true State. 1509.665 Section 1509.665 Foreign... ASSISTANCE) Definitions § 1509.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false State. 32.665 Section 32.665 Transportation Office... ASSISTANCE) Definitions § 32.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false State. 210.665 Section 210.665 Foreign... (FINANCIAL ASSISTANCE) Definitions § 210.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false State. 630.665 Section 630.665 Public Welfare... DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 630.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true State. 1008.665 Section 1008.665 Foreign... ASSISTANCE) Definitions § 1008.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false State. 1173.665 Section 1173.665 Public Welfare...) Definitions § 1173.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false State. 182.665 Section 182.665 Grants and... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 182.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico...
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false State. 1267.665 Section 1267.665... WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1267.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the...
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false State. 36.665 Section 36.665 Protection... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 36.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false State. 1405.665 Section 1405.665 Food and Drugs... ASSISTANCE) Definitions § 1405.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false State. 29.665 Section 29.665 Commerce... WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 29.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the...
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false State. 43.665 Section 43.665 Public Lands... (FINANCIAL ASSISTANCE) Definitions § 43.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
International Nuclear Information System (INIS)
Miyanishi, Motoaki
1984-01-01
The automatic emulsion analysis system developed by Nagoya cosmic ray observation group was practically used for the experiment (FNAL-E531) on determining the lifetime of charm particles for the first time in the world, and achieved a great successful result. The system consists of four large precise coordinate-measuring stages capable of conducting simultaneous measurement and multiple (currently four) DOMS (digitized on-line microscope), supported with one mini-computer (ECLIPS S/130). The purpose of E531 experiment was the determination of charm particle lifetime. The experiment was carried out at FNAL, USA, and by the irradiation of wide band ν sub(μ) beam equivalent to 7 x 10 18 of 350 GeV/c protons. The detector was a hybrid system of emulsions and a counter spectrometer. The scan of neutrino reaction, the scan of charm particles, and charm event measurement were analyzed in emulsions, and the on-line programs for-respective analyses were created. Nagoya group has found 726 neutrino reactions in the first run, obtained 37 charm particle candidates, and found 1442 neutrino reactions in the second run, and obtained 56 charm particle candidates. The capability of the automatic emulsion analysis system in terms of the time equired for analysis is in total 3.5 hours per event; 15 minutes for C.S. scan, 15 minutes for coupling to module, 20 minutes for tracing to vertex, 1 hour for neutrino reaction measurement, 10 minutes for offline data processing and 1.5 hours for charm particle scanning. (Wakatsuki, Y.)
DEFF Research Database (Denmark)
Raudsepp, Piret; Brüggemann, Dagmar Adeline; Andersen, Mogens Larsen
2014-01-01
(E,E)-3,5-Bis(4-phenyl-1,3-butadienyl)-4,4-difluoro-4-bora-3a,4a-diaza-s-indacene, BODIPY(665/676), is a lipophilic radical-sensitive fluorescent probe that can be used to study radical-driven lipid autoxidation. The sensitivity of BODIPY(665/676) was studied in the presence of radical initiators...... di-tert-butyl peroxide and 2,2'-azobis(2,4-dimethyl)valeronitrile (AMVN). In both cases the fluorescence of BODIPY(665/676) changed more in saturated medium-chain triglyceride oil than in linseed or sunflower oils, where the high degree of unsaturation is expected to give more pronounced radical......-derived lipid oxidation. It was suggested that BODIPY(665/676), as the only available oxidizable substance in the saturated oil, was directly attacked by radicals, resulting in high rates of probe oxidation, while in the unsaturated oils, radicals attacked either unsaturated fatty acids or BODIPY(665...
Harvard University High Energy Physics
International Nuclear Information System (INIS)
1993-01-01
The mainly experimental research program in high energy physics at Harvard is summarized in a descriptive fashion according to the following outline: Proton endash antiproton colliding beam program at Fermilab -- CDF (forward/backward electromagnetic calorimeters -- FEM, central muon extension -- CMX, gas calorimetry and electronics development, front-end electronics upgrades, software development, physics analysis, timetable), electron -- positron collisions in the upsilon region -- CLEO (the hardware projects including CLEO II barrel TOF system and silicon drift detector R ampersand D, physics analysis), search for ν μ to ν τ oscillations with the NOMAD experiment at CERN, the solenoidal detector collaboration at the SSC, muon scattering at FNAL -- E665, the L3 experiment, and phenomenological analysis of high-energy bar pp cross sections. 149 refs
46 CFR 154.665 - Welding procedures.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Welding procedures. 154.665 Section 154.665 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES SAFETY STANDARDS... Construction § 154.665 Welding procedures. Welding procedure tests for cargo tanks for a design temperature...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false State. 105-74.665 Section 105-74.665 Public Contracts and Property Management Federal Property Management Regulations System...-GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 105-74.665 State. State...
Model-independent search for new physics at D0 experiment
Indian Academy of Sciences (India)
2012-11-11
Nov 11, 2012 ... at D0 experiment. MD NAIMUDDIN. Department of Physics, University of Delhi, Delhi 110 007, India. E-mail: nayeem@fnal.gov. Abstract. Finding the .... a similar analysis performed at the CMS experiment. The preliminary results of the CMS analysis was also shown at the Lepton–Photon 2011. Conference.
Recent operation of the FNAL magnetron H- ion source
Karns, P. R.; Bollinger, D. S.; Sosa, A.
2017-08-01
This paper will detail changes in the operational paradigm of the Fermi National Accelerator Laboratory (FNAL) magnetron H- ion source due to upgrades in the accelerator system. Prior to November of 2012 the H- ions for High Energy Physics (HEP) experiments were extracted at ˜18 keV vertically downward into a 90 degree bending magnet and accelerated through a Cockcroft-Walton accelerating column to 750 keV. Following the upgrade in the fall of 2012 the H- ions are now directly extracted from a magnetron at 35 keV and accelerated to 750 keV by a Radio Frequency Quadrupole (RFQ). This change in extraction energy as well as the orientation of the ion source required not only a redesign of the ion source, but an updated understanding of its operation at these new values. Discussed in detail are the changes to the ion source timing, arc discharge current, hydrogen gas pressure, and cesium delivery system that were needed to maintain consistent operation at >99% uptime for HEP, with an increased ion source lifetime of over 9 months.
Electrodes for stochastic cooling of the FNAL antiproton source
International Nuclear Information System (INIS)
Voelker, F.
1982-11-01
AN electrode array for stochastic cooling is being developed for use on the FNAL antiproton source. With minor power handling modifications, the same electrodes can function as pickups or as kickers. When used as pickups, a large array is needed to increase the signal-to-noise ratio. Each electrode is one element of a pair of directional coupler loops that are mounted flush with the upper and lower walls of the beam chamber. The loops, fabricated from flat metal plates, are supported by specially shaped legs
Preliminary results from FNAL E665 muon scattering at low. chi. sub Bj
Energy Technology Data Exchange (ETDEWEB)
Schellman, H.
1991-11-01
We present measurements of inelastic muon scattering cross section ratios at very low x{sub Bj}. The Xe/D{sub 2} cross section ratio has been measured for x{sub Bj} down to 2 {times} 10{sup 3}. We have also measured the n/p cross section ratio down to x{sub Bj} = 10{sup 3} and see no significant deviation from unity. 8 refs., 4 figs.
49 CFR 665.25 - Transportation of vehicle.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Transportation of vehicle. 665.25 Section 665.25 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL TRANSIT ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BUS TESTING Operations § 665.25 Transportation of vehicle. A manufacturer shall...
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false State. 3021.665 Section 3021.665 Agriculture... State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
THE US LONG BASELINE NEUTRINO EXPERIMENT STUDY.
Energy Technology Data Exchange (ETDEWEB)
BISHAI,M.
2007-08-06
The US Long Baseline Neutrino Experiment Study was commissioned jointly by Brookhaven National Laboratory (BNL)and Fermi National Accelerator Laboratory (FNAL) to investigate the potential for future U.S. based long baseline neutrino oscillation experiments using MW class conventional neutrino beams that can be produced at FNAL. The experimental baselines are based on two possible detector locations: (1) off-axis to the existing FNAL NuMI beamline at baselines of 700 to 810 km and (2) NSF's proposed future Deep Underground Science and Engineering Laboratory (DUSEL) at baselines greater than 1000km. Two detector technologies are considered: a megaton class Water Cherenkov detector deployed deep underground at a DUSEL site, or a 100kT Liquid Argon Time-Projection Chamber (TPC) deployed on the surface at any of the proposed sites. The physics sensitivities of the proposed experiments are summarized. We find that conventional horn focused wide-band neutrino beam options from FNAL aimed at a massive detector with a baseline of > 1000km have the best sensitivity to CP violation and the neutrino mass hierarchy for values of the mixing angle {theta}{sub 13} down to 2{sup o}.
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT
Experimental results on charmonium from E760 (FNAL)
International Nuclear Information System (INIS)
Armstrong, T.A.; Hasan, M.A.; Lewis, R.A.; Majewska, A.M.; Reid, J.D.; Smith, G.A.; Zhang, Y.; Bettoni, D.; Borreani, G.; Calabrese, R.; Dalpiaz, P.; Dalpiaz, P.F.; Fabbri, M.; Luppi, E.; Martini, M.; Petrucci, F.; Savrie, M.; Bharadwaj, V.; Church, M.D.; Hahn, A.A.; Hsueh, S.Y.; Marsh, W.; Peoples, J. Jr.; Pordes, S.; Rapidis, P.A.; Werkema, S.J.; Biino, C.; Ceccucci, A.; Cester, R.; Marchetto, F.; Menichetti, E.; Migliori, A.; Mussa, R.; Palestini, S.; Pastrone, N.; Pesando, L.; Rinaudo, G.; Tecchio, L.; Broemmelsiek, D.R.; Fast, J.E.; Gee, M.; Gollwitzer, K.E.; Mandelkern, M.A.; Marques, J.L.; Schultz, J.; Weber, M.F.; Zioulas, G.; Buzzo, A.; Dameri, M.; Ferroni, S.; Macri, M.; Marinelli, M.; Patrignani, C.; Pia, M.G.; Santroni, A.; Tommasini, S.; Zito, M.; Dimitroyannis, D.; Ginsburg, C.M.; Masuzawa, M.; Rosen, J.L.; Sarmiento, M.; Seth, K.K.; Trokenheim, S.; Zhao, J.L.; Ray, R.E.
1992-01-01
E760 is a fixed target experiment dedicated to the study of charmonium spectroscopy in anti pp annihilations. Results on X 1 and X 2 resonance parameters from 1990 data taking are presented, consisting of precise measurement of mass, total width and partial width to anti pp. A preliminary result is presented on the first determination of Ψ'width from line shape analysis. (orig.)
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false State. 1212.665 Section 1212... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1212.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico...
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false State. 48.665 Section 48... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 48.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...
International Nuclear Information System (INIS)
Gunaydin, Yusuf Oguzhan
2009-01-01
Cross-sections are presented for 58 GeV π, K, and p on a wide range of nuclear targets. These cross-sections are essential for determining the neutrino flux in measurements of neutrino cross-sections and oscillations. The E907 Main Injector Particle Production (MIPP) experiment at Fermilab is a fixed target experiment for measuring hadronic particle production using primary 120 GeV/c protons and secondary π, K, and p beams. The particle identification is made by dE/dx in a time projection chamber, and by time-of-flight, differential Cherenkov and ring imaging Cherenkov detectors, which together cover a wide range of momentum from 0.1 GeV/c up to 120 GeV/c. MIPP targets span the periodic table, from hydrogen to uranium, including beryllium and carbon. The MIPP has collected ∼ 0.26 x 10 6 events of 58 GeV/c secondary particles produced by protons from the main injector striking a carbon target.
Maximilien Brice
2007-01-01
National Science Foundation Assistant Director for Mathematics and Physical Sciences Tony Chan (USA) visiting CMS experiment on 23rd May 2007 with Spokesperson T. Virdee, Deputy Spokesperson R. Cousins, Advisor to CERN Director-General J. Ellis, US CMS Research Program Deputy Manager D. Marlow and FNAL D. Green
46 CFR 108.665 - Appliances for watertight integrity.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Appliances for watertight integrity. 108.665 Section 108.665 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Equipment Markings and Instructions § 108.665 Appliances for watertight integrity...
50 CFR 665.98 - Management area.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Management area. 665.98 Section 665.98 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Management area. The American Samoa fishery management area is the EEZ seaward of the Territory of American...
Stoynev, S; Apollinari, G; Auchmann, B; Barzi, E; Izquierdo Bermudez, S; Bossert, R; Chlachidze, G; DiMarco, J; Karppinen, M; Nobrega, F; Novitski, I; Rossi, F; Savary, F; Smekens, D; Strauss, T; Turrioni, D; Velev, G; Zlobin, A V
2017-01-01
A 2 m long single-aperture dipole demonstrator and two 1 m long single-aperture models based on Nb$_{3}$Sn superconductor have been built and tested at FNAL. The two 1 m long collared coils were then assembled in a twin-aperture Nb$_{3}$Sn dipole demonstrator compatible with the LHC main dipole and tested in two thermal cycles. This paper summarizes the quench performance of the FNAL twin-aperture Nb$_{3}$Sn 11 T dipole in the temperature range of 1.9-4.5 K. The results of magnetic measurements for one of the two apertures are also presented. Test results are compared to the performance of coils in a single-aperture configuration. A summary of quench propagation studies in both apertures is given.
50 CFR 665.220 - Hawaii coral reef ecosystem fisheries. [Reserved
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Hawaii coral reef ecosystem fisheries. [Reserved] 665.220 Section 665.220 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Hawaii Fisheries § 665.220 Hawaii coral reef ecosystem fisheries. [Reserved] ...
50 CFR 665.420 - Mariana coral reef ecosystem fisheries. [Reserved
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Mariana coral reef ecosystem fisheries. [Reserved] 665.420 Section 665.420 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Mariana Archipelago Fisheries § 665.420 Mariana coral reef ecosystem fisheries. [Reserved] ...
50 CFR 665.620 - PRIA coral reef ecosystem fisheries. [Reserved
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false PRIA coral reef ecosystem fisheries. [Reserved] 665.620 Section 665.620 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Pacific Remote Island Area Fisheries § 665.620 PRIA coral reef ecosystem fisheries. [Reserved] ...
Studies of E-Cloud Build up for the FNAL Main Injector and for the LHC
International Nuclear Information System (INIS)
Furman, M.A.
2006-01-01
We present a summary of recent simulation studies of the electron-cloud (EC) build-up for the FNAL MI and for the LHC. In the first case we pay particular attention to the dependence on bunch intensity N b at injection energy assuming the nominal bunch spacing t b = 19 ns, and we focus on the dipole magnets and field-free regions. The saturated value of the average EC density shows a clear threshold in N b beyond which the beam will be approximately neutralized on average. For the case of the LHC we limit our discussion to arc dipoles at collision energy, and bunch spacings t b = 25 ns or t b = 75 ns. The main variables exercised in this study are N b and the peak value of the secondary emission yield (SEY) (delta) max . For t b = 25 ns we conclude that the EC power deposition is comfortably below the available cooling capacity of the cryogenic system if (delta) max is below ∼ 1.2 at nominal N b . For t b = 75 ns, the EC power deposition is insignificant. As a byproduct of this exercise, we reach a detailed understanding of the significant role played by the backscattered secondary electrons. This article summarizes the results, an slightly extends the discussions, presented in Refs. 1 and 2
10 CFR 603.665 - Periodic audits of nonprofit participants.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Periodic audits of nonprofit participants. 603.665 Section 603.665 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems Financial Matters...
Neutrino oscillations on the way to long-baseline experiments
Ryabov, V A
2003-01-01
The motivations and physical objectives of experiments in the search for nu /sub mu / to nu /sub e/, nu /sub tau / oscillations in long- baseline accelerator neutrino beams are reviewed. Neutrino beams, detectors, and methods for detecting oscillations (detection of the disappearance of nu /sub mu /, and the appearance of nu /sub e/ and nu /sub tau /) in the current K2K (KEK to Super Kamiokande) experiment and in the MINOS (FNAL to Soudan) and OPERA (CERN to Gran Sasso) near-future experiments are discussed. Possibilities of measuring the oscillation parameters in these experiments are considered in connection with new data obtained in CHOOZ and Palo Verde reactor experiments, the solar neutrino deficit and nu /sub mu // nu /sub e/ anomaly of atmospheric neutrinos, which are observed in large-scale underground detectors, and the excess of nu /sub e/ events in the LSND experiment. Neutrino-oscillation scenarios used in models with three and four (including sterile) types of neutrino, as well as the possibility...
Secondary emission detectors for fixed target experiments at Fermilab
International Nuclear Information System (INIS)
Drucker, R.; Ford, R.; Tassotto, G.
1998-02-01
A description of a Secondary Emission Electron Detector (SEED) is given. The SEEDs provide accurate profiles and positions at small wire spacing (125-500 mm) in a high energy, high rate environment that exceeds the capabilities of traditional segmented wire ion chambers (SWICs). This device has been designed and constructed to monitor beam position and profile of two fixed target beamlines, namely, KTeV (FNAL E-799, E-832) with an average beam sigma at target of 0.22 mm and NuTeV (FNAL E-815) with a sigma = 0.6 mm. KTeV took beam at an intensity of up to 5E12 800 GeV protons over a 20 sec spill and NuTeV received 1E13 800 GeV protons in five pings/spill
An Experimental High Energy Physics Program: Task D
International Nuclear Information System (INIS)
Barnes, V.E.; Carmony, D.D.; Garfinkel, A.F.; Gutay, L.J.
1992-01-01
This report discusses: The CDF for bar p-p Collisions at FNAL; The L3 Detector for e + e - Collisions at CERN; The SCD Detector for pp Collisions at the SSCL (calorimeters); The SDC Detector for pp Collisions at the SSCL (muon detector); The CO experiment for bar p-p Collisions at FNAL; and Accelerator Physics at Fermilab
50 CFR 665.227 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Fisheries § 665.227 Allowable gear and gear restrictions. (a) Hawaii coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...
50 CFR 665.427 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Archipelago Fisheries § 665.427 Allowable gear and gear restrictions. (a) Mariana coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp...
50 CFR 665.127 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Fisheries § 665.127 Allowable gear and gear restrictions. (a) American Samoa coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...
50 CFR 665.627 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Island Area Fisheries § 665.627 Allowable gear and gear restrictions. (a) Coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...
Main Injector Particle Production Experiment Status
International Nuclear Information System (INIS)
Lebedev, Andre
2007-01-01
MIPP (FNAL-E907) is a large acceptance spectrometer to measure hadronic particle production - TPC and wire chambers to measure track parameters - TPC dE/dx, ToF, differential Cherenkov and ring imaging Cherenkov give π/K/p separation up to 100 GeV/c
2010-04-01
... TREASURY LIQUORS âTIED-HOUSEâ Unlawful Inducements Extension of Credit § 6.65 General. Extension of credit by an industry member to a retailer for a period of time in excess of 30 days from the date of...
47 CFR 73.665 - Use of TV aural baseband subcarriers.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Use of TV aural baseband subcarriers. 73.665... RADIO BROADCAST SERVICES Television Broadcast Stations § 73.665 Use of TV aural baseband subcarriers. Licensees of TV broadcast stations may transmit, without further authorization from the FCC, subcarriers and...
50 CFR Figure 1 to Part 665 - Carapace Length of Lobsters
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Carapace Length of Lobsters 1 Figure 1 to Part 665 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... Part 665—Carapace Length of Lobsters ER14JA10.126 ...
26 CFR 1.665(f)-1A - Undistributed capital gain.
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Undistributed capital gain. 1.665(f)-1A Section... Beginning on Or After January 1, 1969 § 1.665(f)-1A Undistributed capital gain. (a) Domestic trusts. (1) The term undistributed capital gain means (in the case of a trust other than a foreign trust created by a U...
Current experiments in elementary-particle physics
International Nuclear Information System (INIS)
Wohl, C.G.; Armstrong, F.E.; Rittenberg, A.
1983-03-01
Microfiche are included which contain summaries of 479 experiments in elementary particle physics. Experiments are included at the following laboratories: Brookhaven (BNL); CERN; CESR; DESY; Fermilab (FNAL); Institute for Nuclear Studies (INS); KEK; LAMPF; Serpukhov (SERP); SIN; SLAC; and TRIUMF. Also, summaries of proton decay experiments are included. A list of experiments and titles is included; and a beam-target-momentum index and a spokesperson index are given. Properties of beams at the facilities are tabulated
Study of New FNAL-NICADD Extruded Scintillator as Active Media of Large EMCal of ALICE at LHC
Grachov, Oleg A.; Pla-Dalmau, A.; Bross, A.; Rykalin, V.
2006-01-01
The current conceptual design of proposed Large EMCal of ALICE at LHC is based largely on the scintillating mega-tile/fiber technology implemented in CDF Endplug upgrade project and in both barrel and endcap electromagnetic calorimeters of the STAR. The cost of scintillating material leads us to the choice of extruded polystyrene based scintillator, which is available in new FNAL-NICADD facility. Result of optical measurements, such as light yield and light yield variation, show that it is possible to use this material as active media of Large EMCal of ALICE at LHC.
Current experiments in elementary particle physics. Revision
International Nuclear Information System (INIS)
Galic, H.; Armstrong, F.E.; von Przewoski, B.
1994-08-01
This report contains summaries of 568 current and recent experiments in elementary particle physics. Experiments that finished taking data before 1988 are excluded. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, INS (Tokyo), ITEP (Moscow), IUCF (Bloomington), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several underground and underwater experiments. Instructions are given for remote searching of the computer database (maintained under the SLAC/SPIRES system) that contains the summaries
Current Experiments in Particle Physics. 1996 Edition.
Energy Technology Data Exchange (ETDEWEB)
Galic, Hrvoje
2003-06-27
This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries.
Current experiments in elementary particle physics. Revision
Energy Technology Data Exchange (ETDEWEB)
Galic, H. [Stanford Linear Accelerator Center, Menlo Park, CA (United States); Armstrong, F.E. [Lawrence Berkeley Lab., CA (United States); von Przewoski, B. [Indiana Univ. Cyclotron Facility, Bloomington, IN (United States)] [and others
1994-08-01
This report contains summaries of 568 current and recent experiments in elementary particle physics. Experiments that finished taking data before 1988 are excluded. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, INS (Tokyo), ITEP (Moscow), IUCF (Bloomington), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several underground and underwater experiments. Instructions are given for remote searching of the computer database (maintained under the SLAC/SPIRES system) that contains the summaries.
Current experiments in particle physics - particle data group
Energy Technology Data Exchange (ETDEWEB)
Galic, H. [Stanford Univ., CA (United States). Stanford Linear Accelerator Center; Lehar, F. [Centre d`Etudes Nucleaires de Saclay, Gif-sur-Yvette (France); Kettle, P.R. [Paul Scherrer Institute, Villigen (Switzerland)] [and others
1996-09-01
This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries.
Current experiments in particle physics - particle data group
International Nuclear Information System (INIS)
Galic, H.; Kettle, P.R.
1996-09-01
This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries
International Nuclear Information System (INIS)
Furman, M.A.
2010-01-01
We present simulation results of the build-up of the electron-cloud density n e in three regions of the FNAL Main Injector (MI) for a beam fill pattern made up of 5 double booster batches followed by a 6th single batch. We vary the pulse intensity in the range N t = (2-5) x 10 13 , and the beam kinetic energy in the range E k = 8-120 GeV. We assume a secondary electron emission model qualitatively corresponding to TiN, except that we let the peak value of the secondary electron yield (SEY) (delta) max vary as a free parameter in a fairly broad range. Our main conclusions are: (1) At fixed N t there is a clear threshold behavior of n e as a function of (delta) max in the range ∼ 1.1-1.3. (2) At fixed (delta) max , there is a threshold behavior of n e as a function of N t provided (delta) max is sufficiently high; the threshold value of N t is a function of the characteristics of the region being simulated. (3) The dependence on E k is weak except possibly at transition energy. Most of these results were informally presented to the relevant MI personnel in April 2010.
Sun, Wen-Chong; Pei, Ling
2016-07-01
Propofol exerts a cytotoxic influence over immature neurocytes. Our previous study revealed that clinically relevant doses of propofol accelerated apoptosis of primary cultured astrocytes of developing rodent brains via rno-miR-665 regulation. However, the role of rno-miR-665 during the growth spurt of neonatal rodent brains in vivo is still uncertain. Post-natal day 7 (P7) rats received a single injection of propofol 30 mg/kg intraperitoneally (i.p.), and neuroapoptosis of hippocampal astrocytes was analyzed by immunofluorescence and scanning electron microscopy. The differential expression of rno-miR-665, BCL2L1 (Bcl-xl), and cleaved caspase 3 (CC3) was surveyed by qRT-PCR and western blotting. In addition, the utility of A-1155463, a highly potent and BCL2L1-selective antagonist, was aimed to assess the contribution of BCL2L1 for neuroglial survival. Following the intraventricular injection of lentivirus rno-miR-665, neuroprotection was detected by 5-point scale measurement. The single dose of propofol 30 mg/kg triggered dose-dependent apoptosis of developing hippocampal astrocytes. Meanwhile, propofol triggered both rno-miR-665 and CC3, and depressed BCL2L1, which was predicted as one target gene of rno-miR-665. Combination treatment with A-1155463 and propofol induced lower mRNA and protein levels of BCL2L1 and more CC3 activation than propofol treatment alone in vivo. The lentivirus-mediated knockdown of rno-miR-665 elevated BCL2L1 and attenuated CC3 levels, whereas up-regulation of rno-miR-665 suppressed BCL2L1 and induced CC3 expression in vivo. More importantly, rno-miR-665 antagomir infusion improved neurological outcomes of pups receiving propofol during the brain growth spurt. Rno-miR-665, providing a potential target for alternative therapeutics for pediatric anesthesia, is susceptible to propofol by negatively targeting antiapoptotic BCL2L1. Relatively little is known about the association between exposure of astrocytes to brief propofol
20 CFR 416.665 - How does your representative payee account for the use of benefits?
2010-04-01
... for the use of benefits? 416.665 Section 416.665 Employees' Benefits SOCIAL SECURITY ADMINISTRATION... in order to make accounting reports and must make those records available upon our request. If your representative payee fails to provide an annual accounting of benefits or other required reports, we may require...
Energy Technology Data Exchange (ETDEWEB)
Furman, M. A.
2010-12-11
We present simulation results of the build-up of the electron-cloud density n{sub e} in three regions of the FNAL Main Injector (MI) for a beam fill pattern made up of 5 double booster batches followed by a 6th single batch. We vary the pulse intensity in the range N{sub t} = (2-5) x 10{sup 13}, and the beam kinetic energy in the range E{sub k} = 8-120 GeV. We assume a secondary electron emission model qualitatively corresponding to TiN, except that we let the peak value of the secondary electron yield (SEY) {delta}{sub max} vary as a free parameter in a fairly broad range. Our main conclusions are: (1) At fixed N{sub t} there is a clear threshold behavior of n{sub e} as a function of {delta}{sub max} in the range {approx} 1.1-1.3. (2) At fixed {delta}{sub max}, there is a threshold behavior of n{sub e} as a function of N{sub t} provided {delta}{sub max} is sufficiently high; the threshold value of N{sub t} is a function of the characteristics of the region being simulated. (3) The dependence on E{sub k} is weak except possibly at transition energy. Most of these results were informally presented to the relevant MI personnel in April 2010.
7 CFR 205.665 - Noncompliance procedure for certifying agents.
2010-01-01
... applicable State organic program's governing State official all records concerning its certification...) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Administrative Compliance § 205.665... agent. (f) Cessation of certification activities. A certifying agent whose accreditation is suspended or...
20 CFR 665.300 - What are rapid response activities and who is responsible for providing them?
2010-04-01
... responsible for providing them? 665.300 Section 665.300 Employees' Benefits EMPLOYMENT AND TRAINING... natural or other disaster resulting in a mass job dislocation. (b) The State is responsible for providing.... The State must establish methods by which to provide additional assistance to local areas that...
Object based data access at the D0 experiment
International Nuclear Information System (INIS)
Fuess, S.
1995-11-01
The D OE Experiment at Fermilab is currently participating in the FNAL Computing Division's ''Computing for Analysis Project'' (CAP) to investigate object based data storage and access. Following a short description of the CAP system architecture, the D OE data model is explored. A brief discussion of the method of operation of the CAP system leads into a concluding section
Indiana University High Energy Physics, Task A
Energy Technology Data Exchange (ETDEWEB)
Brabson, B.; Crittenden, R.; Dzierba, A.; Hanson, G.; Martin, H.; Marshall, T.; Mir, R.; Mouthuy, T.; Ogren, H.; Rust, D.; Teige, S.; Zieminska, D.; Zieminski, A.
1991-01-01
This report discusses research in High Energy Physics under the following experiments: Meson spectroscopy at BNL; dimuon production at FNAL; the DO collider experiment at FNAL; the Mark II experiment at SLC and PEP; the OPAL experiment at CERN; and the superconducting supercollider.
Indiana University High Energy Physics, Task A
International Nuclear Information System (INIS)
Brabson, B.; Crittenden, R.; Dzierba, A.; Hanson, G.; Martin, H.; Marshall, T.; Mir, R.; Mouthuy, T.; Ogren, H.; Rust, D.; Teige, S.; Zieminska, D.; Zieminski, A.
1991-01-01
This report discusses research in High Energy Physics under the following experiments: Meson spectroscopy at BNL; dimuon production at FNAL; the DO collider experiment at FNAL; the Mark II experiment at SLC and PEP; the OPAL experiment at CERN; and the superconducting supercollider
Compilation of current high-energy-physics experiments
International Nuclear Information System (INIS)
Wohl, C.G.; Kelly, R.L.; Armstrong, F.E.
1980-04-01
This is the third edition of a compilation of current high energy physics experiments. It is a collaborative effort of the Berkeley Particle Data Group, the SLAC library, and ten participating laboratories: Argonne (ANL), Brookhaven (BNL), CERN, DESY, Fermilab (FNAL), the Institute for Nuclear Study, Tokyo (INS), KEK, Rutherford (RHEL), Serpukhov (SERP), and SLAC. The compilation includes summaries of all high energy physics experiments at the above laboratories that (1) were approved (and not subsequently withdrawn) before about January 1980, and (2) had not completed taking of data by 1 January 1976
20 CFR 408.665 - How does your representative payee account for the use of your SVB payments?
2010-04-01
... for the use of your SVB payments? 408.665 Section 408.665 Employees' Benefits SOCIAL SECURITY... records of how benefits were used in order to provide accounting reports and must make those records available upon our request. If your representative payee fails to provide an annual accounting of benefits...
Indiana University High Energy Physics, Task A
International Nuclear Information System (INIS)
Brabson, B.; Crittenden, R.; Dzierba, A.
1993-01-01
This report discusses research at Indians University on the following high energy physics experiments: A search for mesons with unusual quantum numbers; hadronic states produced in association with high-mass dimuons; FNAL E740 (D0); superconducting super collider; and OPAL experiment at CERN
International Nuclear Information System (INIS)
Ambrogiani, M.; Baldini, W.; Bettoni, D.
1996-01-01
A tracking detector made of scintillating fibers has been built for the Fermilab experiment E835. The tracker is being used for a high resolution measurement of the polar angle θ and to provide a first level trigger, exploiting the fast response and very good time resolution of the signal from the fibers. The small amount of light from the fibers is detected by solid state devices (VLPC: Visible Light Photon Counters), with very high quantum efficiency. This paper reports about the construction of the tracker and gives the first results on the detector performance: light yield/mip, efficiency, signal homogeneity and time resolution
Bringing Federated Identity to Grid Computing
Energy Technology Data Exchange (ETDEWEB)
Teheran, Jeny [Fermilab
2016-03-04
The Fermi National Accelerator Laboratory (FNAL) is facing the challenge of providing scientific data access and grid submission to scientific collaborations that span the globe but are hosted at FNAL. Users in these collaborations are currently required to register as an FNAL user and obtain FNAL credentials to access grid resources to perform their scientific computations. These requirements burden researchers with managing additional authentication credentials, and put additional load on FNAL for managing user identities. Our design integrates the existing InCommon federated identity infrastructure, CILogon Basic CA, and MyProxy with the FNAL grid submission system to provide secure access for users from diverse experiments and collab orations without requiring each user to have authentication credentials from FNAL. The design automates the handling of certificates so users do not need to manage them manually. Although the initial implementation is for FNAL's grid submission system, the design and the core of the implementation are general and could be applied to other distributed computing systems.
50 CFR 665.812 - Sea turtle take mitigation measures.
2010-10-01
....812 Section 665.812 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... of hook sizes and styles used by the vessel. (B) Extended reach handle. The hook removal device must... hook sizes and styles used by the vessel. (B) Handle. The handle must have a length equal to or greater...
Energy Technology Data Exchange (ETDEWEB)
Bodek, A.; Ferbel, T.; Melissinos, A.C.; Slattery, P.; Tipton, P.; Das, A.; Hagen, C.R.; Rajeev, S.G.; Okubo, S.; Orr, L.
1993-05-01
The various components of the high-energy physics research program at the University of Rochester are presented. (I)Fixed-target experimentation at FNAL includes studies of direct photon production by p and {pi} on H, Be, and Cu, and hybrid mesons and other physics issues in Coulomb excitation at high energies. (II)The status of the GEM (Gammas, Electrons, and Muons) Experiment at the SSC is given. (III)The D-Zero experiment at FNAL is reviewed. (IV)Deep inelastic lepton--nucleon scattering experiments are summarized: electron scattering experiments at SLAC, FNAL neutrino quad triplet runs, FNAL neutrino sign selected experiments, and SDC cosmic ray test and test beam calibration. (V)Studies of nonlinear QED at SLAC concentrated on a study of QED at critical field strength in intense laser--high-energy electron collisions. (VI)Development work on the Collider Detector at Fermilab (CDF) emphasized the CDF silicon vertex detector, the end plug calorimeter, and the SDC tile/fiber calorimetry. (VII)The theoretical physics effort is sketched.
Theoretical and experimental studies of elementary physics
International Nuclear Information System (INIS)
Bodek, A.; Ferbel, T.; Melissinos, A.C.; Slattery, P.; Tipton, P.; Das, A.; Hagen, C.R.; Rajeev, S.G.; Okubo, S.; Orr, L.
1993-01-01
The various components of the high-energy physics research program at the University of Rochester are presented. (I)Fixed-target experimentation at FNAL includes studies of direct photon production by p and π on H, Be, and Cu, and hybrid mesons and other physics issues in Coulomb excitation at high energies. (II)The status of the GEM (Gammas, Electrons, and Muons) Experiment at the SSC is given. (III)The D-Zero experiment at FNAL is reviewed. (IV)Deep inelastic lepton--nucleon scattering experiments are summarized: electron scattering experiments at SLAC, FNAL neutrino quad triplet runs, FNAL neutrino sign selected experiments, and SDC cosmic ray test and test beam calibration. (V)Studies of nonlinear QED at SLAC concentrated on a study of QED at critical field strength in intense laser--high-energy electron collisions. (VI)Development work on the Collider Detector at Fermilab (CDF) emphasized the CDF silicon vertex detector, the end plug calorimeter, and the SDC tile/fiber calorimetry. (VII)The theoretical physics effort is sketched
Physics, Computer Science and Mathematics Division. Annual report, January 1-December 31, 1980
International Nuclear Information System (INIS)
Birge, R.W.
1981-12-01
Research in the physics, computer science, and mathematics division is described for the year 1980. While the division's major effort remains in high energy particle physics, there is a continually growing program in computer science and applied mathematics. Experimental programs are reported in e + e - annihilation, muon and neutrino reactions at FNAL, search for effects of a right-handed gauge boson, limits on neutrino oscillations from muon-decay neutrinos, strong interaction experiments at FNAL, strong interaction experiments at BNL, particle data center, Barrelet moment analysis of πN scattering data, astrophysics and astronomy, earth sciences, and instrument development and engineering for high energy physics. In theoretical physics research, studies included particle physics and accelerator physics. Computer science and mathematics research included analytical and numerical methods, information analysis techniques, advanced computer concepts, and environmental and epidemiological studies
Physics, Computer Science and Mathematics Division. Annual report, January 1-December 31, 1980
Energy Technology Data Exchange (ETDEWEB)
Birge, R.W.
1981-12-01
Research in the physics, computer science, and mathematics division is described for the year 1980. While the division's major effort remains in high energy particle physics, there is a continually growing program in computer science and applied mathematics. Experimental programs are reported in e/sup +/e/sup -/ annihilation, muon and neutrino reactions at FNAL, search for effects of a right-handed gauge boson, limits on neutrino oscillations from muon-decay neutrinos, strong interaction experiments at FNAL, strong interaction experiments at BNL, particle data center, Barrelet moment analysis of ..pi..N scattering data, astrophysics and astronomy, earth sciences, and instrument development and engineering for high energy physics. In theoretical physics research, studies included particle physics and accelerator physics. Computer science and mathematics research included analytical and numerical methods, information analysis techniques, advanced computer concepts, and environmental and epidemiological studies. (GHT)
International Nuclear Information System (INIS)
Widgoff, M.; Shapiro, A.M.
1983-01-01
An experimental program to study the interactions of hadrons and photons is being carried out using hybrid systems which include bubble chambers as visible targets as well as counter spectrometers for particle detection, measurement and identification. Experiments are now being carried out at Fermilab and SLAC, and an experiment on neutrino interactions has been approved for the Tevatron at Fermilab. We have been analyzing the film of our one-million-picture 1982 exposure for the study of π/sup +-/, K + and p interactions in hydrogen and in magnesium, silver and gold, at a beam momentum of 200 Gev/c (FNAL Experiments E-565 and E-570). Preliminary results confirm the positive charge excess observed among relativistic particles in our test run of 1981. During the past year analysis has continued on the data of SLAC experiments BC 72/73, investigating the interactions with hydrogen of 20 GeV polarized photons. Results have been obtained and published on the photoproduction of charm and on the lifetimes of charmed particles. Analysis is also in progress on production of vector mesons and strange particles. The study of charm photoproduction and decay is being extended in SLAC experiment BC 75. An initial run of over 600,000 pictures was obtained in the SLAC Hybrid Facility in Spring 1983 with substantially improved resolution in the bubble chamber. Extensive work continues on the analysis of our earlier FNAL experiments on π/sup +-/p, K + p, and pp interactions at 147 GeV/c (FNAL Experiment E-299). Preparations are in progress for our approved Tevatron II experiment designed to study neutrino interactions and particularly the production of tau neutrinos, using a neutrino beam produced by beam dump techniques and employing a hybrid system with a new one-meter holographic bubble chamber
Using the Tevatron Electron Lens (TEL) as a Wire and other TEL Studies at FNAL
Zimmermann, Frank; Sen, T; Shiltsev, V D; Zhang, X L; CERN. Geneva. AB Department
2004-01-01
During a visit to FNAL, on March 1, 2004, we performed a two-dimensional grid scan - with 1-mm step size - of the TEL transverse position in the vicinity of the proton and pbar beams, while three bunches of either beam were excited by the TEL on every turn. The measured tune shifts of protons and pbars are compatible with expectation. The proton Schottky 'emittance' is strongly dependent on the TEL position, possibly due to a coherent interaction between protons and electrons. The relative position of protons, pbars and TEL can be determined in three different ways: from the TEL BPM readings, from the tune variation with TEL position, and from the loss-rate variation with the TEL position. The results are consistent at least within 1 or 2 mm, possibly better. Tunes and losses do not necessarily yield identical values for the beam position. Significant proton losses occurred when the TEL approached the proton beam. These losses decreased with the third power of the distance. They were the result of a longitudi...
Commissioning and Operation of the FNAL Front end Injection Line and Ion Sources.
Energy Technology Data Exchange (ETDEWEB)
Karns, Patrick R. [Indiana Univ., Bloomington, IN (United States)
2015-09-01
This thesis documents the efforts made in commissioning and operating the RFQ Injection Line (RIL) as a replacement for the Cockcroft Walton front end. The Low Energy Beam Transport (LEBT) was assembled and tested with multiwire position and emittance monitor measurements. The Radio Frequency Quadrupole (RFQ) commissioning was completed with the same measurements as well as output beam energy measurements that showed it initially accelerated beam only to 700 keV, which was 50 keV lower than the design energy. Working with the manufacturer solutions were found and instituted to continue testing. The Medium Energy Beam Transport (MEBT) was then connected as the RIL was installed as the new front end of Linac. Testing gave way to operation when the new front end was used as the source of all High Energy Physics (HEP) beam for Fermi National Accelerator Laboratory (FNAL). The magnetron ion source that provides the H- beam for the front end required several changes and eventual upgrades to operate well; such as new source operating points for vacuum pressure and cesium admixture, and new materials for critical source components. Further research was conducted on the cathode geometry and nitrogen doping of the hydrogen gas as well as using solid state switches for the extractor system high voltage.
Current Experiments in Particle Physics (September 1996)
Energy Technology Data Exchange (ETDEWEB)
Galic, H.; Lehar, F.; Klyukhin, V.I.; Ryabov, Yu.G.; Bilak, S.V.; Illarionova, N.S.; Khachaturov, B.A.; Strokovsky, E.A.; Hoffman, C.M.; Kettle, P.-R.; Olin, A.; Armstrong, F.E.
1996-09-01
This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries. This report contains full summaries of 180 approved current and recent experiments in elementary particle physics. The focus of the report is on selected experiments which directly contribute to our better understanding of elementary particles and their properties such as masses, widths or lifetimes, and branching fractions.
32 CFR 37.665 - Must I require nonprofit participants to have periodic audits?
2010-07-01
... DEFENSE DoD GRANT AND AGREEMENT REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems Financial Matters § 37.665 Must I require nonprofit...
Reactor θ{sub 13} Results and Recent Results from FNAL Neutrino Experiments
Energy Technology Data Exchange (ETDEWEB)
Johnson, R.A., E-mail: randy.johnson@uc.edu [Physics Department, University of Cincinnati, Cincinnati, OH 45221-0011 (United States)
2014-08-15
The past year has been very exciting for neutrino physics. The last mixing angle, θ{sub 13}, has been measured by a number of experiments and is quite large. These experiments will, hopefully, continue reducing systematic and statistical errors in anticipation of statistically significant CP violation experiments. At Fermilab, MiniBooNE has finished its data run and has new results for electron antineutrino excesses; MINOS has done a combined fit for their ν{sub μ} disappearance measurements for neutrinos and antineutrinos (which are now consistent) and presented results for a sterile neutrino search; and Minerνa has presented its first cross section results.
Experimental high energy physics. Progress report, 1 January 1985-31 December 1985
International Nuclear Information System (INIS)
Widgoff, M.
1985-01-01
An experimental program to study the interactions of hadrons, photons, and neutrinos is being carried out using hybrid systems which include bubble chambers as visible targets and counter spectrometers for particle detection, identification, and momentum measurements. Experiments have been run in both positive and negative hadron beams at Fermilab and with polarized photons at SLAC. Experiments with neutrino beams at Tevatron II at Fermilab are in progress and in preparation. In addition, we have joined in a collaboration to submit a Letter of Intent to build a detector for experiments at the new ep colliding beam accelerator HERA at DESY. We have been analyzing the film and counter data of our one-million-picture exposure for the study of π + , K + and p interactions in hydrogen and magnesium, silver and gold, at a beam momentum of 200 GeV/c (FNAL Experiments E-565 and E-570), as well as continuing the physics analysis of our earlier FNAL experiments on π + p, K + p and pp interactions at 147 GeV/c (FNAL Experiment E-299). During the past year analysis has continued on the data of SLAC experiments BC72/73/75, studying the interactions in hydrogen of 20 GeV polarized photons. Results have been obtained on photoproduction of charm and on the lifetimes of charmed particles, and on vector meson and strange particle production. Inclusive γp interactions are being studied in detail in this high statistics sample. The hybrid detector for neutrino studies at Tevatron II is operating at Fermilab, as a test for E636, the tau neutrino search to be run in a neutrino beam from a beam dump, and we are collecting data on muon neutrino interactions in the high Q 2 region made accessible for the first time by the Tevatron (E745). Brown built scintillator hodoscopes for the trigger system of the detector. Data including holographic photographs of the Tohoku one-meter bubble chamber are being obtained, and film analysis has begun
Energy Technology Data Exchange (ETDEWEB)
Carey, R. M.; Lynch, K. R.; Miller, J. P.; Roberts, B. L.; Morse, W. M.; Semertzides, Y. K.; Druzhinin, V. P.; Khazin, B. I.; Koop, I. A.; Logashenko, I. [et al.; Redin, S. I.
2009-02-01
We propose to measure the muon anomalous magnetic moment, a{sub {mu}}, to 0.14 ppm-a fourfold improvement over the 0.54 ppm precision obtained in the BNL experiment E821. The muon anomaly is a fundamental quantity and its precise determination will have lasting value. The current measurement was statistics limited, suggesting that greater precision can be obtained in a higher-rate, next-generation experiment. We outline a plan to use the unique FNAL complex of proton accelerators and rings to produce high-intensity bunches of muons, which will be directed into the relocated BNL muon storage ring. The physics goal of our experiment is a precision on the muon anomaly of 16 x 10{sup -11}, which will require 21 times the statistics of the BNL measurement, as well a factor of 3 reduction in the overall systematic error. Our goal is well matched to anticipated advances in the worldwide effort to determine the standard model (SM) value of the anomaly. The present comparison, {Delta}a{sub {mu}} (Expt: -SM) = (295 {+-} 81) x 10{sup -11}, is already suggestive of possible new physics contributions to the muon anomaly. Assuming that the current theory error of 51 x 10{sup -11} is reduced to 30 x 10{sup -11} on the time scale of the completion of our experiment, a future {Delta}a{sub {mu}} comparison would have a combined uncertainty of {approx} 34 x 10{sup -11}, which will be a sensitive and complementary benchmark for proposed standard model extensions. The experimental data will also be used to improve the muon EDM limit by up to a factor of 100 and make a higher-precision test of Lorentz and CPT violation. We describe in this Proposal why the FNAL complex provides a uniquely ideal facility for a next-generation (g-2) experiment. The experiment is compatible with the fixed-target neutrino program; indeed, it requires only the unused Booster batch cycles and can acquire the desired statistics in less than two years of running. The proton beam preparations are largely aligned
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Exclusions from accumulation distributions in the case of trusts (other than a foreign trust created by a U.S. person). 1.665(b)-2 Section 1.665(b)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Treatment of Excess...
Power combiners/dividers for loop pickup and kicker arrays for FNAL stochastic cooling rings
International Nuclear Information System (INIS)
Johnson, J.K.; Nemetz, R.
1985-05-01
The anti-proton accumulator and debuncher at FNAL will use stochastic methods to ''cool'' the beam. Pairs of quarter-wavelength directional-coupler loops are used to detect and kick the beam. The loops are copper plates which are flush with the upper and lower wall of a rectangular beam pipe. The plates, when surrounded by a properly sized pocket, form a 100-ohm transmission-line directional coupler. As the beam passes, a signal which gives position and time information, is induced in the plates. But, because the signal levels are low (<.5 picowatts per pair), a power combiner (usually several primary combiners feeding a secondary combiner) is used to combine the outputs of many loops. Subsequently, the combined signal is amplified, filtered and then fed into a divider, (that is, a combiner operating in reverse). The divider distributes the signal into a different set of loops which modify (kick) the beam's position. Since the loop couplers are arranged linearly, in arrays of various lengths, combiners also provide a convenient method of reducing the number of vacuum feedthroughs and preamplifiers and their related costs in performance and dollars. In this note we describe various stripline combiner systems that add the outputs of 4, 8, 16 or 32 loops
Compilation of current high energy physics experiments
International Nuclear Information System (INIS)
1978-09-01
This compilation of current high-energy physics experiments is a collaborative effort of the Berkeley Particle Data Group, the SLAC library, and the nine participating laboratories: Argonne (ANL), Brookhaven (BNL), CERN, DESY, Fermilab (FNAL), KEK, Rutherford (RHEL), Serpukhov (SERP), and SLAC. Nominally, the compilation includes summaries of all high-energy physics experiments at the above laboratories that were approved (and not subsequently withdrawn) before about June 1978, and had not completed taking of data by 1 January 1975. The experimental summaries are supplemented with three indexes to the compilation, several vocabulary lists giving names or abbreviations used, and a short summary of the beams at each of the laboratories (except Rutherford). The summaries themselves are included on microfiche
Progress status for the Mu2e calorimeter system
International Nuclear Information System (INIS)
Pezzullo, Gianantonio; Cervelli, F; Budagov, J; Davydov, Yu; Glagolev, V; Carosi, R; Cheng, C; Echenard, B; Hitlin, D; Martini, M; Ongmonkolkul, P; Porter, F; Cordelli, M; Corradi, G; Giovannella, S; Happacher, F; Luca, A; Miscetti, S; Saputi, A; Murat, P
2015-01-01
The Mu2e experiment at FNAL aims to measure the charged-lepton flavor violating neutrinoless conversion of a negative muon into an electron. The conversion results in a monochromatic electron with an energy slightly below the muon rest mass (104.97 MeV). The calorimeter should confirm that the candidates reconstructed by the extremely precise tracker system are indeed conversion electrons while performing a powerful μ/e particle identification. Moreover, it should also provide a high level trigger for the experiment independently from the tracker system. The calorimeter should also be able to keep functionality in an environment where the background delivers a dose of ∼ 10 krad/year in the hottest area and to work in the presence of 1 T axial magnetic field. These requirements translate in the design of a calorimeter with large acceptance, good energy resolution O(5%) and a reasonable position (time) resolution of ∼ < 1 cm (<0.5ns). The baseline version of the calorimeter is composed by two disks of inner (outer) radius of 351 (660) mm filled by 1860 hexagonal BaF 2 crystals of 20 cm length. Each crystal is readout by two large area APD's. In this paper, we summarize the experimental tests done so far as well as the simulation studies in the Mu2e environment
Sun, Wen-Chong; Liang, Zuo-Di; Pei, Ling
2015-12-01
Propofol exerts neurotoxic effects on the developing mammalian brains, but the underlying molecular mechanism remains unclear. MicroRNAs (miRNAs) are a class of small noncoding RNAs that modulate gene expression at the post-transcriptional level. However, in specific types of neurocytes, the detailed functions of miRNAs were not entirely understood. We investigated the potential role of miRNAs in astrocyte pathogenesis caused by propofol. We performed genome-wide microRNA expression profiling in immature cultured hippocampal astrocytes by microarray analysis and predicted their targets and functions using bioinformatics tools. The functional effects of one differentially expressed miRNA were examined experimentally in relation to astrocyte viability. The results showed that 13 miRNAs were significantly differentially expressed after both short-term exposure to high-concentration propofol (10 μg/ml for 1h) and long-term exposure to low-concentration propofol (0.9 μg/ml for 48 h), including rno-miR-665, differing significantly between the 2. Bioinformatics predicted putative binding sites for rno-miR-665 existing in the 3'-untranslated region of Bcl-2-like protein 1 BCL2L1 (Bcl-xl) mRNA. Moreover, such relationship was assessed by luciferase reporter assay, qRT-PCR and western blot. Rno-miR-665 which was significantly up-regulated by propofol can suppress BCL2L1 and elevate cleaved caspase-3 expression in immature astrocytes in vitro. Apoptosis of developing hippocampal astrocytes was thus significantly influenced by propofol or rno-miR-665, or both. Taken together, rno-miR-665 is involved in the neurotoxicity induced by propofol via a caspase-3 mediated mechanism by negatively regulating BCL2L1. It might act as an alternative therapeutic target for treatment of neurological disorders in peadiatric prolonged anesthesia or sedation with propofol clinically. Copyright © 2015. Published by Elsevier B.V.
A search for sterile neutrinos at the MINOS experiment
Energy Technology Data Exchange (ETDEWEB)
Pittam, Robert Neil [Univ. of Oxford (United Kingdom)
2010-01-01
MINOS is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory in Illinois, USA. The experiment was designed to study neutrino oscillation phenomena. The vμ beam produced by the NuMI beam facility at FNAL is used along with two functionally identical detectors. The Near Detector at FNAL and a Far Detector 735 km away in the Soudan Underground Laboratory in northern Minnesota. Comparison of the observed spectra of neutrinos at the two detectors provides the evidence for neutrino oscillations. This thesis presents work on the postulated phenomena of sterile neutrinos. Oscillations between active and sterile neutrinos will lead to a deficit in the expected rate of measured Neutral Current interactions at the Far Detector. A technique for selecting Neutral Current events utilizing an Artificial Neural Network is presented with resulting overall efficiency of 91.1% and purity of 66.0%. A method of predicting the expected Charged and Neutral Current energy spectra at the Far Detector given the data recorded at the Near Detector is presented. A model to search for oscillations between sterile and active neutrinos is developed. Sources of systematic uncertainty that can effect the results of the analysis are discussed. The analysis developed is applied to a Standard Model 3 flavour oscillation model as a cross check under the scenarios with and without ve appearance. The oscillation parameters measured by this model are Δm322 = (2.39-0.15+0.23) x 10-3 eV2 and θ23 = 0.727-0.11+0.22 for the no ve appearance result. An analysis of the resulting prediction reveals no evidence for active neutrino disappearance. The analysis is then performed using the 4 flavour neutrino oscillation model developed. Again this is done under the 2 scenarios of ve appearance and no ve appearance
The NESSiE way to searches for sterile neutrinos at FNAL
Stanco, L.; Bagulya, A.; Benettoni, M.; Bernardini, P.; Brugnera, R.; Calabrese, M.; Cecchetti, A.; Cecchini, S.; Chernyavskiy, M.; Creti, P.; Dal Corso, F.; Dalkarov, O.; Del Prete, A.; De Robertis, G.; De Serio, M.
2014-01-01
Neutrino physics is nowadays receiving more and more attention as a possible source of information for the long-standing problem of new physics beyond the Standard Model. The recent measurement of the mixing angle $\\theta_{13}$ in the standard mixing oscillation scenario encourages us to pursue the still missing results on leptonic CP violation and absolute neutrino masses. However, puzzling measurements exist that deserve an exhaustive evaluation. The NESSiE Collaboration has been setup to u...
Compilation of current high energy physics experiments - Sept. 1978
Energy Technology Data Exchange (ETDEWEB)
Addis, L.; Odian, A.; Row, G. M.; Ward, C. E. W.; Wanderer, P.; Armenteros, R.; Joos, P.; Groves, T. H.; Oyanagi, Y.; Arnison, G. T. J.; Antipov, Yu; Barinov, N.
1978-09-01
This compilation of current high-energy physics experiments is a collaborative effort of the Berkeley Particle Data Group, the SLAC library, and the nine participating laboratories: Argonne (ANL), Brookhaven (BNL), CERN, DESY, Fermilab (FNAL), KEK, Rutherford (RHEL), Serpukhov (SERP), and SLAC. Nominally, the compilation includes summaries of all high-energy physics experiments at the above laboratories that were approved (and not subsequently withdrawn) before about June 1978, and had not completed taking of data by 1 January 1975. The experimental summaries are supplemented with three indexes to the compilation, several vocabulary lists giving names or abbreviations used, and a short summary of the beams at each of the laboratories (except Rutherford). The summaries themselves are included on microfiche. (RWR)
PARTICIPATION IN HIGH ENERGY PHYSICS
Energy Technology Data Exchange (ETDEWEB)
White, Christopher
2012-12-20
This grant funded experimental and theoretical activities in elementary particles physics at the Illinois Institute of Technology (IIT). The experiments in which IIT faculty collaborated included the Daya Bay Reactor Neutrino Experiment, the MINOS experiment, the Double Chooz experiment, and FNAL E871 - HyperCP experiment. Funds were used to support summer salary for faculty, salary for postdocs, and general support for graduate and undergraduate students. Funds were also used for travel expenses related to these projects and general supplies.
50 CFR 665.249 - Lobster size and condition restrictions in Permit Area 2.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Lobster size and condition restrictions in... WESTERN PACIFIC Hawaii Fisheries § 665.249 Lobster size and condition restrictions in Permit Area 2. (a) Only spiny lobsters with a carapace length of 8.26 cm or greater may be retained (see Figure 1 to this...
The fabric for frontier experiments project at Fermilab
International Nuclear Information System (INIS)
Kirby, Michael
2014-01-01
The FabrIc for Frontier Experiments (FIFE) project is a new, far-reaching initiative within the Fermilab Scientific Computing Division to drive the future of computing services for experiments at FNAL and elsewhere. It is a collaborative effort between computing professionals and experiment scientists to produce an end-to-end, fully integrated set of services for computing on the grid and clouds, managing data, accessing databases, and collaborating within experiments. FIFE includes 1) easy to use job submission services for processing physics tasks on the Open Science Grid and elsewhere; 2) an extensive data management system for managing local and remote caches, cataloging, querying, moving, and tracking the use of data; 3) custom and generic database applications for calibrations, beam information, and other purposes; 4) collaboration tools including an electronic log book, speakers bureau database, and experiment membership database. All of these aspects will be discussed in detail. FIFE sets the direction of computing at Fermilab experiments now and in the future, and therefore is a major driver in the design of computing services worldwide.
Energy Technology Data Exchange (ETDEWEB)
Yashima, Hiroshi; /Kyoto U., KURRI; Matsuda, Norihiro; Kasugai, Yoshimi; /JAEA, Ibaraki; Matsumura, Hiroshi; Iwase, Hiroshi; /KEK, Tsukuba; Kinoshita, Norikazu; /KEK, Tsukuba /Tsukuba U.; Boehnlein, David; Lauten, Gary; Leveling, Anthony; Mokhov, Nikolai; Vaziri, Kamran; /Fermilab /Shimizu, Tokyo /JAEA, Ibaraki
2011-01-01
The JASMIN Collaboration has performed an experiment to conduct measurements of nuclear reaction rates around the anti-proton production (Pbar) target at the Fermi National Accelerator Laboratory (FNAL). At the Pbar target station, the target, consisting an Inconel 600 cylinder, was irradiated by a 120 GeV/c proton beam from the FNAL Main Injector. The beam intensity was 3.6 x 10{sub 12} protons per second. Samples of Al, Nb, Cu, and Au were placed near the target to investigate the spatial and energy distribution of secondary particles emitted from it. After irradiation, the induced activities of the samples were measured by studying their gamma ray spectra using HPGe detectors. The production rates of 30 nuclides induced in Al, Nb, Cu, Au samples were obtained. These rates increase for samples placed in a forward (small angle) position relative to the target. The angular dependence of these reaction rates becomes larger for increasing threshold energy. These experimental results are compared with Monte Carlo calculations. The calculated results generally agree with the experimental results to within a factor of 2 to 3.
A straw chambers' tracker for the high rate experiment 835 at the Fermilab accumulator
Bagnasco, S.; Dughera, G.; Giraudo, G.; Govi, G.; Marchetto, F.; Menichetti, E.; Pastrone, N.; Rumerio, P.; Trapani, P. P.
1998-02-01
Two layers of proportional drift tubes (aluminum mylar straws) are staggered in two cylindrical light chambers to measure charged particles' azimuthal angle. To stand the high rates (˜10 kHz/ cm2) and minimize the pile-up of the high luminosity experiment 835 at FNAL, a fast ASIC Amplifier-Shaper-Discriminator (ASD-8B) was chosen. The front-end electronics, designed exclusively with SMD components, was mounted on the downstream end plug of each chamber to avoid oscillations and noise. Design, construction and operational performances of these detectors are presented.
Research program in experimental high energy physics, Task B
International Nuclear Information System (INIS)
Widgoff, M.
1990-01-01
Two prototype tracking system modules of the LVD detector have been produced by the direct-mount method and tested. The direct-mount procedure was proposed by a subgroup (mainly US) of the LVD Collaboration. This method has the advantages over the previous (hood) design of greater signal-to-noise ratio, of providing spacing between the two streamer chamber layers of each tracking plane to improve track reconstruction and angular resoluation, economy and speed of production. The tests have shown very satisfactory performance, both of the mechanical aspects and of the read-out electronic which are principally Brown's responsibility. The Collaboration has agreed to proceed with production by this method. The full boot node data acquisition computer and one tower microvax, both provided by the Brown group, have been installed Hall A of Gran Sasso, where data acquisition development will proceed. FNAL Experiment E782, a study of the interactions of muons from the Tevatron, using an upgraded version of the E745 hybrid system, is now running at Fermilab. During the past year, film analysis of the 1987 run of E745, a study of the interactions of muon neutrinos, was essentially completed and a data summary tape is being produced. Also during the past year, analysis has continued both on the data of our experiments on interactions of hadrons with protons and heavier nuclei (FNAL E565, E570, E299, E154) and on the data of SLAC experiments BC72/73/75, studying the interactions in hydrogen of 20GeV/c photons
Long-baseline neutrino oscillation experiments
International Nuclear Information System (INIS)
Crane, D.; Goodman, M.
1994-01-01
There is no unambiguous definition for long baseline neutrino oscillation experiments. The term is generally used for accelerator neutrino oscillation experiments which are sensitive to Δm 2 2 , and for which the detector is not on the accelerator site. The Snowmass N2L working group met to discuss the issues facing such experiments. The Fermilab Program Advisory Committee adopted several recommendations concerning the Fermilab neutrino program at their Aspen meeting immediately prior to the Snowmass Workshop. This heightened the attention for the proposals to use Fermilab for a long-baseline neutrino experiment at the workshop. The plan for a neutrino oscillation program at Brookhaven was also thoroughly discussed. Opportunities at CERN were considered, particularly the use of detectors at the Gran Sasso laboratory. The idea to build a neutrino beam from KEK towards Superkamiokande was not discussed at the Snowmass meeting, but there has been considerable development of this idea since then. Brookhaven and KEK would use low energy neutrino beams, while FNAL and CERN would plan have medium energy beams. This report will summarize a few topics common to LBL proposals and attempt to give a snapshot of where things stand in this fast developing field
Exploring non standard physics in long-baseline neutrino oscillation experiments
International Nuclear Information System (INIS)
Chatterjee, Sabya Sachi
2015-01-01
After the recent discovery of large th ( 13), the focus has been shifted to address the remaining fundamental issues like neutrino mass ordering and CP-violation in leptonic sector. Future proposed Long-Baseline facilities like DUNE (1300 km baseline from FNAL to Homestake) and LBNO (2290 km baseline from CERN to Pyhasalmi) are well suited to address these issues at high confidence level. Not only to the standard framework, these experiments are highly capable to look for some new physics beyond the Standard Model scenario. In this work, we explore whether these high precision future facilities are sensitive to new U(1) global symmetries and upto which confidence level. (author)
What do passwords and toothbrushes have in common?
Computer Security Team
2011-01-01
Your password is your entry token into the digital world. eBay, Amazon, Facebook, Twitter, FNAL, DESY, and CERN - all ask you for a password to authenticate and prove that you are you. And vice versa. If I know your password, I can impersonate you and use your money to buy from eBay or Amazon, post nasty messages on your Twitter or Facebook profile, or misuse CERN's/DESY's/FNAL's computing facilities in your name! CERN accounts have been compromised in the past and misused to send spam across the world. Are you keen to delete tens of thousands of return e-mails from your mailbox? It's no fun. Would you give me your UBS bankcard and its PIN number? Of course not! Please apply the same sensitivity to your digital credentials, i.e. passwords, SSH keys, certificates, CERN card, etc. Beware of attempts to "steal" your password. CERN's computing staff, including the Computer Security Team, will never ask for your password (nor will any other legitimate person at Facebook, FNAL, eBay...
e-Learning Continuance Intention: Moderating Effects of User e-Learning Experience
Lin, Kan-Min
2011-01-01
This study explores the determinants of the e-learning continuance intention of users with different levels of e-learning experience and examines the moderating effects of e-learning experience on the relationships among the determinants. The research hypotheses are empirically validated using the responses received from a survey of 256 users. The…
Remote Monitoring of the Polarized Target's Control for E1039
Fox, David; SeaQuest Collaboration
2017-09-01
The 1039 experiment at FNAL will further our understanding of spin structure by measuring the contribution that sea quarks orbital angular momentum provide to overall nucleon spin. It is accepted that the valence-quarks of nucleons only provide 30% of the total nucleon spin. To study the nucleon's sea quark contribution, E1039 will use the Drell-Yan process by colliding 120 GeV un-polarized beam protons with polarized ammonia targets of hydrogen and deuterium. The asymmetric spin distributions of resulting dimuons will be measured. These asymmetries are sensitive, among other effects, to the orbital angular momentum contribution of the sea quarks. The polarized target requires a multi-stage vacuum pump located near the target. Since access to its present controls will not be possible during running, remote control and monitoring upgrades were required. A secondary control panel was purchased and tested. Information from the programmable logic controller (PLC) must be fed into our data stream to enable remote monitoring and to signal possible alarm conditions. This solution and the program created using explicit TCP/IP messaging to extract data tags from the PLC and log it within our databases will be presented. Supported by U.S. D.O.E. Medium Energy Nuclear Physics under Grant DE-FG02-03ER41243.
E-Learning Experiences of Hong Kong Students
J. Lam; R. Chan
2013-01-01
The adoption of e-learning in Hong Kong has been increasing rapidly in the past decade. To understand the e-learning experiences of the students, the School of Professional and Continuing Education of The University of Hong Kong conducted a survey. The survey aimed to collect students- experiences in using learning management system, their perceived e-learning advantages, barriers in e-learning and preferences in new e-learning development. A questionnaire with 84 questio...
Measurements of Neutrino Charged Current Interactions at SciBooNE
Energy Technology Data Exchange (ETDEWEB)
Nakajima, Yasuhiro [Department of Physics, Kyoto University, Kyoto 606-8502 (Japan)], E-mail: nakajima@scphys.kyoto-u.ac.jp
2009-08-15
The SciBooNE experiment (FNAL-E954) is designed to measure neutrino-nucleous cross sections in the one GeV region. Additionally, SciBooNE serves as a near detector for MiniBooNE by measuring the neutrino flux. In this paper, we describe two analyses using neutrino charged current interactions at SciBooNE: a neutrino spectrum measurement and a search for charged current coherent pion production.
Electronic Collaboration Logbook
CERN. Geneva
2012-01-01
At FNAL, we developed an Electronic Collaboration Logbook (ECL) application which is used by about 20 different collaborations, experiments and groups at FNAL. ECL is the latest iteration of the project formerly known as Control Room Logbook (CRL). We have been working on mobile (IOS and Android) clients for ECL. We will present history, current status and future plans of the project, as well as design, implementation and support solutions made by the project.
Progress report of a research program in experimental high energy physics
International Nuclear Information System (INIS)
Widgoff, M.
1991-01-01
The LVD Collaboration has made major progress during the past year in constructing the basic modules of the detector and installing them in five-tower LVD structure. Each of these modules consists of a portatank containing eight liquid scintillation counters (each 1.0m x 1.0m x 1.5m, viewed by three photomultipliers) totalling 9.6 tons of liquid scintillator and 6.7 tons of steel. Each portatank is covered on its bottom and one side by two layers of limited streamer tubes which form the tracking system of the detector. About half of the first tower has now been installed and initial data-taking with the entire tower is expected to being during the Fall of 1991. Data acquisition hardware and software are in place for this. The data-taking run of FNAL Experiment E782, a study of the interactions of 200 GeV muons in a hybrid system with the Tohoku Freon bubble chamber as visible target, was completed in August 1990. Film analysis is now in progress. The results will be readily comparable to those obtained in FNAL Experiment E745, a study of the interactions of muon neutrinos in a similar system. The film analysis of E745 has been completed, and some preliminary results are presented on the production of strange particles, based on the combined data of both the 1985 and 1987 runs of this experiment
Thermodynamic properties of crystalline Sr0.5Zr2(PO4)3 phosphate from T → 0 to 665 K
International Nuclear Information System (INIS)
Pet'kov, V.I.; Markin, A.V.; Bykova, T.A.; Sukhanov, M.V.; Smirnova, N.N.; Loshkarev, V.N.
2007-01-01
The temperature dependence of the heat capacity of crystalline Sr 0.5 Zr 2 (PO 4 ) 3 phosphate was studied by precision adiabatic vacuum and dynamic scanning calorimetry over the temperature range 7-665 K. The low-temperature dependence of the heat capacity was analyzed using the Debye theory of the heat capacity of solids and its multifractal generalization, which allowed conclusions to be drawn about the heterodynamic characteristics of the structure. The experimental data obtained were used to calculate the standard thermodynamic functions of Sr 0.5 Zr 2 (PO 4 ) 3 from T → 0 to 665 K. The standard absolute entropy of Sr 0.5 Zr 2 (PO 4 ) 3 was in turn used to calculate the standard entropy of its formation from simple substances at 298.15 K [ru
Study of a transition radiation detector for the DO experiment at FNAL
International Nuclear Information System (INIS)
Feinstein, F.
1988-06-01
The DZero experiment will study proton-antiproton collisions at 1.8 TeV in the center of mass produced at Fermi National Accelerator Laboratory (USA). The main features of the detector are an excellent hermetical calorimeter and a very good identification of muons and electrons. The Transition Radiation Detector contributes to electron/jet discrimination. Transition radiation is emitted when a charge particle crosses the interface between two media of different refraction indices. A N foils radiator produces about N/137 soft X rays when the Lorentz factor gamma of the particle is greater than a threshold of the order of 1000. The radiated energy saturates when gamma goes to infinity. These properties allow to separate electrons from pions until 140 GeV. This study presents the results of a test on a 5 GeV electron and pion beam of a prototype of chamber and of three radiators made of lithium foils, polypropylene foils, and polyethylene fibers. The detector response to pions and electrons is compared to theoretical predictions. Different statistical methods of electron/pion separation are compared on the experimental data. A method has been performed using likelihood functions which obtains a pion rejection greater than 50 for an electron efficiency of 90%. The performances are compared to those of other TRDs [fr
On-line experience with the 168/E
International Nuclear Information System (INIS)
Carroll, J.T.; Brau, J.E.; Maruyama, T.; Parker, D.B.; Chima, J.S.; Price, D.R.; Rankin, P.; Hatley, R.W.
1981-04-01
Current 20 GeV/c photoproduction experiments at the SLAC Hybrid Facility require a decision to take a picture within 150 to 300 μs after the beam pulse. A charged track trigger is provided by a 168/E processor which finds tracks in a downstream PWC system. To meet trigger time requirements the 168/E SNOOP module CAMAC interface is augmented by a CAMAD Auxiliary Controller and dedicated I/0 cards in the 168/E chassis. Between beam pulses a floating point Fortran program executing on a 168/E monitors data acquisition. Experiences with software development and application are reviewed
Nuclear dependence of Drell-Yan and J/ψ production in FNAL E866
International Nuclear Information System (INIS)
Tribble, R.E.; Beddo, M.E.; Brown, C.N.; Carey, T.A.; Chang, T.H.; Cooper, W.E.; Gagliardi, C.A.; Garvey, G.T.; Geesaman, D.F.; Hawker, E.A.; He, X.C.; Isenhower, L.D.; Kaufman, S.B.; Kaplan, D.M.; Koetke, D.D.; Lee, W.M.; Leitch, M.J.; McGaughey, P.L.; Moss, J.M.; Mueller, B.A.; Papavassiliou, V.; Peng, J.C.; Petitt, G.; Reimer, P.E.; Sadler, M.E.; Stankus, P.W.; Sondheim, W.E.; Towell, R.S.; Vasiliev, M.A.; Webb, J.C.; Willis, J.L.; Young, G.R.
2000-01-01
Fermilab E866 has measured the target-mass dependence of Drell-Yan and J/ψ dimuon production induced by an 800 GeV proton beam on targets of Be, Fe and W. Clear evidence of nuclear shadowing is observed in the Drell-Yan cross section ratios per nucleon at small x 2 . The x 1 dependence of the cross section ratios provides a determination of the energy loss of ultra-relativistic quarks as they pass through cold nuclei. Preliminary results for J/ψ yields show maximum cross section ratios that are slightly less than 1 at an x F value near 0.1. The yield on heavy targets is much more strongly suppressed relative to light targets at larger values of x F
A cosmic ALP background and the cluster soft X-ray excess in A665, A2199 and A2255
Energy Technology Data Exchange (ETDEWEB)
Powell, Andrew J., E-mail: Andrew.Powell2@physics.ox.ac.uk [Rudolf Peierls Centre for Theoretical Physics, University of Oxford, 1 Keble Road, Oxford, OX1 3NP (United Kingdom)
2015-09-01
It has been proposed that an excess in soft X-ray emission observed from many galaxy clusters can be explained by conversion into photons of axion-like particles (ALPs) in the cluster's magnetic field. Previously it has been shown that conversion of this primordially-generated background of relativistic ALPs—a cosmic ALP background (CAB)—can explain the observed soft X-ray excess in both the centre and the outskirts of the Coma cluster. Here we extend this work to the three clusters A665, A2199 and A2255. We use a stochastic, power law model of the cluster magnetic field to numerically calculate ALP-photon conversion probabilities to predict the CAB-generated soft X-ray flux in these clusters. The simulated magnetic fields include models with non-standard (i.e. not turbulent Kolmogorov) power spectra, the index of the spectrum changes from cluster to cluster and even within the cluster A2255. We compare this flux to ROSAT PSPC observations of the three clusters, and use these observations to constrain the CAB parameter space. Assuming these non-standard magnetic field power spectra are valid, we find the CAB can reproduce the magnitude of the observed excess in A2199 and A2255 for the same CAB parameters that match the observed soft excess in the Coma cluster. We also find good fit to the morphology of the excesses in these clusters. Simulation of CAB conversion in the cluster A665 is in mild tension with the other clusters due to producing a small but observable excess at large radii where none is observed. This tension is alleviated considering the uncertainty on predicting the count rate in the ROSAT detector, and on the systematics affecting the magnetic field determination. Overall we find good agreement between the CAB parameters for the four clusters studied so far.
A cosmic ALP background and the cluster soft X-ray excess in A665, A2199 and A2255
International Nuclear Information System (INIS)
Powell, Andrew J.
2015-01-01
It has been proposed that an excess in soft X-ray emission observed from many galaxy clusters can be explained by conversion into photons of axion-like particles (ALPs) in the cluster's magnetic field. Previously it has been shown that conversion of this primordially-generated background of relativistic ALPs—a cosmic ALP background (CAB)—can explain the observed soft X-ray excess in both the centre and the outskirts of the Coma cluster. Here we extend this work to the three clusters A665, A2199 and A2255. We use a stochastic, power law model of the cluster magnetic field to numerically calculate ALP-photon conversion probabilities to predict the CAB-generated soft X-ray flux in these clusters. The simulated magnetic fields include models with non-standard (i.e. not turbulent Kolmogorov) power spectra, the index of the spectrum changes from cluster to cluster and even within the cluster A2255. We compare this flux to ROSAT PSPC observations of the three clusters, and use these observations to constrain the CAB parameter space. Assuming these non-standard magnetic field power spectra are valid, we find the CAB can reproduce the magnitude of the observed excess in A2199 and A2255 for the same CAB parameters that match the observed soft excess in the Coma cluster. We also find good fit to the morphology of the excesses in these clusters. Simulation of CAB conversion in the cluster A665 is in mild tension with the other clusters due to producing a small but observable excess at large radii where none is observed. This tension is alleviated considering the uncertainty on predicting the count rate in the ROSAT detector, and on the systematics affecting the magnetic field determination. Overall we find good agreement between the CAB parameters for the four clusters studied so far
Tecnologia, experiência e memória
Directory of Open Access Journals (Sweden)
Aécio Amaral Jr
2006-10-01
Full Text Available O artigo investiga a estruturação de uma nova cultura de memória, a qual inverte a lógica metafísica com que se pensou a relação entre tecnologia e experiência nas ciências sociais. Com as recentes tecnologias da vida e da informação, a concepção do corpo humano como algo que se constitui à margem de um aparato tecnológico declina em credibilidade. Com isso, um dos principais projetos da metafísica ocidental, a saber, a estruturação de um campo de experiência e conhecimento livre de suportes técnicos, malogra em seu humanismo tecnofóbico. A partir de uma apreciação do conto Memento Mori, de Jonathan Nolan, e do filme Amnésia, de Christopher Nolan, analiso a relação entre memória e escritura, corpo e arquivo na contemporaneidade. O objetivo é perceber as tensões e oscilações implícitas na tentativa de instauração de uma mnemotécnica pretensamente pós-humana ou pós-orgânica. Palavras-chave: tecnologia; experiência; memória; humanismo; pós-humanismo.
Mu2e, a coherent μ → e conversion experiment at Fermilab
International Nuclear Information System (INIS)
Brown, D. N.
2012-01-01
We describe a proposed experiment to search for Charged Lepton Flavor Violation (CLFV) using stopped muons at Fermilab. A primary Proton beam will strike a gold target, producing pions which decay to muons. Low-momentum negative muons will be collected, selected, and transported by a custom arrangement of solenoidal magnets and collimators. Muons will stop in thin foil targets, creating muonic atoms with significant nuclear overlap. Mu2e will search for the coherent conversion of nuclear bound muons to electrons, with an experimental signature of a single mono-energetic electron. Conversion electrons will be detected and measured in a low-mass straw tracker and a crystal calorimeter. Mu2e will have a sensitivity four orders of magnitude better than the most sensitive published result for μ → e conversion, and will have complementary physics reach to LHC experiments and μ → eγ decay experiments such as MEG.
Making a Case for E - learning: Experiences in E-learning at ...
African Journals Online (AJOL)
Making a Case for E - learning: Experiences in E-learning at Langston University ... performances can surpass those of students in traditional learning settings. ... The research method was qualitative based mainly on participatory and ...
BNL workshop on rare K decays and CP violation, August 25-27, 1988
International Nuclear Information System (INIS)
1988-10-01
This report contains viewgraphs on the following topics: rare and forbidden K decays; CP violation in the K system; the status of current experiments at BNL, CERN, FNAL, and KEK; and future experiments and facilities
Antropologia e filosofia: estética e experiência em Clifford Geertz e Walter Benjamin
Directory of Open Access Journals (Sweden)
Relivaldo Pinho de Oliveira
2012-06-01
Full Text Available Este artigo estuda as concepções de estética e experiência de Clifford Geertz e Walter Benjamin como possibilidades argumentativas e metodológicas para pensar a realidade e suas formas estéticas. Utiliza-se para isso as discussões metodológicas de Geertz, especialmente a respeito do lugar da estética e de sua relação com os demais âmbitos do humano, que encetaram uma nova forma de concebê-los para a etnografia e antropologia de modo geral, e os estudos de Benjamin a respeito da estética como expressão fisionômica de uma época, de determinada realidade, especialmente os que se referem sobre a modernidade. Constata-se essa possibilidade a partir da observação de que a estética e a experiência, nos autores, são tomadas como dimensões da realidade que se relacionam, não de modo mecânico, e sim como âmbitos que atravessam a realidade, os artefatos estéticos, os discursos, e esses assim devem ser observados.This article study the conceptions of aesthetics and experience of Clifford Geertz and Walter Benjamin as argumentative and methodological possibilities for thinking reality and its aesthetic forms. Uses for this Geertz's methodological discussions, especially regarding the place of aesthetics and its relation to other spheres of the human, which has embarked on a new way of conceiving them to ethnography and anthropology in general, and studies Benjamin about the aesthetics and physiognomical expression of an era, a certain reality, especially those concerning about modernity. There is that possibility from the observation that the aesthetics and experience, in the authors, are taken as the dimensions of reality are related, not mechanically, but as areas that cross the reality, the aesthetic artifacts, the speeches, and so these must be observed.
Experience Effect in E-Learning Research
Wu, Bing; Xu, WenXia; Ge, Jun
This study is a productivity review on the literature gleaned from SSCI, SCIE databases concerning experience in E-Learning research. The result indicates that the number of literature productions on experience effect in ELearning research is still growing from 2005. The main research development country is Croatia, and from the analysis of the publication year, the number of papers is increasing to the peaking in 2010. And the main source title is British Journal of Educational Technology. In addition the subject area concentrated on Education & Educational Research. Moreover the research focuses on are mainly survey research and empirical research, in order to explore experience effect in E-Learning research. Also the limitations and future research of these research were discussed, so that the direction for further research work can be exploited
Particle searches in e+e- experiments at PEP and PETRA
International Nuclear Information System (INIS)
Lau, K.H.
1982-10-01
This talk reviews recent results in new particle searches performed by experiments at the high energy e + e - storage rings PEP and PETRA. It concentrates on recent searches for: hadrons with a new quark flavor, spin-1/2 charged heavy leptons, spin-0 charged leptons, spin-0 point-like scalars or pseudoscalars, and neutral heavy leptons
Conectividade e Informação: Usabilidade e Mobilidade orientada para User Experience
Directory of Open Access Journals (Sweden)
Antonio Mendes Silva Filho
2012-08-01
Full Text Available Tempo é o bem mais precioso que todo ser humano pode possuir, inclusive para aqueles que pensam nada ter. Adicionalmente, o livre arbítrio de cada ser lhe permite escolher como utilizar esse bem precioso. O ser humano quando envolvido em atividades profissionais ou de lazer buscam otimizar o uso de tempo, que é propiciada pela facilidade através da qual ele(a consegue realizar a atividade. E, se para realizar a atividade, ele requer uso de tecnologias como computador, notebook, iGadgets (como, por exemplo, iPad, iPhone e iPod, TV, DVD player, dentre outros, essa facilidade é oferecida pela usabilidade do produto. Isso é determinante no momento que usuário vai escolher um produto. Preocupar-se com o usuário e prover ele com um produto que tem simplicidade, eficiência e elegância é prover suporte à experiência do usuário. Nesse sentido, este artigo explora e discute como a experiência do usuário (user experience e usabilidade impactam uso e adoção de novas tecnologias.
Complete (γ,2e) experiments at 0.1 eV above threshold
International Nuclear Information System (INIS)
Rond, F.; Mazeau, J.; Huetz, A.
1999-01-01
Here we report on a new experiment which has been designed to perform (γ,2e) experiments extremely close to threshold, in an energy range which is inaccessible to conventional electron analysers. The angular and energy resolutions of this new technique are illustrated by measuring electrons issued from resonant single ionization of argon. First results on double ionization of argon for the 3p 4 3 P e J=2 final state of Ar ++ are also presented. The contribution of an indirect process producing 20 meV Auger electrons, which was suspected from previous experiments, is clearly observed in addition to the direct process. (orig.)
[Experimental and theoretical high energy physics program
Energy Technology Data Exchange (ETDEWEB)
Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.
1993-04-01
Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac{endash}Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e{sup +}e{sup {minus}} collisions at CERN; {bar p}{endash}p collisions at FNAL; accelerator physics at Fermilab; development work for the SDC detector at SSC; TOPAZ; D-zero physics; physics beyond the standard model; and the Collider Detector at Fermilab. (RWR)
[Experimental and theoretical high energy physics program
International Nuclear Information System (INIS)
Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.
1993-04-01
Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac endash Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e + e - collisions at CERN; bar p endash p collisions at FNAL; accelerator physics at Fermilab; development work for the SDC detector at SSC; TOPAZ; D-zero physics; physics beyond the standard model; and the Collider Detector at Fermilab
International Nuclear Information System (INIS)
Overseth, O.
1977-01-01
The discussion of the lambda anti lambda beams involves how to make polarized protons from lambda decay so that experiments on polarization at very high energies may be possible. The aspect studied is the amount of polarization and how to get it
Observation of the rare {eta}{yields}e{sup +}e{sup -}e{sup +}e{sup -} decay with the KLOE experiment
Energy Technology Data Exchange (ETDEWEB)
Ambrosino, F. [Dipartimento di Scienze Fisiche dell' Universita ' Federico II' , Napoli (Italy); INFN Sezione di Napoli, Napoli (Italy); Antonelli, A.; Antonelli, M. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Archilli, F. [Dipartimento di Fisica dell' Universita ' Tor Vergata, Roma (Italy); INFN Sezione di Roma Tor Vergata, Roma (Italy); Balwierz, I. [Institute of Physics, Jagiellonian University, Krakow (Poland); Bencivenni, G. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Bini, C. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy); Bloise, C. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Bocchetta, S. [Dipartimento di Fisica dell' Universita ' Roma Tre' , Roma (Italy); INFN Sezione di Roma Tre, Roma (Italy); Bossi, F. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Branchini, P. [INFN Sezione di Roma Tre, Roma (Italy); Capon, G.; Capussela, T. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Ceradini, F. [Dipartimento di Fisica dell' Universita ' Roma Tre' , Roma (Italy); INFN Sezione di Roma Tre, Roma (Italy); Ciambrone, P.; Czerwinski, E.; De Lucia, E. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); De Santis, A. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy); De Simone, P. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); De Zorzi, G. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy)
2011-08-26
We report the first observation of the rare {eta}{yields}e{sup +}e{sup -}e{sup +}e{sup -}({gamma}) decay based on 1.7 fb{sup -1} collected by the KLOE experiment at the DA{Phi}NE {phi}-factory. The selection of the e{sup +}e{sup -}e{sup +}e{sup -} final state is fully inclusive of radiation. We have identified 362{+-}29 events resulting in a branching ratio of (2.4{+-}0.2{sub stat}+bckg{+-}0.1{sub syst})x10{sup -5}.
Diffractively Produced Charm Final States in 800-GeV/c pp Collisions
Wang, M. H.; Berisso, M. C.; Christian, D. C.; Félix, J.; Gara, A.; Gottschalk, E.; Gutiérrez, G.; Hartouni, E. P.; Knapp, B. C.; Kreisler, M. N.; Lee, S.; Markianos, K.; Moreno, G.; Reyes, M. A.; Sosa, M.; Wehmann, A.; Wesson, D.
2001-08-01
We report the first observation of diffractively produced open charm in 800-GeV/c pp collisions of the type pp-->pD*X. We measure cross sections of σdiff(D*+) = (0.185+/-0.044+/-0.054) μb and σdiff(D*-) = (0.174+/-0.034+/-0.029) μb. Our measurements are based on 4.3×109 events recorded by FNAL E690 in the fixed-target run of 1991. We compare our results with previous fixed-target charm experiments.
Study of the decay D0 --> K+pi-.
Link, J M; Reyes, M; Yager, P M; Anjos, J C; Bediaga, I; Göbel, C; Magnin, J; Massafferi, A; de Miranda, J M; Pepe, I M; dos Reis, A C; Simão, F R; Carrillo, S; Casimiro, E; Sánchez-Hernández, A; Uribe, C; Vazquez, F; Cinquini, L; Cumalat, J P; O'Reilly, B; Ramirez, J E; Vaandering, E W; Butler, J N; Cheung, H W; Gaines, I; Garbincius, P H; Garren, L A; Gottschalk, E; Kasper, P H; Kreymer, A E; Kutschke, R; Bianco, S; Fabbri, F L; Sarwar, S; Zallo, A; Cawlfield, C; Kim, D Y; Rahimi, A; Wiss, J; Gardner, R; Chung, Y S; Kang, J S; Ko, B R; Kwak, J W; Lee, K B; Park, H; Alimonti, G; Boschini, M; Caccianiga, B; D'Angelo, P; DiCorato, M; Dini, P; Giammarchi, M; Inzani, P; Leveraro, F; Malvezzi, S; Menasce, D; Mezzadri, M; Milazzo, L; Moroni, L; Pedrini, D; Pontoglio, C; Prelz, F; Rovere, M; Sala, A; Sala, S; Davenport, T F; Agostino, L; Arena, V; Boca, G; Bonomi, G; Gianini, G; Liguori, G; Merlo, M; Pantea, D; Ratti, S P; Riccardi, C; Segoni, I; Viola, L; Vitulo, P; Hernandez, H; Lopez, A M; Mendez, H; Mendez, L; Mirles, A; Montiel, E; Olaya, D; Paris, A; Quinones, J; Rivera, C; Xiong, W; Zhang, Y; Wilson, J R; Cho, K; Handler, T; Engh, D; Hosack, M; Johns, W E; Nehring, M S; Sheldon, P D; Stenson, K; Webster, M S; Sheaff, M
2001-04-02
Using a large sample of photoproduced charm mesons from the FOCUS experiment at Fermilab (FNAL-E831), we observe the decay D0-->K+pi- with a signal yield of 149+/-31 events compared to a similarly cut sample consisting of 36 760+/-195 D0-->K-pi+ events. We use the observed ratio of D0-->K+pi- to D0-->K-pi+ (0.404+/-0.085+/-0.025)% to obtain a relationship between the D0 mixing and doubly Cabibbo suppressed decay parameters.
Study of the Decay D0 --> K+π-
Link, J. M.; Reyes, M.; Yager, P. M.; Anjos, J. C.; Bediaga, I.; Göbel, C.; Magnin, J.; Massafferi, A.; de Miranda, J. M.; Pepe, I. M.; Dos Reis, A. C.; Simão, F. R.; Carrillo, S.; Casimiro, E.; Sánchez-Hernández, A.; Uribe, C.; Vazquez, F.; Cinquini, L.; Cumalat, J. P.; O'Reilly, B.; Ramirez, J. E.; Vaandering, E. W.; Butler, J. N.; Cheung, H. W.; Gaines, I.; Garbincius, P. H.; Garren, L. A.; Gottschalk, E.; Kasper, P. H.; Kreymer, A. E.; Kutschke, R.; Bianco, S.; Fabbri, F. L.; Sarwar, S.; Zallo, A.; Cawlfield, C.; Kim, D. Y.; Rahimi, A.; Wiss, J.; Gardner, R.; Chung, Y. S.; Kang, J. S.; Ko, B. R.; Kwak, J. W.; Lee, K. B.; Park, H.; Alimonti, G.; Boschini, M.; Caccianiga, B.; D'Angelo, P.; Dicorato, M.; Dini, P.; Giammarchi, M.; Inzani, P.; Leveraro, F.; Malvezzi, S.; Menasce, D.; Mezzadri, M.; Milazzo, L.; Moroni, L.; Pedrini, D.; Pontoglio, C.; Prelz, F.; Rovere, M.; Sala, A.; Sala, S.; Davenport, T. F.; Agostino, L.; Arena, V.; Boca, G.; Bonomi, G.; Gianini, G.; Liguori, G.; Merlo, M.; Pantea, D.; Ratti, S. P.; Riccardi, C.; Segoni, I.; Viola, L.; Vitulo, P.; Hernandez, H.; Lopez, A. M.; Mendez, H.; Mendez, L.; Mirles, A.; Montiel, E.; Olaya, D.; Paris, A.; Quinones, J.; Rivera, C.; Xiong, W.; Zhang, Y.; Wilson, J. R.; Cho, K.; Handler, T.; Engh, D.; Hosack, M.; Johns, W. E.; Nehring, M. S.; Sheldon, P. D.; Stenson, K.; Webster, M. S.; Sheaff, M.
2001-04-01
Using a large sample of photoproduced charm mesons from the FOCUS experiment at Fermilab (FNAL-E831), we observe the decay D0-->K+π- with a signal yield of 149+/-31 events compared to a similarly cut sample consisting of 36 760+/-195 D0-->K-π+ events. We use the observed ratio of D0-->K+π- to D0-->K-π+ \\(0.404+/-0.085+/-0.025\\)% to obtain a relationship between the D0 mixing and doubly Cabibbo suppressed decay parameters.
Directory of Open Access Journals (Sweden)
Anelise Henrich Crestani
2012-04-01
Full Text Available TEMA: a experiência da maternidade e dialogia mãe-filho com distúrbio de linguagem. PROCEDIMENTOS: o objetivo de investigar as possíveis relações entre a constituição da experiência da maternidade e a dialogia mãe-filho com distúrbio de linguagem. A amostra desta pesquisa foi constituída por 4 crianças, entre 2 e 4 anos, com distúrbio de linguagem, e suas mães. As mães foram submetidas a uma entrevista semi-estruturada acerca da experiência materna e a possibilidade de a mesma ter passado por alterações emocionais tais como a depressão e/ou ansiedade. Coletou-se uma interação mãe-filho, e em um caso avó-neta, através da filmagem da díade em atividade lúdica para analisar o modo como a dialogia e a interação aconteciam na díade. RESULTADOS: demonstraram que as quatro crianças estiveram sujeitas a interações com mães e avó com índices de ansiedade (dois casos e depressão (dois casos. Apenas uma mãe não possuía tais índices e esta possuía dialogia adequada com a filha. CONCLUSÃO: os dados demonstraram relações entre a dialogia mãe-filho e a experiência materna. Houve distinções na dialogia e no brincar relacionados aos estados emocionais das mães e, em um caso, da avó.BACKGROUND: the maternal experience and language impairment mother-child dialogics. PROCEDURES: the aim was to research the possible relations between maternal experience and mother-child dialogics, in language impairment children cases. The sample was made up with four children, between two and four year old with language impairment and their mothers.The mothers answered a semi-structured interview about the maternal experience and possible mothers' emotional signs like anxiety and depression. The pairs engaged in interaction were videotaped in order to interpret the mother's speech, in one case grand-mother, and the interaction process. RESULTS: the results showed that the children were in interactions with mothers and a grandmother
Theoretical and experimental studies of elementary physics
International Nuclear Information System (INIS)
Bodek, A.; Ferbel, T.; Melissinos, A.C.; Olsen, S.; Slattery, P.; Tipton, P.; Das, A.; Hagen, C.R.; Rajeev, S.G.; Okubo, S.
1992-01-01
The experimental high energy physics program is directed toward the execution of experiments that probe the basic constituents of matter and the forces between them. These experiments are carried out at national and international accelerator facilities. At the current time, we are primarily concentrating on the following projects: Direct photon production in hadronic reactions (Fermilab E706); Production of hybrid mesons in the nuclear Coulomb field; The D-Zero experiment at the Tevatron collider; Deep inelastic neutrino- and electron-nucleon scattering at FNAL and SLAC; Nonlinear QED at critical field strengths at SLAC; The Experiments at KEK (AMY, 17keV neutrino); The CDF experiment at the Tevatron collider; and SSC-related detector R ampersand D on scintillating tile- and diamond-based calorimetry and microstrip tracking detectors
Event structures in large psub(T) hadron-hadron collisions
International Nuclear Information System (INIS)
Boeggild, H.
1977-01-01
Recent large psub(T) experimental results are reviewed with a special emphasis on high energy pp experiments at FNAL and ISR. Some theoretical approaches with a considerable success are discussed. (Auth.)
Macrorrealismo fenomenológico e campos-experiência
Directory of Open Access Journals (Sweden)
Renato Schaeffer
1995-01-01
Full Text Available Este artigo critica a concepção predominante, representacionista-neurofisicalista sobre a percepção sensorial. Introduz a noção de "campo-experiência" na tentativa de tratamento ontológico dos dados fenomenológicos da experiência. A idéia geral é que a experiência visual, por exemplo, seria ontologicamente algo assim como um campo-experiência de intencionalidade visual, que se estende por sobre e entre o sistema nervoso central do sujeito da experiência e o objeto distai da visão. Chamo esta posição de macrorrealismo fenomenológico, em contraste com o microrrealismo científico. Qualidades da fenomenalidade não estão subjetivamente dentro do cérebro, mas objetivamente dentro de campos-experiência perceptuais extra-encefálicos, ou, como dizemos, lá fora no mundo. Algumas conseqüências específicas do macrorrealismo fenomenológico são apresentadas.
Directory of Open Access Journals (Sweden)
Kathleen Schreurs
2013-12-01
Full Text Available Children’s e-books waited to emerge until technology could support their advanced requirements. Recent technologies such as colour e-readers and tablets like Apple’s iPad provide support for heavy visual content and opportunities for interactivity. E-books for children have grown in availability and popularity and now include puzzles, games, music, video, and audio features that boost narratives and create a unique reading experience that is further from print than ever before. This article positions e-books for children as leaders in e-book development. It reviews concepts, practices, and scholarship in the area of e-books for children and highlights issues with definitions and research caused by the rapid growth of enhanced and interactive e-books. There is little argument among scholars and practitioners that the reading experience is changing, and the new generation of readers may have different opinions, assumptions, and preferences for the meanings of ‘book’ and ‘reading’. Managing these shifts in the reading experience, which is still strongly tied to notions from print culture, is an important role for LIS scholars, librarians, educators, and parents. Recent research on e-books for children focuses largely on literacy and education. Little attention has been paid to if and why children enjoy the e-reading experience. Additionally, the majority of current research examines children’s e-reading from an adult perspective with most surveys and interviews consulting parent participants and not children. An examination of relevant research as well as literature on the history and conceptualization of e-books and reading as an evolving experience reveals that, from new technologies to new experiences and new definitions, e-books for children are pushing toward the future of reading.
Manufacturing experience for the LHC inner triplet quadrupole cables
Scanlan, R M; Bossert, R; Kerby, J S; Ghosh, A K; Boivin, M; Roy, T
2002-01-01
The design for the U.S. LHC Inner Triplet Quadrupole magnet requires a 37 strand (inner layer) and a 46 strand (outer layer) cable. This represents the largest number of strands attempted to date for a production quantity of Rutherford-type cable. The cable parameters were optimized during the production of a series of short prototype magnets produced at FNAL. These optimization studies focused on critical current degradation, dimensional control, coil winding, and interstrand resistance. After the R&D phase was complete, the technology was transferred to NEEW and a new cabling machine was installed to produce these cables. At present, about 60 unit lengths, out of 90 required for the entire production series of magnets, have been completed for each type of cable. The manufacturing experience with these challenging cables will be reported. Finally, the implications for even larger cables, with more strands, will be discussed. (8 refs).
Experimental Tests of the Standard Model for Particles and Nuclei
Energy Technology Data Exchange (ETDEWEB)
Stanislaus, Shirvel [Valparaiso Univ., IN (United States); Manweiler, Robert [Valparaiso Univ., IN (United States); Koetke, Donald [Valparaiso Univ., IN (United States)
2015-10-01
This report summarizes the research carried out by the faculty, staff and students of Valparaiso University (VU) during the 30-year period from 1986 to 2015 using funds provided by the Medium Energy Nuclear Physics program of the Department of Energy (DOE). Three faculty members led the VU research group during the lifetime of the research grant. The three principal investigators responsible for the research were: Dr. Donald Koetke (1986 – 2007), Dr. Robert Manweiler (2008 – 2010), and Dr. Shirvel Stanislaus (2011 – 2015). During this period we participated and contributed to the progress of the following experiments: 1. The MEGA Experiment at Los Alamos National Laboratory (LAMPF E969). 2. The Crystal Ball Experiment at Brookhaven National Laboratory (BNL/AGS E906, E913). 3. The NuSea Experiment at Fermilab (FNAL E866). 4. The TWIST Experiment at TRIUMF (TRIUMF E614). 5. The STAR Experiment at RHIC. 6. The nEDM Experiment at Oak Ridge National Laboratory. In the following sections we briefly describe the goals of the above experiments and the contributions made by the Valparaiso University personnel towards the progress of each project.
Results from the first cycle of the PWR crud deposition test (IFA-665.1)
International Nuclear Information System (INIS)
Bennett, Peter
2004-03-01
The main objective of IFA-665.1 is to deposit crud on fuel rods operating under PWR thermal-hydraulic and water chemistry conditions, and to measure the resulting power reduction due to incorporation of boron into the crud. The test has operated for 160 days at power. Water chemistry conditions were 3.15 ppm LiOH and 1400 ppm boron (pH 300 =7.0). The coolant inlet temperature was 290/294 C, with sub-cooled nucleate boiling along the upper half of the fuel bundle. This report presents the results from the first cycle of operation. Three methods have been used to attempt to accelerate crud formation: (i) injection of simulated crud particles (NiFe 2 O 4 ); (ii) pH transients (reduction of pH 300 from 7.0 to 6.0 for periods of 48 hours); and (iii) oxygen addition transients. While the pH transients resulted in movement of large amounts of corrosion products around the loop, no significant deposition onto the fuel surfaces was measured. Comparison of the heat fluxes in IFA-665 with those in previous tests in which crud deposition has occurred does not clearly identify reasons for the lack of crud formation, although it is noted that higher heat fluxes may be required. In addition, the relatively benign boiling conditions in the current test (small void fraction with no detached voidage) may partly explain the absence of crud formation. For the second cycle of the test, changes will be made to the water chemistry to attempt to increase the concentrations of dissolved and colloidal Fe and Ni in the test rig, such that a continuous (Fe + Ni) level of 100 ppb will be targeted, with short-term concentrations of colloids of up to 500 ppb. (Author)
Progress on the design of a data push architecture for an array of optimized time tagging pixels
International Nuclear Information System (INIS)
Shapiro, S.; Cords, D.; Mani, S.; Holbrook, B.; Atlas, E.
1993-06-01
A pixel array has been proposed which features a completely data driven architecture. A pixel cell has been designed that has been optimized for this readout. It retains the features of preceding designs which allow low noise operation, time stamping, analog signal processing, XY address recording, ghost elimination and sparse data transmission. The pixel design eliminates a number of problems inherent in previous designs, by the use of sampled data techniques, destructive readout, and current mode output drivers. This architecture and pixel design is directed at applications such as a forward spectrometer at the SSC, an e + e - B factory at SLAC, and fixed target experiments at FNAL
Open-Rate Controlled Experiment in E-Mail Marketing Campaigns
Directory of Open Access Journals (Sweden)
Antun Biloš
2016-06-01
Full Text Available Purpose – The main purpose of this paper is to test the controlled experiment (A/B split methodology in B2C oriented e-mail marketing campaigns. Design/Methodology/Approach – E-mail marketing techniques have been a substantial part of e-marketing methodology since the early Internet days of the mid-1990s. From the very beginning of Internet utilization for business purposes, e-mail was one of the most widely used communication techniques in B2B and B2C markets alike. Due to high volumes of spamming and progression of online communication clutter, some practitioners began to question the usability of e-mail as a marketing communication channel, while others embarked on working on improving the message itself. Efforts were invested into improving message quality, as well as into better understanding user expectations. One of the most commonly used techniques to test specific e-mail message elements is the controlled experiment. Findings and implications – This paper explores several types of controlled experiments in a specific Croatian B2C market. Tests were run to determine subscriber behavior towards several newsletter components, including sending time, sending day, sender’s name, and subject line. Open and click rates for tested campaigns, and several other metrics were investigated using MailChimp software. An N − 1 two-proportion test using an adjusted Wald confidence interval around the difference in the proportions was used for comparing the open-rate measure in the controlled experiments between subjects. Limitation – Controlled experiments (A/B split tests showed a lot of potential as a way of measuring behavior and preferences of subscribers, although several apparent limitations (the data-set scope, comparability issues indicated a clear need for standardization on a managerial and scientific level. Originality – This paper provides an up-to-date e-mail marketing effectiveness literature review, describes and tests the
E-36: First Proto-Megascience Experiment at NAL
Energy Technology Data Exchange (ETDEWEB)
Pronskikh, Vitaly S. [Fermilab
2016-03-01
E-36, an experiment on small angle proton-proton scattering, began testing equipment in the National Accelerator Laboratory’s newly achieved 100-GeV beam on February 12, 1972, marking the beginning of NAL’s experimental program. This experiment, which drew collaborators from NAL, Joint Institute for Nuclear Research (JINR at Dubna, USSR), the University of Rochester (Rochester, New York) and Rockefeller University (New York City) was significant not only as a milestone in Fermilab’s history but also as a model of cooperation between the East and West at a time when Cold War tensions still ran high. An examination of the origin, operation, and resolution of E-36 and the chain of experiments it spawned reveals the complex interplay of science and politics that drove these experiments as well as seeds of the megascience paradigm that has come to dominate high-energy physics research since the 1970s.
Charged particle multiplicity distributions in e+e--annihilation processes in the LEP experiments
International Nuclear Information System (INIS)
Shlyapnikov, P.V.
1992-01-01
Results of studies of the charged particle multiplicity distributions in the process of e + e - -annihilation into hadrons obtained in experiments at LEP accelerator in CERN are reviewed. Universality in energy dependence of the average charged particle multiplicity in e + e - and p ± p collisions, evidence for KNO-scaling in e + e - data, structure in multiplicity distribution and its relation to the jet structure of events, average particle multiplicities or quark and gluon jets, 'clan' picture and other topics are discussed. 73 refs.; 20 figs.; 3 tabs
E143 experiment. Shower counter calibration
International Nuclear Information System (INIS)
Fonvieille, H.; Grenier, P.
1994-01-01
The calibration procedure for the shower counters used in the E143 experiment is described. It has been developed during january 1994 in view of being used for the quick analysis. The method is explained and the results obtained on a given run are presented. (author)
Final Technical Report: Mu2e at the City University of New York
Energy Technology Data Exchange (ETDEWEB)
Lynch, Kevin [City Univ. (CUNY), NY (United States); Popp, James [City Univ. (CUNY), NY (United States)
2017-06-25
This DOE grant award for was for the period June 1, 2013 to March 31, 2016. Popp was awarded an internship in the Visiting Faculty Program at FNAL in summer of 2015; consequently the unused portion of summer salary funds allowed us to apply for a no-cost extension with our remaining funds until March 31, 2017. That support furnished us with the means to carry out numerous successful projects for Mu2e for nearly four years. Up to now, the driving force to our work has been dictated primarily by the Mu2e Project cost and schedule needs. Our work has been under the purview of three of the Working Groups to which we belong: Target Station, Electron Tracker, and Stopping Target Monitor. We have carried out a mix of bench-top testing tasks locally, more elaborate work at Fermilab every summer, and extensive software development and simulation studies.
The Influence of Experience, Ability and Interest on e-Learning Effectiveness
Haverila, Matti; Barkhi, Reza
2009-01-01
The purpose of this paper is to report the findings of a research conducted to evaluate the effect of learning preconceptions, prior e-learning experience, ability and interest of students on their perceptions regarding the process of e-learning. We study the effectiveness of e-learning as it relates to the level of e-learning experience. The…
Search for Multi-quark Exotic States with Heavy Flavor at D0 Experiment
Energy Technology Data Exchange (ETDEWEB)
Popov, Alexei [Serpukhov, IHEP
2017-12-20
We present the results for multi-quark exotic states search from D0 Collaboration at the FNAL Tevatron. This includes an evidence for a state (X(5568)) with hadronic decays of Bs meson, a confirmation of the X(5568) state with semileptonic decays of Bs meson, and a search for exotic baryons decaying to J/ψΛ pairs.
Sala de descanso em empresas de telemarketing e qualidade de vida
Victor Hugo de Almeida
2008-01-01
Para sistematizar a produção, majorar a produtividade, suprimir gastos e economizar tempo, empresas aderiram ao telemarketing, principal atividade terceirizada no Brasil e uma das maiores empregadoras do país (665 mil teleoperadores). Todavia, doenças desencadeadas pela atividade laboral são freqüentes em teleoperadores, fato que tem motivado empresas a buscarem recursos no próprio ambiente laboral, como a implementação de uma sala de descanso para seus funcionários, para atender ao recém apr...
The Mu2e experiment at Fermilab
International Nuclear Information System (INIS)
Donghia, R.
2017-01-01
The Mu2e experiment searches for the neutrinoless muon to electron conversion in the field of a nucleus, which is a charged lepton flavor violating process. The goal of the experiment is to reach a single event sensitivity of 2.8×10"−"1"7, setting an upper limit on the muon conversion rate of 6.7 × 10"−"1"7. This corresponds to a four order of magnitude improvement with respect to the existing limits.
Directory of Open Access Journals (Sweden)
Antônio Claret Guerra
2015-07-01
Full Text Available Este artigo tem como objetivo identificar a contribuição de redes sociais on-line (OSN para o processo de disseminação e compartilhamento de experiências de turismo das gerações X e Y. A pesquisa realizada tem natureza exploratória e abordagem qualitativa, sendo os dados obtidos por entrevistas semiestruturadas. A análise de conteúdo (Bardin, 2009 foi a técnica usada para a análise dos dados coletados. Procurou-se, dessa forma, investigar vários aspectos ligados ao tema proposto: se as OSN são uma inovação tecnológica que impactou o setor de viagens; sua importância para o desenvolvimento e manutenção de relacionamentos das gerações X e Y com mídias sociais on-line; a interface de cocriação de produtos turísticos; sua contribuição para a formação de preferências e intenções de compra. Entre as conclusões do estudo, verifica-se que os entrevistados concordam que as OSN impactam o setor e o consumidor busca benefícios ao utilizá-las, destacando a praticidade, comodidade, segurança, troca de informações e experiências. Foi citado, ainda, que as OSN divulgam roteiros turísticos competitivos e acessíveis, que antes da era digital eram relativamente pouco conhecidos do grande público. Palavras-chave: Turismo. Experiência Turística. Redes Sociais On-line. Gerações X e Y. Social Networks and Generations X and Y: Dissemination and Tourism Experience Sharing - This article aims to identify the on-line social network (OSN contribution to the X and Y generations´ tourism experiences of dissemination and sharing process. The content analysis (Bardin, 2008 was the technique used to analyses the data obtained through semi structured interviews. It was sought to investigate the OSN as technological innovation, its significance for the X and y generations relationships development, co-creation and formation of purchase intentions interface. Among the conclusions is the actual benefit of the OSN impact on the
Collaborative e-Science Experiments and Scientific Workflows
Belloum, A.; Inda, M.A.; Vasunin, D.; Korkhov, V.; Zhao, Z.; Rauwerda, H.; Breit, T.M.; Bubak, M.; Hertzberger, L.O.
2011-01-01
Recent advances in Internet and grid technologies have greatly enhanced scientific experiments' life cycle. In addition to compute- and data-intensive tasks, large-scale collaborations involving geographically distributed scientists and e-infrastructure are now possible. Scientific workflows, which
Meson spectroscopy experiment at KEK - E/iota puzzle
International Nuclear Information System (INIS)
Tsuru, Tsuneaki
1985-01-01
Physics interests at the KEK (National Laboratory for High Energy Physics) are (1) search for exotic mesons such as glueballs (gg), meiktons (q anti q g) and multiquark states (q sup(2 - )q 2 ), (2) search for missing ordinary mesons (q anti q) and confirmation of unestablished mesons, and (3) new informations of quark contents of mesons, mixing angles of SU(3) singlet-octet and tests of conservations law. Special interest is in search for exotics such as glueballs and meiktons. (2) is a so-called meson spectroscopy experiment. This is important not only in itself but also in identifying newly discovered states as exotics because exotics have often same quantum numbers as ordinary mesons. Contents are the following: glueballs and E/iota puzzles, spectrometer system, experiments, performance of the spectrometer, physics outputs, E/iota puzzles and πI experiment, future plans. (Mori, K.)
Experiência e Utopia em Theodor W. Adorno, André Gorz e François Dubet
Directory of Open Access Journals (Sweden)
Sílvio César Camargo
2007-01-01
sociedade contemporânea. Conceito bastante complexo quanto a sua possibilidade de apreensão pela sociologia, experiência se refere tanto a problemas relativos ao conhecimento e suas possibilidades, mas também para as possibilidades de transformação da sociedade. Entende-se que há três teóricos da sociedade contemporânea, que partindo de bases epistemológicas diferentes, problematizam a emancipação humana a partir de uma singular atenção ao conceito de experiência. Theodor W. Adorno, André Gorz e François Dubet representam três formas de pensamento sobre a sociedade bastante diferentes, mas que possuem em comum o interesse normativo, e seu confronto nos mostra a importância do conceito de experiência para a compreensão da sociedade contemporânea e para pensar-se a utopia.
Radio frequency systems for present and future accelerators
International Nuclear Information System (INIS)
Raka, E.C.
1987-01-01
Rf systems are described for the FNAL Main Ring and Tevatron Ring, CERN SPS and LEP, and HERA proton acceleration system, CERN PS e + e/sup minus/ acceleration system, and CERN EPA monochromatic cavity. Low impedance rf systems in CERN ISR, the Brookhaven CBA, and SSC are also discussed
Delírios I – Agonia e experiência (jogos de vida e morte
Directory of Open Access Journals (Sweden)
Vinícius Nicastro Honesko
2010-07-01
Full Text Available O presente ensaio pretende expor uma idéia de agonia como jogo de vida e morte no qual imerge o artista no ato de criação. A partir das leituras e conceituações do termo jogo em Johan Huizinga e em Roger Caillois, mostra como tais idéias são importantes para compreender a experiência humana diante do incompreensível que é a morte. Aponta como a agonia inspira no poeta, principalmente na modernidade, uma distância em relação às certezas do conhecimento, implicando uma leitura etimológica do termo experiência, isto é, como ex periri, (aqui, também, jogo de vida e morte. Por fim, procura ver como os traços desse jogo – uma eterna luta – sutilmente se mostram nos pânicos de Murilo Mendes e de Paul Gauguin, artistas nos quais a consciência dessa luta é atravessada pela imagem do lugar por excelência da agonia: o Calvário.
Report of the Snowmass M6 Working Group on high intensity proton sources
Energy Technology Data Exchange (ETDEWEB)
Weiren Chou and J. Wei
2002-08-20
The U.S. high-energy physics program needs an intense proton source, a 1-4 MW Proton Driver (PD), by the end of this decade. This machine will serve as a stand-alone facility that will provide neutrino superbeams and other high intensity secondary beams such as kaons, muons, neutrons, and anti-protons (cf. E1 and E5 group reports) and also serve as the first stage of a neutrino factory (cf. M1 group report). It can also be a high brightness source for a VLHC. Based on present accelerator technology and project construction experience, it is both feasible and cost-effective to construct a 1-4 MW Proton Driver. Two recent PD design studies have been made, one at FNAL and the other at the BNL. Both designed PD's for 1 MW proton beams at a cost of about U.S. $200M (excluding contingency and overhead) and both designs were upgradeable to 4 MW. An international collaboration between FNAL, BNL and KEK on high intensity proton facilities is addressing a number of key design issues. The superconducting (sc) RF cavities, cryogenics, and RF controls developed for the SNS can be directly adopted to save R&D efforts, cost, and schedule. PD studies are also actively being pursued at Europe and Japan.
Electronic Collaboration Logbook
International Nuclear Information System (INIS)
Gysin, Suzanne; Mandrichenko, Igor; Podstavkov, Vladimir; Vittone, Margherita
2012-01-01
In HEP, scientific research is performed by large collaborations of organizations and individuals. The logbook of a scientific collaboration is an important part of the collaboration record. Often it contains experimental data. At Fermi National Accelerator Laboratory (FNAL), we developed an Electronic Collaboration Logbook (ECL) application, which is used by about 20 different collaborations, experiments and groups at FNAL. The ECL is the latest iteration of the project formerly known as the Control Room Logbook (CRL). We have been working on mobile (IOS and Android) clients for the ECL. We will present the history, current status and future plans of the project, as well as design, implementation and support solutions made by the project.
Experiment E89-044 on the Quasielastic 3He(e,e'p) Reaction at Jefferson Laboratory
Energy Technology Data Exchange (ETDEWEB)
Penel-Nottaris, Emilie [Univ. Joseph Fourier Grenoble (France)
2004-07-07
The Jefferson Lab Hall A E89-044 experiment has measured the 3He(e,e'p) reaction cross-sections. The extraction of the longitudinal and transverse response functions for the two-body break-up 3He(e,e'p)d reaction in parallel kinematics allows the study of the bound proton electromagnetic properties inside the 3He nucleus and the involved nuclear mechanisms beyond plane wave approximations.
Evaluation Of User Experience And Its Economics In E-Commerce
Directory of Open Access Journals (Sweden)
Praneeth Kumar Baru
2017-10-01
Full Text Available User Experience pertains to designing studying and evaluating experiences that users have while using or interacting with the system with a specific context. UX is seen as a field of study a phenomenon and as a practice as well. To understand it with an analogy justice as a phenomenon law as a field of study and a lawyers work as a practice. Evaluating the users experience can help quantify or measure to the extent to which the system is being understood or perceived the way it is supposed to be. Evaluation methods can take various forms and are categorized in this paper. Essentials of the user experience are elaborated and furthermore some quantified data is presented that discusses the role user experience in e-commerce website and also the future prospects of the e-commerce domain are briefly described.
O Plano Real à luz da experiência mexicana e argentina
Directory of Open Access Journals (Sweden)
Paulo Nogueira Batista Jr.
1996-12-01
Full Text Available O trabalho discute os primeiros dois anos do Plano Real e em especial os seus efeitos sobre as relações externas do Brasil, à luz da experiência de programas de estabilização adotados no México, em 1988-1994, e na Argentina, desde 1991. Embora cada experiência nacional apresente as suas peculiaridades, argumenta-se que a economia brasileira vem revivendo a experiência mexicana e argentina em alguns pontos importantes, combinando sucesso no combate à inflação com acentuada e persistente apreciação cambial, elevados déficits no balanço de pagamentos em conta corrente e dependência de fluxos voláteis de capital internacional.This paper discusses the first two years of Brazil's current stabilization programme - known as the Real Plan - and in particular its effects on the country's external economic relations, in the ligth of similar stabilization programmes adopted in Mexico from 1988 to 1994 and in Argentina since 1991. Although each national experience has its peculiarities, it is shown that the Brazilian economy has been reliving the Mexican and Argentinian experience in some important respects, combining success in terms of inflation reduction, with strong and persistent exchange rate appreciation, high deficits in the balance of payments on current account and dependence on volatile international capital flows.
International Reactor Physics Experiment Evaluation (IRPhE) Project. IRPhE Handbook - 2015 edition
International Nuclear Information System (INIS)
Bess, John D.; Gullifor, Jim
2015-03-01
The purpose of the International Reactor Physics Experiment Evaluation (IRPhE) Project is to provide an extensively peer-reviewed set of reactor physics-related integral data that can be used by reactor designers and safety analysts to validate the analytical tools used to design next-generation reactors and establish the safety basis for operation of these reactors. This work of the IRPhE Project is formally documented in the 'International Handbook of Evaluated Reactor Physics Benchmark Experiments', a single source of verified and extensively peer-reviewed reactor physics benchmark measurements data. The evaluation process entails the following steps: Identify a comprehensive set of reactor physics experimental measurements data, Evaluate the data and quantify overall uncertainties through various types of sensitivity analysis to the extent possible, verify the data by reviewing original and subsequently revised documentation, and by talking with the experimenters or individuals who are familiar with the experimental facility, Compile the data into a standardized format, Perform calculations of each experiment with standard reactor physics codes where it would add information, Formally document the work into a single source of verified and peer reviewed reactor physics benchmark measurements data. The International Handbook of Evaluated Reactor Physics Benchmark Experiments contains reactor physics benchmark specifications that have been derived from experiments that were performed at nuclear facilities around the world. The benchmark specifications are intended for use by reactor designers, safety analysts and nuclear data evaluators to validate calculation techniques and data. Example calculations are presented; these do not constitute a validation or endorsement of the codes or cross-section data. The 2015 edition of the International Handbook of Evaluated Reactor Physics Benchmark Experiments contains data from 143 experimental series that were
Energy Technology Data Exchange (ETDEWEB)
Dahmen, H D; Schuelke, L; Zech, G [Physics Department, Siegen University, Germany, F.R.
1979-02-26
A measurement of parity violating effects in the process e/sup +/e/sup -/ ..-->.. tau/sup +/tau/sup -/ for unpolarized e/sup +/e/sup -/ beams is proposed. For realistic assumptions on the luminosity of PETRA and PEP an estimate shows that the experiment is feasible.
Religiosidade e turismo: o primado da experiência
Directory of Open Access Journals (Sweden)
António Sérgio Araújo de Almeida
Full Text Available Resumo Localizada em um plano complexo e multifacetado, a experiência turística em contexto religioso é fortemente afetada pelos aspectos simbólicos, culturais, sociais e econômicos, presentes no lugar de visitação. É neste sentido que este trabalho se propõe a discutir alguns destes elementos no contexto empírico da Semana Santa de Braga, em Portugal.
Feminilidade: alteridade e experiência Femininity: alterity and experience
Directory of Open Access Journals (Sweden)
Márcia Arán
2002-06-01
Full Text Available Este ensaio tem como objetivo desenvolver a noção de alteridade na psicanálise a partir dos conceitos de feminilidade e de experiência. Parte de uma crítica à centralidade do modelo Édipo / castração na teoria psicanalítica modelo este que fundamenta uma forma de subjetivação que se faz pelo recalque como defesa ou pela renúncia pulsional - para pensar novas formas de sociabilidade. Inicialmente, procura-se analisar o destino da experiência alteritária na modernidade: o outro como estranho-familiar. Em seguida, através da análise de algumas passagens da obra freudiana, procura-se desen volver a noção de alteridade no registro da imanência, ou seja, como uma abertura para a diferença.The objective of this essay is to elaborate on the notion of alterity in psychoanalysis based on the concepts of femininity and experience. The point of departure is a critique of the centrality of the Oedipean/castration model in psychoanalytical theory (a model underlying a form of subjectivation resulting from repression or denial of drive in order to conceive new forms of sociabilily. The article begins by analyzing lhe fate of the altetily experience in modernity: lhe other as slrange/familiar. Next, by analyzing key passages from Freud's work, lhe author seeks to develop the notion of alterily in lhe context of immanence, that is, as an openness to difference.
A "Uses and Gratification Expectancy Model" to Predict Students' "Perceived e-Learning Experience"
Mondi, Makingu; Woods, Peter; Rafi, Ahmad
2008-01-01
This study investigates "how and why" students' "Uses and Gratification Expectancy" (UGE) for e-learning resources influences their "Perceived e-Learning Experience." A "Uses and Gratification Expectancy Model" (UGEM) framework is proposed to predict students' "Perceived e-Learning Experience," and…
The E166 experiment: Development of an undulator-based ...
Indian Academy of Sciences (India)
A longitudinal polarized positron beam is foreseen for the international linear collider (ILC). A proof-of-principle experiment has been performed in the final focus test beam at SLAC to demonstrate the production of polarized positrons for implementation at the ILC. The E166 experiment uses a 1 m long helical undulator in a ...
Antiproton storage: a comparison of proposals
International Nuclear Information System (INIS)
Pondrom, L.G.
1977-01-01
Projects to produce and store anti p's and to accelerate anti p's and p's together in the same large ring are underway at CERN and FNAL. The goal is to achieve anti pp collisions with a luminosity L approximately 10 30 cm -2 sec -1 by perhaps 1980. These experiments predate any similar effort at ISABELLE by at least four years, so it is necessary to plan an ISABELLE project which will have significantly higher luminosity. A lower bound L = 10 31 cm -2 sec -1 has been rather arbitrarily chosen. The basic numbers which enter into the luminosity calculations for the CERN and FNAL proposals are presented and are compared with what could be achieved at ISABELLE under ideal conditions
O ensino e a experiência nas narrativas de professores de Inglês
Directory of Open Access Journals (Sweden)
Annallena de Souza Guedes
2016-09-01
Full Text Available Resumo: Este trabalho tem como objetivo analisar três narrativas de professores de Inglês em exercício, através das quais são reveladas experiências que dizem respeito ao processo de ensinar Inglês em contextos de instituições públicas no Brasil. Pautado no conceito de experiência (MICCOLI, 2010, buscamos compreender quais experiências emergem dessas narrativas e como elas influenciam na prática de ensino dos professores. Ademais, intentamos analisar como os professores de Inglês se veem e quais desafios ele enfrentam nos seus contextos de trabalho. Os resultados desse estudo mostraram que, apesar de todas as experiências de dificuldades e indisciplina reveladas nas narrativas, duas delas parecem ainda encontrar motivação e esperança quanto à sua profissão. Além disso, percebemos que o modo como os professores veem sua realidade, seus alunos e seu trabalho são importantes para caracterizar sua prática profissional. Assim, acreditamos que o contexto e as experiências retratados nas narrativas podem ser caminhos que direcionem as ações desses professores em sala de aula e, consequentemente, possibilitem reflexões e mudanças no seu papel como educador.
Open-Rate Controlled Experiment in E-Mail Marketing Campaigns
Biloš, Antun; Turkalj, Davorin; Kelić, Ivan
2016-01-01
Purpose – The main purpose of this paper is to test the controlled experiment (A/B split) methodology in B2C oriented e-mail marketing campaigns. Design/Methodology/Approach – E-mail marketing techniques have been a substantial part of e-marketing methodology since the early Internet days of the mid-1990s. From the very beginning of Internet utilization for business purposes, e-mail was one of the most widely used communication techniques in B2B and B2C markets alike. Due to high volumes o...
Rare K+ decays from experiment E787
International Nuclear Information System (INIS)
Jain, V.
2000-01-01
This paper presents the latest results from experiment E787, at Brookhaven National Laboratory, on K + -> π + νbar ν and radiative K + decays. The result for K + -> π + νbar ν uses data collected in runs taken during 1995, 1996 and 1997. In addition, they discuss plans for future measurements of K + -> π + νbar ν
International Reactor Physics Experiment Evaluation (IRPhE) Project
International Nuclear Information System (INIS)
2013-01-01
The International Reactor Physics Experiment Evaluation (IRPhE) Project aims to provide the nuclear community with qualified benchmark data sets by collecting reactor physics experimental data from nuclear facilities, worldwide. More specifically the objectives of the expert group are as follows: - maintaining an inventory of the experiments that have been carried out and documented; - archiving the primary documents and data released in computer-readable form; - promoting the use of the format and methods developed and seek to have them adopted as a standard. For those experiments where interest and priority is expressed by member countries or working parties and executive groups within the NEA provide guidance or co-ordination in: - compiling experiments into a standard international agreed format; - verifying the data, to the extent possible, by reviewing original and subsequently revised documentation, and by consulting with the experimenters or individuals who are familiar with the experimenters or the experimental facility; - analysing and interpreting the experiments with current state-of-the-art methods; - publishing electronically the benchmark evaluations. The expert group will: - identify gaps in data and provide guidance on priorities for future experiments; - involve the young generation (Masters and PhD students and young researchers) to find an effective way of transferring know-how in experimental techniques and analysis methods; - provide a tool for improved exploitation of completed experiments for Generation IV reactors; - coordinate closely its work with other NSC experimental work groups in particular the International Criticality Safety Benchmark Evaluation Project (ICSBEP), the Shielding Integral Benchmark Experiment Data Base (SINBAD) and others, e.g. knowledge preservation in fast reactors of the IAEA, the ANS Joint Benchmark Activities; - keep a close link with the working parties on scientific issues of reactor systems (WPRS), the expert
XbD Video 2, Taxonomy of Experience (ToE) [Online
DEFF Research Database (Denmark)
2013-01-01
This is the second video in the Experience-based Designing series: It describes the Taxonomy of Experience, a structural way of looking at human experiences of almost any kind.This hierarchical model is useful to researchers and decision makers as a general method or tool for guiding the collection......, processing and categorisation of field data about an everyday experience. Researchers using this model often referred to the process as 'doing a ToE'...
Nietzsche e a jubilosa experiência trágica dos gregos
Directory of Open Access Journals (Sweden)
Renato Nunes Bittencourt
2010-10-01
Full Text Available Neste texto analisamos a interpretação de Nietzsche sobre o sentido existencial da experiência trágica realizada pelos antigos gregos na celebração estética e religiosa da Tragédia Ática, e de que modo tal experiência favorece a compreensão imanente e amoral da vida, suprimindo-se ainda qualquer tipo de depreciação moralista em relação ao real.
E-Books and Audiobooks: Extending the Digital Reading Experience
Larson, Lotta C.
2015-01-01
This article examines how sixth-grade students navigated and perceived a combined e-book and audiobook reading experience using Kindle Fires. While audiobooks and e-books are not new, little is known about students' use and perceptions of the combination of these two media, as the ability to synchronize audio contents with digital texts is rather…
De Marias e Luizes: experiências devocionais e de gênero numa festa mariana
Directory of Open Access Journals (Sweden)
Martín, Eloísa
2003-01-01
Full Text Available O presente artigo parte de uma pesquisa levada a cabo entre 1998 e 2000 na festa da Virgem de Itatí em Corrientes (Argentina. A partir de dois casos, proponho analisar a maneira pela qual as experiências religiosas e de gênero relacionam-se e se constituem mutuamente a través de certas práticas devocionais. Tais práticas, transmitidas e reproduzidas por meio de laços familiares também marcadas por diferenciais de gênero, se processam em termos de um compromisso com a Virgem, mas também com as tradições locais e com os próprios laços de parentesco. Assim, através de certas práticas de devoção, veremos como se aprende a ser, ao mesmo tempo e desde o início, mulher e devota, homem e devoto
Optimizing Centrifugal Barrel Polishing For Mirror Finish SRF Cavity And RF Tests At Jefferson Lab
International Nuclear Information System (INIS)
Palczewski, Ari; Geng, Rongli; Tian, Hui
2012-01-01
We performed Centrifugal Barrel Polishing (CBP) on a 1.3 GHz fine grain TESLA single cell cavity and 1.5 GHz fine grain CEBAF high gradient superconducting radio frequency (SRF) single cell cavity following a modified recipe originally developed at Fermi National Accelerator Lab (FNAL). We were able to obtain a mirror like surface similar to that obtained at FNAL, while reducing the number of CBP steps and total processing time. This paper will discuss the change in surface and subsequent cavity performance post CBP, after a 800 C bake (no pre-bake chemistry) and minimal controlled electro-polishing (10 micron). In addition to Q vs. E ACC thermometry mapping with preheating characteristics and optical inspection of the cavity after CBP will also be shown.
Phenomenology of neutrino oscillations
Indian Academy of Sciences (India)
Hence, I think it is time to look at the next job. .... travel Д in vacuum is given by. И´ « .... travelling through the earth that the effect is most dominant. ..... real confirmation or ruling out has to await the Mini BOONE experiment at FNAL, a long.
The challenges of new nuclear projects. E.ON Experience
International Nuclear Information System (INIS)
Spechty, J.; Perez Rodriguez, J. L.
2012-01-01
E.ON is one of the largest privately-owned energy companies in the world. Its portfolio of nuclear assets in composed of 21 nuclear power plants on 13 sites located in Germany and Sweden, 9 of which are directly operated by E.ON. At present E.ON develops large-scale construction projects in two of the European countries willing to commit to new nuclear build-Finland and UK - for which its experience as the best nuclear power plant operator in Europe is key. (Author)
Feasibility of a 81Br(ν,e-) 81Kr solar neutrino experiment
International Nuclear Information System (INIS)
Hurst, G.S.; Chen, C.H.; Kramer, S.D.; Cleveland, B.T.; Davis, R. Jr.; Rowley, R.K.; Gabbard, F.; Schima, F.J.
1984-01-01
A solar neutrino experiment utilizing the interaction of 81 Br(ν,e - ) 81 Kr to study the 7 Be neutrino source in the interior of the sun is shown to be feasible. Resonance ionization spectroscopy was used to count less than 1000 atoms of 2 x 10 5 -yr 81 Kr, making the bromine experiment possible. Except for the method of counting product atoms, the bromine experiment would be very similar to the successful chlorine detector 37 Cl(ν,e - ) 37 Ar, and thus it is a natural sequel to the only solar neutrino experiment to date
International Reactor Physics Experiment Evaluation (IRPhE) Project. IRPhE Handbook - 2017 edition
International Nuclear Information System (INIS)
2017-01-01
The International Reactor Physics Evaluation (IRPhE) Project was initiated as a pilot in 1999 by the Nuclear Energy Agency (NEA) Nuclear Science Committee (NSC). The project was endorsed as an official activity of the NSC in June 2003. While the NEA co-ordinates and administers the IRPhE Project at the international level, each participating country is responsible for the administration, technical direction and priorities of the project within their respective countries. The information and data included in this handbook are available to NEA member countries, to all contributing countries and to others on a case-by-case basis. The IRPhE Project is patterned after the International Criticality Safety Benchmark Evaluation Project (ICSBEP). It closely co-ordinates with the ICSBEP to avoid duplication of efforts and publication of conflicting information. Some benchmark data are applicable to both nuclear criticality safety and reactor physics technology. Some have already been evaluated and published by the ICSBEP, but have been extended to include other types of measurements in addition to the critical configuration. Through this effort, the IRPhE Project will be able to 1) consolidate and preserve the existing worldwide information base; 2) retrieve lost data; 3) identify areas where more data are needed; 4) draw upon the resources of the international reactor physics community to help fill knowledge gaps; 5) identify discrepancies between calculations and experiments due to deficiencies in reported experimental data, cross-section data, cross-section processing codes and neutronics codes; 6) eliminate a large amount of redundant research and processing of reactor physics experiment data, and 7) improve future experimental planning, execution and reporting. This handbook contains reactor physics benchmark specifications that have been derived from experiments performed at nuclear facilities around the world. The benchmark specifications are intended for use by
Infância, experiência e performatividade: primeiras aproximações
Directory of Open Access Journals (Sweden)
Sandro Vinicius Sales dos Santos
2014-08-01
Full Text Available http://dx.doi.org/10.5007/1980-4512.2014n30p31 O presente trabalho apresenta e discute alguns resultados parciais de uma pesquisa de mestrado em andamento que objetiva analisar as experiências vivenciadas por crianças de quatro anos no interior de uma instituição pública de educação infantil. O estudo de caráter interpretativo busca suas bases teóricas na sociologia da infância e nas pedagogias da infância e da educação infantil. Do ponto de vista metodológico, a pesquisa se fundamenta em um estudo de caso (ANDRÉ, 1991; SARMENTO, 2003 assumindo uma lógica de investigação etnográfica (CASTANHEIRA, 2004; GREEN, DIXON, ZAHALIRICK, 2005, tendo como principais instrumentos de coleta de dados, a observação participante, fotografias e desenhos articulados com a oralidade; entrevista com crianças e adultos, dentre outros. Discute ainda a noção de experiência infantil como a possibilidade de análise das formas de sociabilidade das crianças. Palavras-chave: infância, crianças, educação infantil, experiência infantil, ponto de vista das crianças.
Coincidence (e,e'p) Scattering on 40Ar and 48Ti to Aid Precision Neutrino Oscillation Experiments
Abrams, Dan; E12-14-012 Collaboration
2017-09-01
Neutrino oscillations are an active area of research, with experiments such as DUNE (Deep Underground Neutrino Experiment). DUNE will make use of large liquid argon detectors to perform a precision measurement of the CP violating phase. Hence, an understanding of the argon nuclear ground state and its response to (anti-)neutrino interactions is of paramount importance. Information about the nuclear ground state is encapsulated in the spectral function, S (k , E) , the joint probability of removing a nucleon of momentum k = |k | from the ground state leaving the residual (A-1) system with excitation energy E. E12-14-012 at Jefferson Lab ran in early 2017 and has measured the argon spectral function through coincidence (e ,e' p) scattering on 40Ar and 48Ti. The results of E12-14-012 are important to both the neutrino and nuclear physics communities. A direct measurement of the coincidence (e ,e' p) cross section from 40Ar and 48Ti will provide valuable information about the argon nucleus, as well as the experimental input necessary to constrain theoretical models used to calculate S (k , E) , paving the way for reliable estimates of the neutrino cross sections. Data from E12-14-012 is currently being analyzed at UVA and Va. Tech. Supported in part by the Department of Energy Grant No: DE-FG02-96ER40950.
Tempo e Trânsito na Experiência Subjetiva de Motoristas
Ana Inez Oka Elvas de Lima; Sylvia Cavalcante
2015-01-01
Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas d...
Telford, Mark; Senior, Emma
2017-06-08
This article describes the experiences of undergraduate healthcare students taking a module adopting a 'flipped classroom' approach. Evidence suggests that flipped classroom as a pedagogical tool has the potential to enhance student learning and to improve healthcare practice. This innovative approach was implemented within a healthcare curriculum and in a module looking at public health delivered at the beginning of year two of a 3-year programme. The focus of the evaluation study was on the e-learning resources used in the module and the student experiences of these; with a specific aim to evaluate this element of the flipped classroom approach. A mixed-methods approach was adopted and data collected using questionnaires, which were distributed across a whole cohort, and a focus group involving ten participants. Statistical analysis of the data showed the positive student experience of engaging with e-learning. The thematic analysis identified two key themes; factors influencing a positive learning experience and the challenges when developing e-learning within a flipped classroom approach. The study provides guidance for further developments and improvements when developing e-learning as part of the flipped classroom approach.
International Nuclear Information System (INIS)
Cerny, V.
1983-01-01
A model based estimate is presented of the geometrical acceptance of the HYPERON spectrometer for the detection of the e + e - pairs in the proposed lepton experiment. The results of the Monte Carlo calculation show that the expected acceptance is fairly high. (author)
Proposed solar neutrino experiment using 81Br(nu,e-)81Kr
International Nuclear Information System (INIS)
Hurst, G.S.; Chen, C.H.; Kramer, S.D.; Allman, S.L.
1984-12-01
It has now been shown that it is feasible to measure the 7 Be neutrino source in the sun by using the reaction 81 Br(nu,e - ) 81 Kr in a radiochemical experiment. Such an experiment would be quite similar to the Davis, Cleveland, and Rowley method for measuring the 8 B neutrino using 37 Cl(nu,e - ) 37 Ar except that the resonance ionization spectroscopy (RIS) method (instead of decay counting) would be employed to count the 2 x 10 5 -yr 81 Kr atoms
Status and future of the experiment PS 170 (anti pp → e+e-)
International Nuclear Information System (INIS)
Duclos, J.
1985-03-01
The LEAR experiment PS170 is designed to detect the e +- pairs from anti p-annihilation. It aims to measure the proton form factors in the time like region and the spectrum of vector mesons in the mass range: 1-1,6 GeV. Data have been taken at 300, 600 and 1500 MeV/c incident momenta. The analysis of the 300 MeV/c data gave 200 2-body events: (anti pp → e + e - ), clearly separated from the hadronic background. Values of the form factors are extracted near threshold. The next step will be to accumulate sufficient data to measure separately the electric and magnetic components up to 600 MeV/c. The use of an internal target is considered for measurements at high momenta
Assessing the User Experience of E-Books in Academic Libraries
Zhang, Tao; Niu, Xi; Promann, Marlen
2017-01-01
We report findings from an assessment of e-book user experience (search and information seeking) from usage data and user tests. The usage data showed that most reading sessions were brief and focused on certain pages, suggesting that users mainly use e-books to find specific information. The user tests found that participants tended to use…
Two-particle correlations at FNAL and ISR energies
International Nuclear Information System (INIS)
Darriulat, P.
1975-01-01
Some recent experimental results concerning the cluster structure of hadronic final states at high incident energies are reviewed. Results of experiments on angular correlations, both rapidity correlations and joint azimuth-rapidity correlations, in the central region, are discussed. Recent evidence for local compensation of charges and new data on resonance production are reviewed. Leading and high transverse momentum clusters, in as much as they may somehow be related to central clusters, are dealt with briefly. (U.K.)
Emoções e pesquisa narrativa: transformando experiências de aprendizagem
Directory of Open Access Journals (Sweden)
Rodrigo Aragão
2008-01-01
Full Text Available Este artigo explora a influência de uma pesquisa narrativa nas experiências de aprendizagem de estudantes de Letras/Inglês. Ao refletir sobre suas histórias de aprendizagem, eles deram voz e sentido às suas experiências, sentindo-se valorizados. Suas histórias de aprendizagem expõem a relevância das emoções no desenvolvimento de habilidades orais, na reflexão e na responsabilidade por sua trajetória profissional. Três participantes transformaram suas experiências de aprendizagem de inglês ao refletir sobre as emoções que limitam seu desempenho oral e ao projetar imagens que representassem o desejo de se tornarem falantes fluentes. Porém, transformar os desejos em ações pode envolver investimentos que extrapolam a tomada de consciência na reflexão pela pesquisa.This article explores the influence of a narrative research on the language learning experiences of undergraduate students of English. As they reflect upon their language learning histories, they give voice and meaning to their experiences and their self-esteem improves. Their language learning histories reveal the relevance of emotions in their oral skills development, reflection, and responsibility for their professional trajectories. Three participants transformed their language experiences by reflecting on the emotions that restrained their speaking skills and projecting images that would represent their desire to become fluent speakers. However, transforming their desires into actions entails dealing with investments that may go beyond reflection fostered by this research.
Experimental and theoretical high energy physics research. [UCLA
Energy Technology Data Exchange (ETDEWEB)
Buchanan, Charles D.; Cline, David B.; Byers, N.; Ferrara, S.; Peccei, R.; Hauser, Jay; Muller, Thomas; Atac, Muzaffer; Slater, William; Cousins, Robert; Arisaka, Katsushi
1992-01-01
Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e{sup +}e{sup {minus}} analysis, {bar P} decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the {phi} factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K{sub L}{sup 0} {yields} {pi}{sup 0}{gamma}{gamma} and {pi}{sup 0}{nu}{bar {nu}}, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R D.
Energy Technology Data Exchange (ETDEWEB)
1992-10-01
Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e{sup +}e{sup {minus}} analysis, {bar P} decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the {phi} factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K{sub L}{sup 0} {yields} {pi}{sup 0}{gamma}{gamma} and {pi}{sup 0}{nu}{bar {nu}}, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R & D.
Experimental and theoretical high energy physics research
International Nuclear Information System (INIS)
1992-01-01
Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e + e - analysis, bar P decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the φ factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K L 0 → π 0 γγ and π 0 ν bar ν, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R ampersand D
Usabilidade e user experience: essencial para aceitabilidade de produtos e serviços
Directory of Open Access Journals (Sweden)
Antonio Mendes Silva Filho
2011-11-01
Full Text Available Usabilidade é um atributo de qualidade essencial que tem sido usado pelas empresas para conquistar novos consumidores. E, você quando busca adquirir um novo produto (ou serviço, você intenciona (a atingir objetivos (que atendam suas necessidades num determinado contexto; (b eficiência (obtendo um resultado ou solução, de modo eficiente e produtivo, para um problema que tenha em mãos; e (c satisfação (de maneira subjetiva no uso do produto ou serviço. Esses três aspectos destacados compreendem os fatores, utilizados pela Norma 9241-11 da ISO (International Organization for Standardization para definir a usabilidade. De acordo com a Norma 9241-11 da ISO (International Organization for Standardization, a usabilidade é definida como “The extent to which a product can be used by specified users to achieve specified goals with effectiveness, efficiency, and satisfaction in a specified context of use”. Esses objetivos compreendem a base do que é denominado “user experience”. Mas, o que é user experience? Trata-se da experiência do usuário quando interage com produtos ou serviços. Um produto pode ser qualquer coisa como, por exemplo, um tablet, um aparelho celular ou smartphone, um painel de automóvel ou software. Qualquer desses produtos ou até serviços (como oferecidos em web sites, têm a usabilidade como atributo determinante da qualidade perceptível aos usuários. Nesse sentido, o objetivo deste artigo é discutir a usabilidade e estratégias de sua avaliação.
International Nuclear Information System (INIS)
Lanou, R.E. Jr.
1984-01-01
An experimental program in strong and electro-weak interaction physics of elementary particles is being carried out using electronic detection techniques. Experiments have been performed or are being prepared utilizing the accelerators of the laboratories at Brookhaven and Fermilab. The experiments described in this report by the Electronic Detector Group include the following: (1) experiments to measure neutrino-electron scattering and other neutral current phenomena, (2) preparations for experiments at the FNAL anti P P Collider, (3) neutrino oscillation experiments at BNL, and (4) a monopole search
Directory of Open Access Journals (Sweden)
Adair Menezes Jr.
2012-01-01
Full Text Available CONTEXTO: Vivências psicóticas e dissociativas não patológicas são comuns na população geral, especialmente em grupos religiosos. Há poucos estudos sobre o perfil da população não clínica com essas vivências, bem como há dúvidas sobre critérios para o diagnóstico diferencial dessas experiências. OBJETIVOS: Identificar o perfil sociodemográfico e de experiências anômalas (EA entre pessoas que buscaram ajuda em centros espíritas. MÉTODOS: Foram entrevistadas 115 pessoas que procuraram auxílio em seis centros espíritas de Juiz de Fora/MG por causa de vivências psicóticas e/ou dissociativas. Entrevista semiestruturada investigou dados sociodemográficos, experiências anômalas apresentadas e a presença de critérios propostos para identificar experiências espirituais não patológicas. RESULTADOS: Predomínio de mulheres (70%, de meia-idade, com alta escolaridade, ativas ocupacionalmente e cujas EA começaram na infância (65% ou adolescência (23%. As EA mais frequentes foram alucinações visuais (63%, auditivas (54%, "percepção espiritual" (53%, "sonhos paranormais" (38% e experiências fora do corpo (31%. Para a maioria da amostra, essas EA não traziam prejuízos sócio-ocupacionais, eram curtas, episódicas e benéficas; entretanto referiram sofrimento emocional e falta de controle sobre elas. CONCLUSÃO: A alta frequência e diversidade de EA encontradas, bem como suas implicações teóricas, clínicas e de saúde pública, indicam a urgência de maior atenção a esse tópico.BACKGROUND: Non-pathological psychotic and dissociative experiences are frequent in the general population, particularly in religious groups. There are few studies on the profile of non-clinical populations with these experiences, and on criteria for differential diagnosis. OBJECTIVES: To identify the sociodemographic profile and anomalous experiences (AE among people who sought help in spiritualist groups. METHODS: We interviewed 115
Progress report of a research program in experimental high energy physics
International Nuclear Information System (INIS)
Lanou, R.E. Jr.; Cutts, D.
1990-01-01
An experimental program in strong and electro-weak interaction physics of elementary particles is being carried out using electronic detection techniques. Experiments have been performed at Brown, Brookhaven, and Fermilab. The work described in this report by the Electronic Detector Group addresses the following: neutrino interactions and intrinsic properties, preparations for experiments (''D--ZERO'') at the FNAL 2 TeV bar pp Collider, new detection techniques for neutrino properties
A research program in experimental high energy physics: Task C, Progress report
International Nuclear Information System (INIS)
Lanou, R.E. Jr.; Cutts, D.
1988-01-01
An experimental program in strong and electro-weak interaction physics of elementary particles is being carried out using electronic detection techniques. Experiments have been performed at Brown, Brookhaven, and Fermilab. The work described in this report by the /electronic Detector Group addresses the following: electroweak parameters via neutrino interactions, preparations for experiments (''D-ZERO'') at the FNAL 2 TeV /bar p/p Collider, new detection techniques for neutrino properties
Empirical study on flow experience in China tourism e-commerce market
Directory of Open Access Journals (Sweden)
Jianling Wang
2015-04-01
Full Text Available Purpose: While tourism e-commerce develops rapidly in China, these channels are truly new to both web providers and web consumers, understanding the nature of these media attaches greater importance. This study investigates the mediation effects of flow experience on the relationship between motivation and behavior intention in tourism e-commerce.Design/methodology/approach: Based on the technology acceptance model, an empirical study is designed to test this relationship.we estimated the measurement model with 13 manifest indicators and 4 latent constructs by CFA to assess the reliability and validity of the construct measures, then tested hypotheses by OLS regression and a formal three-step mediation procedure.Findings: Overall, the results reveal that trust is incorporated in motivation and play it’s role together with other motivations; telepresence and concentration are confirmed in flow experience, and both partially mediated the relationship.Research limitations/implications: This study demonstrates that to improve consumers’ usage adoption, marketers should pay much attention to not only consumers’ motivation but also the areas such as flow experience.Originality/value: This study takes flow experience as a new perspective to explore china tourism e-commerce, estimates its measurement and tests its roles between motivation and behavior intention.
Review of e+e- experiments with PLUTO from 3 to 31 GeV
International Nuclear Information System (INIS)
Criegee, L.; Knies, G.
1981-07-01
The contributions of the PLUTO experiment to e + e - physics at collision energies in the range of 3-31 GeV are reviewed. The review briefly sketches the storage rings DORIS and PETRA at DESY, and describes the most important features of the PLUTO detector, of data processing, and of the analysis methods. It covers the physics results in the fields of electroweak interactions, of the heavy lepton tau and the search for still heavier leptons, of hadron production with evidence for quark and gluon jets, as well as multiparton effects, of UPSILON decays and their relation to QCD, and concludes with first results in high-energy photon-photon interactions. (orig.)
An Electron Fixed Target Experiment to Search for a New Vector Boson A' Decaying to e+e-
Energy Technology Data Exchange (ETDEWEB)
Essig, Rouven; Schuster, Philip; /SLAC; Toro, Natalia; /Stanford U., Phys. Dept.; Wojtsekhowski, Bogdan; /Jefferson Lab
2010-06-11
We describe an experiment to search for a new vector boson A' with weak coupling {alpha}' {approx}> 6 x 10{sup -8} {alpha} to electrons ({alpha} = e{sup 2}/4{pi}) in the mass range 65 MeV < m{sub A'} < 550 MeV. New vector bosons with such small couplings arise naturally from a small kinetic mixing of the 'dark photon' A' with the photon - one of the very few ways in which new forces can couple to the Standard Model - and have received considerable attention as an explanation of various dark matter related anomalies. A' bosons are produced by radiation off an electron beam, and could appear as narrow resonances with small production cross-section in the trident e{sup +}e{sup -} spectrum. We summarize the experimental approach described in a proposal submitted to Jefferson Laboratory's PAC35, PR-10-009. This experiment, the A' Experiment (APEX), uses the electron beam of the Continuous Electron Beam Accelerator Facility at Jefferson Laboratory (CEBAF) at energies of {approx} 1-4 GeV incident on 0.5-10% radiation length Tungsten wire mesh targets, and measures the resulting e{sup +}e{sup -} pairs to search for the A' using the High Resolution Spectrometer and the septum magnet in Hall A. With a {approx} 1 month run, APEX will achieve very good sensitivity because the statistics of e{sup +}e{sup -} pairs will be {approx} 10,000 times larger in the explored mass range than any previous search for the A' boson. These statistics and the excellent mass resolution of the spectrometers allow sensitivity to {alpha}'/{alpha} one to three orders of magnitude below current limits, in a region of parameter space of great theoretical and phenomenological interest. Similar experiments could also be performed at other facilities, such as the Mainz Microtron.
Controlled Experiment Replication in Evaluation of E-Learning System's Educational Influence
Grubisic, Ani; Stankov, Slavomir; Rosic, Marko; Zitko, Branko
2009-01-01
We believe that every effectiveness evaluation should be replicated at least in order to verify the original results and to indicate evaluated e-learning system's advantages or disadvantages. This paper presents the methodology for conducting controlled experiment replication, as well as, results of a controlled experiment and an internal…
The Social & Mobile Learning Experiences of Students Using Mobile E-Books
Kissinger, Jeff S.
2013-01-01
This research was designed to explore the learning experiences of state college students using mobile electronic textbook (e-book) readers. The purpose of the study was to build a rich description of how students used e-books delivered on mobile computing devices for college-level, introductory
Energy Technology Data Exchange (ETDEWEB)
Dorman, Mark Edward [Univ. College London, Bloomsbury (United Kingdom)
2008-04-01
The Main Injector Neutrino Oscillation Search (MINOS) is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory (FNAL) in Chicago, Illinois. MINOS measures neutrino interactions in two large iron-scintillator tracking/sampling calorimeters; the Near Detector on-site at FNAL and the Far Detector located in the Soudan mine in northern Minnesota. The Near Detector has recorded a large number of neutrino interactions and this high statistics dataset can be used to make precision measurements of neutrino interaction cross sections. The cross section for charged-current quasi-elastic scattering has been measured by a number of previous experiments and these measurements disagree by up to 30%. A method to select a quasi-elastic enriched sample of neutrino interactions in the MINOS Near Detector is presented and a procedure to fit the kinematic distributions of this sample and extract the quasi-elastic cross section is introduced. The accuracy and robustness of the fitting procedure is studied using mock data and finally results from fits to the MINOS Near Detector data are presented.
International Nuclear Information System (INIS)
Dorman, Mark Edward
2008-01-01
The Main Injector Neutrino Oscillation Search (MINOS) is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory (FNAL) in Chicago, Illinois. MINOS measures neutrino interactions in two large iron-scintillator tracking/sampling calorimeters; the Near Detector on-site at FNAL and the Far Detector located in the Soudan mine in northern Minnesota. The Near Detector has recorded a large number of neutrino interactions and this high statistics dataset can be used to make precision measurements of neutrino interaction cross sections. The cross section for charged-current quasi-elastic scattering has been measured by a number of previous experiments and these measurements disagree by up to 30%. A method to select a quasi-elastic enriched sample of neutrino interactions in the MINOS Near Detector is presented and a procedure to fit the kinematic distributions of this sample and extract the quasi-elastic cross section is introduced. The accuracy and robustness of the fitting procedure is studied using mock data and finally results from fits to the MINOS Near Detector data are presented
Making music out of noise. The Sentara Healthcare Experience Implementing e-Care.
Abraham, Chon; Reese, Bertram
2010-01-01
This paper describes insights from the an implementation experience with a project titled eCare, a comprehensive health IT solution integrating all environments of care and the primary business functions at Sentara Healthcare, the largest system in southeastern Virginia and northeastern North Carolina. eCare is expected to account for more than $16 million by the end of 2009, from realized benefits in quality of care, process efficiencies and firm performance. Made evident by Sentara's experience, eCare-type technology may be as much of a market differentiator for healthcare as the ATM was for banking industry, but prudent management in the implementation process is key.
Calibrating the CERN ATLAS Experiment with $E/p$
Froeschl, R; Aleksa, M
2009-01-01
Inside the ATLAS experiment two proton beams will collide with a center of mass energy of 14 TeV. These proton beams will be delivered with unprecedented high collision rates by the Large Hadron Collider (LHC) at the European Center of Particle Physics, CERN. For important parts of the physics program of ATLAS, e.g. the search for the Higgs boson, the performance of the electromagnetic calorimeter, whose primary task is to measure the energy of electrons and photons, is crucial. The main topic of this thesis is the intercalibration of the energy scale of the electromagnetic calorimeter and the momentum scale of the inner detector. This is an important consistency test for these two detectors. The intercalibration is performed by investigating the ratio E/p for electrons, i.e. the ratio of the energy E measured by the electromagnetic calorimeter and the momentum p measured by the inner detector. The starting point is the Combined Test Beam (CTB) 2004, where a segment of the ATLAS detector was exposed to differ...
Study of the granular electromagnetic calorimeter with PPDs and scintillator strips for ILC
Energy Technology Data Exchange (ETDEWEB)
Kotera, Katsushige, E-mail: coterra@azusa.shinshu-u.ac.j [Shinshu University, Asahi 3-1-1, Matsumoto 390-8621 (Japan)
2011-02-01
A prototype module of a fine-granular electromagnetic calorimeter has been constructed by the CALICE collaboration and tested in the period August-September 2008 at the FNAL meson beam test facility. The calorimeter is one of the proposed concepts for a highly granular electromagnetic calorimeter for the International Linear Collider (ILC) experiment, which is designed to have an effective 10 mmx10 mm lateral segmentation using 10 mmx45 mm scintillator strips. The strips in the 15 odd layers are orthogonal with respect to those in the 15 even layers. A total of 2160 strip scintillators are individually read out using a Pixelated Photon Detector (PPD) or MPPC. As a preliminary result of the first stage analysis, we obtain a relative energy resolution for single electrons of {sigma}{sub E}/E=(15.15{+-}0.03)%/{radical}(E{sub beam}(GeV))+(1.44{+-}0.02)%, the quoted uncertainties are purely statistical.
Providing pervasive Learning eXperiences by Combining Internet of Things and e-Learning standards
Directory of Open Access Journals (Sweden)
Aroua TAAMALLAH
2015-12-01
Full Text Available Nowadays, learning is more and more taking place anywhere and anytime. This implies that e-learning environments are expanded from only virtual learning environments to both virtual and physical ones. Thanks to the evolution of Internet, ICT (Information and Communication Technology and Internet of Things, new learning scenarios could be experienced by learners either individually or collaboratively. These learning scenarios are Pervasive in such a way that they allow to mix virtual and physical learning environments as well. They are therefore characterized by possible interactions of the learner with the physical environment, the Learner's contextual data detection as well as the adaptation of pedagogical strategies and services according to this context. This paper aims to take advantage of this trend and keep up also with existing e-Learning standards such as IMS LD and LOM. The solution proposed is therefore to extend these standards models with that of Internet of Things and to provide an adaptation approach of learning activities based on learner's context and her/his track using the eXperience API. In this context and in order to allow both reasoning capabilities and interoperability between the proposed models Ontological representations and implementation are therefore proposed. Moreover a technical architecture highlighting the required software components and their interactions is provided. And finally, a relevant pervasive learning scenario is implemented and experimented.
Fermilab Education Office - Contacts
Search The Office of Education and Public Outreach: Contacts All telephone numbers require area code Presentations for Presenters 840-3094 Office of Education and Public Outreach Spencer Pasero spasero@fnal.gov Education Office 840-3076 Fermilab Friends for Science Education General Questions Susan Dahl sdahl@fnal.gov
Directory of Open Access Journals (Sweden)
Sandoval Vilaverde Monteiro
2004-01-01
Full Text Available O principal objetivo do texto consiste em problematizar as práticas corporais vivenciadas como lazer e aventura em ambientes naturais, em especial aquelas ligadas ao montanhismo, buscando pensá-las no contexto das formas contemporâneas de sociabilidade e processos de subjetivação, indagando sobre os liames sociais suscitados a partir da relação com tais práticas. A partir dos dados provenientes do contexto dos grupos estudados, bem como do referencial teórico adotado, sustenta-se o argumento de que o envolvimento com estas práticas coletivas de lazer e aventura na natureza pode, em algumas situações, ser entendido como experiências existenciais férteis para o exercício de uma relação renovada do sujeito consigo mesmo, com o outro e com a natureza. Este exercício faculta aos sujeitos envolvidos a possibilidade de vivenciar processos renovados de subjetivação coletiva, podendo resultar em formas de amizade mais solidárias, livres e criativas. Palavras-chaves: subjetividade, amizade, lazer, natureza
Mestres do Tao: tradição, experiência e etnografia
Directory of Open Access Journals (Sweden)
José Bizerril Neto
2005-12-01
Full Text Available Neste artigo analiso a dimensão performática constitutiva da transmissão da tradição em uma linhagem taoísta no Brasil, partindo de uma perspectiva baseada na antropologia da experiência. A idéia de conhecimento no taoísmo baseia-se em uma noção pragmática: conhece-se por experiência pessoal corporificada o legado da tradição. A possibilidade de conhecer está fundada em uma relação pessoal entre mestre e aprendiz, inserida em uma cadeia dialógica e genealógica.In this article I analyse the performative dimension that constitutes the transmission of tradition in taoist lineage located in Brazil, from the perspective of the anthropology of experience. The idea of knowing in taoism is based on a practical notion: one knows the legacy of tradition through personal embodied experience. The very possibility of knowing is based upon a personal relation between master and apprentice, inserted on a dialogical and genealogical.
Leonardo Breno Martins
2012-01-01
Esta pesquisa compara pessoas que alegam experiências anômalas e que não as alegam quanto aos cinco grandes fatores da personalidade, indicadores de transtornos mentais e atribuições de causalidade. O recorte incide sobre experiências caracteristicamente contemporâneas, que mencionam objetos voadores não-identificados (óvnis) e eventos correlatos, como alegadas visões de alienígenas. As variáveis foram escolhidas para o estudo devido ao seu papel teórico na edificação das experiências e aos a...
Park, Hyejin; Moon, Mikyung; Baeg, Jung Hoon
2014-09-01
Cancer is a critical disease with a high mortality rate in the US. Although useful information exists on the Internet, many people experience difficulty finding information about cancer prevention because they have limited eHealth literacy. This study aimed to identify relationships between the level of eHealth literacy and cancer information seeking experience or prior experience with cancer screening tests. A total of 108 adults participated in this study through questionnaires. Data covering demographics, eHealth literacy, cancer information seeking experience, educational needs for cancer information searching, and previous cancer screening tests were obtained. Study findings show that the level of eHealth literacy influences cancer information seeking. Individuals with low eHealth literacy are likely to be less confident about finding cancer information. In addition, people who have a low level of eHealth literacy need more education about seeking information than do those with a higher level of eHealth literacy. However, there is no significant relationship between eHealth literacy and cancer screening tests. More people today are using the Internet for access to information to maintain good health. It is therefore critical to educate those with low eHealth literacy so they can better self-manage their health.
Search for νμ→νe oscillations in the NOMAD experiment
International Nuclear Information System (INIS)
Krasnoperov, A.
2000-06-01
The NOMAD experiment is looking for ν μ →ν τ and ν→ν e oscillations in a predominantly ν μ beam at the CERN SPS. Neutrino oscillations are closely related with the existence of non-zero neutrino mass and mixing between different flavours. This document describes the search for ν μ →ν e oscillations in the full NOMAD data sample accumulated during four years of data-taking (1995-98). The search for ν e appearance was performed by studying the charged current (CC) interactions with in the NOMAD detector. The selection of ν e CC and ν μ interactions with the help of different particle identification algorithms, as well as using the event kinematic criteria, is described here in detail. We show that the NOMAD experiment is sensitive to the LSND allowed region of oscillation parameters with the squared mass difference larger than 10 eV 2 /C 4 . An upper limit on the probability of ν μ →ν e oscillations, based on a fraction of the NOMAD data, is given. (author)
Flex-prints for the Mu3e experiment
Energy Technology Data Exchange (ETDEWEB)
Dittmeier, Sebastian [Physikalisches Institut, Universitaet Heidelberg (Germany); Collaboration: Mu3e-Collaboration
2016-07-01
Mu3e is a novel experiment dedicated to the search for the charged lepton flavor violating decay μ{sup +} → e{sup +}e{sup -}e{sup +} with a targeted sensitivity of a branching ratio (BR) down to 10{sup -16}. Within the standard model of particle physics this process is extremely suppressed to BR<10{sup -54}. Thus, any observation would be a clear sign for new physics beyond the standard model. The Mu3e detector consists of a silicon pixel tracking detector using the novel HV-MAPS (High Voltage Monolithic Active Pixel Sensor) technology to measure the momentum of the decay products, and scintillating fibres and tiles for precise timing. The pixel sensors are thinned to 50 μ m to achieve a material budget of about 0.1% radiation length per tracking layer. The pixel sensors are powered and connected to readout frontend boards using custom designed flex-prints, which are low material interconnects with a high signal density. We present studies of high speed data transmission up to 3.2 Gb/s over flex-print prototypes produced in-house. The design of the flex-prints for the Mu3e detector will be discussed. A 3-layer design including power, ground and slow control distribution, as well as 9 1.25 Gb/s data transmission lines for the readout of the pixel sensors is foreseen.
Precise measurement in elastic electron scattering: HAPPEX and E-158 experiments
International Nuclear Information System (INIS)
Vacheret, A.
2004-12-01
Parity Violation asymmetry measurements in elastic electron scattering are in one hand an interesting way of retrieving new informations about the sea quarks of the nucleon and in the other hand a powerful test of the Standard Model electroweak sector at low energy. This thesis describes the HAPPEX experiment at JLab and the E-158 experiment at SLAC (USA) which measure de parity violation asymmetries in elastic scattering of polarized electron on nuclei like Hydrogen or Helium and on atomic electrons. With the measurements on hadronic targets one can extract the strange quarks contribution to the charge and current density of the nucleon. With the electron-electron scattering one can test the standard model at the loop level and far from the Z pole by extracting sin 2 θ W . In this thesis we describe the formalism associated with the electroweak probe. We present in detail the experimental methods used to make such precise measurements of parity violation asymmetry. Then, we describe the experimental set-up of each experiment and in particular the electron detector and the feedback loop on the beam current for the HAPPEX experiment and the analysis of E-158 run III with a dedicated systematic study on the beam sub-pulse fluctuations. We present the preliminary results for each experiment with a comparison with the other existing results and the future experiments. (author)
Beam Extinction Monitoring in the Mu2e Experiment
Energy Technology Data Exchange (ETDEWEB)
Prebys, Eric [Fermilab; Bartoszek, Larry [Technicare; Gaponenko, Andrei [Fermilab; Kasper, Peter [Fermilab
2015-06-01
The Mu2e Experiment at Fermilab will search for the conversion of a muon to an electron in the field of an atomic nucleus with unprecedented sensitivity. The experiment requires a beam consisting of proton bunches approximately 200ns FW long, separated by 1.7 microseconds, with no out-of-time protons at the 10⁻¹⁰ fractional level. The verification of this level of extinction is very challenging. The proposed technique uses a special purpose spectrometer which will observe particles scattered from the production target of the experiment. The acceptance will be limited such that there will be no saturation effects from the in-time beam. The precise level and profile of the out-of-time beam can then be built up statistically, by integrating over many bunches.
Feasibility of 81Br(nu,e-)81Kr solar neutrino experiment
International Nuclear Information System (INIS)
Hurst, G.S.; Allman, S.L.; Chen, C.H.; Kramer, S.D.; Thomson, J.O.; Cleveland, B.
1985-05-01
Several ingenious solutions have been offered for the solar neutrino problem - a defect in the solar model, the appearance of a new type of neutrino physics, the sun is no longer burning, etc. The range of these proffered solutions stresses the need for a new experiment to study the sun. The modern pulsed laser now makes possible a new solar neutrino test which examines an independent neutrino source in the sun. A recently proposed experiment would use the reaction 81 Br(nu,e - ) 81 Kr to measure the flux of 7 Be neutrinos from the sun. When 7 Be decays by electron capture to make 7 Li, a neutrino is emitted at 0.862 MeV and the flux of these on the earth is about 4 x 10 9 cm -2 s -1 , according to the standard model. Therefore, an experiment based on 81 Br(nu,e - ) 81 Kr which is sensitive to these lower energy neutrinos would be of fundamental importance. To first order, the chlorine experiment detects the 8 B neutrinos while bromine detects the much more abundant 7 Be neutrino source. In practice, the proposed bromine experiment would be very similar to the chlorine radiochemical experiment, except that 81 Kr with a half-life of 2 x 10 5 years cannot be counted by decay methods. With an experiment of about the same volume as the chlorine experiment (380 m 3 ) filled with CH 2 Br 2 , the model predicts about 2 atoms of 81 Kr per day. The bromine experiment depends entirely on the RIS method, implemented with pulsed lasers, for its success. 10 refs., 3 figs
Energy Technology Data Exchange (ETDEWEB)
Lesne, V
2006-07-15
In the framework of the mSUGRA model which provides a simple breaking mechanism of supersymmetry, sparticles with masses beyond the kinematic reach of the LEP-II experiments may be produced at the Tevatron pp-bar collider at a center of mass energy of 1.96 TeV. A promising source of sparticles at the Tevatron collider is the associated production of the lightest chargino, {chi}-tilde{sub 1}{sup {+-}}, and the next to lightest neutralino, {chi}-tilde{sub 2}{sup 0}. Leptonic decay modes, {chi}-tilde{sub 2}{sup 0} {yields} {chi}-tilde{sub 1}{sup 0}l{sup +}l{sup -} and {chi}-tilde{sub 1}{sup {+-}}l{sup {+-}}{nu}{sub l}, lead to a clean detector signature with three leptons and a large amount of missing transverse energy. In order to increase the sensitivity to signal in regions of mSUGRA parameters space leading to a very soft third lepton with small reconstruction efficiency, a selection based on 2 like sign leptons plus missing transverse energy has been developed. The particular signature with 2 like sign muons is presented in this work. No evidence for supersymmetry has been observed in a dataset collected from April 2002 to February 2006 with the D0 detector at the Tevatron collider and corresponding to an integrated luminosity of 0.9 fb{sup -1}. Then, limits on the product of the cross-section and the 3-leptonic branching ratio, {sigma}(pp-bar {yields} {chi}-tilde{sub 1}{sup {+-}}{chi}-tilde{sub 2}{sup 0}) * BR(3l), have been set as a function of the {chi}-tilde{sub 1}{sup {+-}} mass. The results obtained with the like sign dimuon selection have been combined with the results of three tri-lepton selections. For mSUGRA models with enhanced leptonic decays, a {chi}-tilde{sub 1}{sup {+-}} mass limit of 140 GeV/c{sup 2} has been derived at 95% confidence level. (author)
Weak mixing and CP-violation involving heavy quarks and possible measurements in e+e- experiments
International Nuclear Information System (INIS)
Ali, A.; Aydin, Z.Z.
1978-09-01
We evaluate weak mass mixing among the neutral heavy mesons with a bottom (Q = -1/3) or top (Q = +2/3) quark and CP-violation in the frame work of six quark (V - A) models. It is argued that bottom and top mesons may distinguish the Higgs exchange mechanism of CP-violation from a complex phase in the quark mass matrix, if bottom and top quark masses are sufficiently different. Estimates of weak mixing-and CP-violating effects for e + e - experiments at PETRA, PEP and CESR energies are presented. (orig.) [de
Directory of Open Access Journals (Sweden)
Cléopâtre Montandon
2005-08-01
Full Text Available Este artigo tenta mostrar o quanto é importante estudar a experiência das crianças e seus pontos de vista para podermos compreender os diferentes fenômenos sociais que lhes dizem respeito. Na perspectiva da sociologia da infância, sua experiência é considerada no âmbito das estruturas sociais e do contexto particular nos quais se insere. A partir de vários exemplos no campo da educação de crianças, a autora argumenta que não basta examinar as práticas educativas de seus educadores, mas que é necessário compreender as perspectivas das crianças ou, dito de modo mais simples, que importa analisar não apenas o que os educadores fazem com as crianças, como também o que estas fazem com o que se faz com elas. Duas pesquisas são apresentadas para apoiar essa abordagem: a primeira diz respeito à experiência que as crianças têm de sua educação no âmbito familiar e escolar; a segunda trata de um objetivo particular dos educadores modernos: o desenvolvimento da autonomia das crianças. Em ambos os estudos, a experiência das crianças foi apreendida por intermédio de suas representações, emoções e ações, e foi situada segundo suas características sociais e culturais.This paper tries to show that the experience of children and their points of view are paramount when one wants to understand the various social phenomena that concern them. According to the perspective of the Sociology of Childhood, children's experience is analyzed in the framework of the social structures and the particular contexts in which it takes place. Using different examples from the field of the education of children, the author argues that it is not sufficient to examine the educational practices of adults; it is equally important to examine the children's perspective. In other words, we should take into consideration what the children do with what is done to them. Two studies are presented to support this approach: the first one concerns the
Experiência subjetiva do tempo e sua influência no comportamento: revisão e modelos
Directory of Open Access Journals (Sweden)
Alejandro Vásquez Echeverría
Full Text Available Pesquisadores têm tentado explicar, desde o início da psicologia, a experiência temporal das pessoas e sua influência nas cognições, emoções e comportamentos. Trata-se de uma das dimensões mais complexas e influentes da psique, que tem sido abordada a partir de concepções diferentes e sem uma estrutura consensual. Este artigo tem o objetivo de contribuir na sistematização da psicologia do tempo, ampliando um modelo de quatro níveis, aprofundando na percepção do tempo vital ou tempo III. Trabalhos incluídos foram selecionados segundo a sua importância na historia da psicologia ou índice de citação. Sugere-se um modelo explicativo do Tempo III, que inclui discussão e debate e visa integrar os diferentes modelos existentes na literatura.
Quark Energy Loss and Shadowing in Nuclear Drell-Yan Process
Institute of Scientific and Technical Information of China (English)
DUAN Chun-Gui; CUI Shu-Wen; YAN Zhan-Yuan
2005-01-01
The energy loss effect in nuclear matter is another nuclear effect apart from the nuclear effects on the parton distribution as in deep inelastic scattering process. The quark energy loss can be measured best by the nuclear dependence of the high energy nuclear Drell-Yan process. By means of three kinds of quark energy loss parameterizations given in literature and the nuclear parton distribution extracted only with lepton-nucleus deep inelastic scattering experimental data, measured Drell-Yan production cross sections are analyzed for 800 GeV proton incident on a variety of nuclear targets from FNAL E866. It is shown that our results with considering the energy loss effect are much different from those of the FNAL E866, who analyzes the experimental data with the nuclear parton distribution functions obtained by using the deep inelastic IA collisions and pA nuclear Drell-Yan data. Considering the existence of energy loss effect in Drell-Yan lepton pairs production, we suggest that the extraction of nuclear parton distribution functions should not include Drell-Yan experimental data.
Quark Energy Loss and Shadowing in Nuclear Drell-Yan Process
International Nuclear Information System (INIS)
Duan Chungui; Cui Shuwen; Yan Zhanyuan
2005-01-01
The energy loss effect in nuclear matter is another nuclear effect apart from the nuclear effects on the parton distribution as in deep inelastic scattering process. The quark energy loss can be measured best by the nuclear dependence of the high energy nuclear Drell-Yan process. By means of three kinds of quark energy loss parameterizations given in literature and the nuclear parton distribution extracted only with lepton-nucleus deep inelastic scattering experimental data, measured Drell-Yan production cross sections are analyzed for 800 GeV proton incident on a variety of nuclear targets from FNAL E866. It is shown that our results with considering the energy loss effect are much different from those of the FNAL E866, who analyzes the experimental data with the nuclear parton distribution functions obtained by using the deep inelastic lA collisions and pA nuclear Drell-Yan data. Considering the existence of energy loss effect in Drell-Yan lepton pairs production, we suggest that the extraction of nuclear parton distribution functions should not include Drell-Yan experimental data.
RF cogging in the FNAL Booster Accelerator
International Nuclear Information System (INIS)
William A. Pellico and Robert C. Webber
2000-01-01
The Fermilab Booster operates at a Radio Frequency (RF) harmonic number of 84 with beam in all buckets. One or two bunches of beam are systematically lost in the 8 GeV extraction process as beam is swept across a magnetic septum during the extraction kicker rise time. The prompt radiation and component activation resulting from this localized high energy beam loss become serious concerns as Booster beam throughput must be increased more than tenfold to meet the requirements of RUN II, NUMI, and MiniBooNE experiments. Synchronizing a gap in the beam to the firing of the extraction kickers, a relatively easy and standard practice in many machines, can eliminate the problem. This seemingly simple operation is greatly complicated in the Booster by the need to synchronize extraction to beam already circulating in the Main Injector. Coupled with the inflexibility of the Booster resonant magnetic cycle, cycle to cycle variations, and constraints inherent in the accelerator physics, that requirement forces active control of the gap's azimuthal position throughout the acceleration process as the revolution frequency sweeps rapidly. Until recently, the complexities of actually implementing and demonstrating this process in the Booster had not been worked out. This paper describes a successful demonstration of gap cogging in the Booster
Legitimidade e não legitimidade das experiências dos sofrimentos e adoecimentos de longa duração
Canesqui, Ana Maria
2018-01-01
Resumo Discute-se a legitimidade e não legitimidade das experiências de adoecimentos e sofrimentos de longa duração selecionados, considerados ou não doenças pelos diagnósticos médicos, como a dor, a fadiga crônica e a “pressão alta”, usando pesquisas internacionais e nacionais sociológicas e antropológicas em saúde. As análises dos relatos de adoecidos ou de profissionais de saúde nas pesquisas consideradas exploram o assunto, suas implicações, reflexos e ambiguidades geradas nos sujeitos e ...
Directory of Open Access Journals (Sweden)
Carlos Hubinger Tokarnia
1999-01-01
Full Text Available Em função de históricos obtidos, no presente estudo tentou-se reproduzir, em bovinos, fotossensibilização e/ou aborto com as favas de Enterolobium spp (Leg. Mimosoi-deae. As favas de E. contortisiliquum e E. timbouva ("tamboril" ou "timbaúba", de diversas procedências, inclusive as colhidas durante dois surtos de intoxicação caracterizados por fotossensiblilização e aborto, foram administradas em doses únicas e repetidas, a bovinos jovens e a vacas em gestação. Em todos os experimentos realizados, a resposta à ingestão das favas independentemente da procedência, sempre foi caracterizada por diarréia e diminuição do apetite, passageiras. Também ficou evidente que os animais mostram menor sensibilidade, à medida que ingerem as favas seguidamente. Os experimentos não revelaram possíveis fatores envolvidos ou eventuais condições necessárias para que as favas de Enterolobium contortisiliquum e E. timbouva causem fotossen-siblização e/ou aborto.The pods of Enterolobium spp (Leg.Mimosoideae are said to cause photsensitivity and abortion in cattle. The pods of E. contortisiliquum and E. timbouva ("tamboril" or "timbaúba", collected at various localities, in two occasions during outbreaks of photosensitization and abortions, were fed in single and repeated doses to young bovines and to cows in calf. In all experiments the animals showed only diarrhoea and loss of apetite, as it had been already seen in previous experiments with E. contortisiliquum performed in Fortaleza, northeastern Brazil. Also it was seen again that the animals become tolerant to the toxicity of the pods if they get successive doses. The experiments did not reveal possible conditions necessary for the pods of Enterolobium contortisiliquum and E. timbouva to cause photosensitization and/or abortion.
Etnografia como prática e experiência
Directory of Open Access Journals (Sweden)
José Guilherme Cantor Magnani
2009-12-01
Full Text Available Este artigo, a partir de alguns usos pouco ortodoxos da etnografia, fora do campo da antropologia, propõe uma discussão sobre a especificidade desse método de pesquisa, com base em pesquisas e reflexões realizadas sobre o tema no Núcleo de Antropologia Urbana da USP (NAU. Tomando como ponto de partida uma citação de Lévi-Strauss, repassa alguns autores - Goldman, Peirano, DaMatta, Favret-Saada, entre outros - para estabelecer parâmetros na busca de traços que considera específicos do fazer etnográfico e assim chega a três considerações principais: etnografia como experiência, como prática e com base numa certa noção de totalidade. O relato de uma etnografia sobre jovens surdos é apresentado para oferecer um suporte empírico àquelas conclusões.Considering some less orthodox uses of ethnography, not belonging to the anthropological field, this article proposes a discussion on the specificities of the ethnographical research method, based on reflections and researches undertaken at the Urban Anthropology Nucleus (NAU. Taking a Lévi-Strauss's quotation as its starting point, it examines the ideas of authors like Goldman, Peirano, Da Matta, Favret-Saada, among others, in order to establish parameters to guide the search for specific features in the ethnographic métier. Such a discussion leads to three considerations: ethnography as experience, as practice, and as based on a certain concept of "totality". The report of an ethnography on deaf young people is included in the article as empirical support to the conclusions.
International Nuclear Information System (INIS)
Lanou, R.E. Jr.; Cutts, D.
1987-01-01
An experimental program in strong and electro-weak interaction physics of elementary particles is being carried out using electronic detection techniques. Experiments have been performed at Brown, Brookhaven, Fermilab and SLAC. The work described in this report by the Electronic Detector Group addresses the following: (1) electroweak parameters via neutrino interactions, (2) preparations for experiments (''D-ZERO'') at the FNAL 2 TeV anti pp Collider, (3) neutrino properties, and (4) study of the charm system
Directory of Open Access Journals (Sweden)
Yeimi Alexandra Alzate López
2014-10-01
Full Text Available O artigo analisa as experiências de enfermidade de pacientes com leucemia mieloide crônica (LMC, centrando nas dimensões que apontam a chegada da doença como uma ruptura biográfica. Este estudo qualitativo baseou-se na análise das narrativas de seis pacientes, com idades entre 23 e 62 anos, usuários do Sistema Único de Saúde (SUS e pacientes de um hospital – centro de referência em atenção hematológica na cidade de Salvador, Bahia, Brasil. Nos resultados apresenta-se a experiência de ruptura com base em três categorias (1 os significados da doença e a LMC como ameaça; (2 rupturas físicas, sociais e as experiências estigmatizantes; (3 a percepção de um “antes” e um “depois” da LMC, apontando para as mudanças no self, nas relações sociais e na vida cotidiana. Concluiu-se que os impactos biográficos, sociais e dos sistemas de saúde (considerando o custo das medicações atualizam e ampliam questões como o acesso a tratamentos, assim como o enfrentamento do certo e do incerto, em que o “conhecido” da LMC encontra-se pouco acessível ao estoque de conhecimento da vida cotidiana.
Energy Technology Data Exchange (ETDEWEB)
Krasnoperov, A
2000-06-01
The NOMAD experiment is looking for {nu}{sub {mu}}{yields}{nu}{sub {tau}} and {nu}{yields}{nu}{sub e} oscillations in a predominantly {nu}{sub {mu}} beam at the CERN SPS. Neutrino oscillations are closely related with the existence of non-zero neutrino mass and mixing between different flavours. This document describes the search for {nu}{sub {mu}}{yields}{nu}{sub e} oscillations in the full NOMAD data sample accumulated during four years of data-taking (1995-98). The search for {nu}{sub e} appearance was performed by studying the charged current (CC) interactions with in the NOMAD detector. The selection of {nu}{sub e} CC and {nu}{sub {mu}} interactions with the help of different particle identification algorithms, as well as using the event kinematic criteria, is described here in detail. We show that the NOMAD experiment is sensitive to the LSND allowed region of oscillation parameters with the squared mass difference larger than 10 eV{sup 2}/C{sup 4}. An upper limit on the probability of {nu}{sub {mu}}{yields}{nu}{sub e} oscillations, based on a fraction of the NOMAD data, is given. (author)
CERN. Geneva; BONFILLOU, Eric; Dr. WIEBALCK, Arne
2015-01-01
The HEPiX forum brings together worldwide Information Technology staff, including system administrators, system engineers, and managers from the High Energy Physics and Nuclear Physics laboratories and institutes, to foster a learning and sharing experience between sites facing scientific computing and data challenges. Participating sites include BNL, CERN, DESY, FNAL, IN2P3, INFN, JLAB, NIKHEF, RAL, SLAC, TRIUMF and many others.
Summary of the HEPiX autumn meeting
CERN. Geneva; VALSAN, Liviu; Dr. WIEBALCK, Arne
2014-01-01
The HEPiX forum brings together worldwide Information Technology staff, including system administrators, system engineers, and managers from the High Energy Physics and Nuclear Physics laboratories and institutes, to foster a learning and sharing experience between sites facing scientific computing and data challenges. Participating sites include BNL, CERN, DESY, FNAL, IN2P3, INFN, JLAB, NIKHEF, RAL, SLAC, TRIUMF and many others.
Barikbin, Behrooz; Khodamrdi, Zeinab; Kholoosi, Leila; Akhgri, Mohammad Reza; Haj Abbasi, Majid; Hajabbasi, Mojgan; Razzaghi, Zahra; Akbarpour, Samaneh
2017-05-17
This study aimed to evaluate the effectiveness of a combined set of low level diode laser scanner (665 nm and 808nm) on hair growth, and assessment of safety and effectiveness of a new laser scanner on hair growth treatment procedure in androgenic alopecia. 90 patients (18 to 70 years) with androgenic alopecia were randomized into three groups. The first group (n=30) received 655 nm red light using laser hat, the second group (n=30) received 655 nm red laser plus 808 nm infrared laser using a laser scanner of hair growth device (with the patent number: 77733) and the third group (n=30) received no laser as the control group. Patients in laser scanner group had better results and showed a higher increase in terminal hair density compared with laser hat group (mean of 9.61 versus 9.16 per cm 2 ). We found significant decrease in terminal hair density from baseline in control group (mean -1.8 per cm 2 , plaser scanner of the hair growth group compared with laser hat and the control group. The study showed that treatment with new laser devise had a promising result without any observable adverse effects.
Seiberg duality and e+e- experiments
International Nuclear Information System (INIS)
De Gouvea, Andre; Friedland, Alexander; Murayama, Hitoshi
1998-01-01
Seiberg duality in supersymmetric gauge theories is the claim that two different theories describe the same physics in the infrared limit. However, one cannot easily work out physical quantities in strongly coupled theories and hence it has been difficult to compare the physics of the electric and magnetic theories. In order to gain more insight into the equivalence of two theories, we study the ''e + e - '' cross sections into ''hadrons'' for both theories in the superconformal window. We describe a technique which allows us to compute the cross sections exactly in the infrared limit. They are indeed equal in the low-energy limit and the equality is guaranteed because of the anomaly matching condition. The ultraviolet behavior of the total ''e + e - '' cross section is different for the two theories. We comment on proposed nonsupersymmetric dualities. We also analyze the agreement of the ''γγ'' and ''WW'' scattering amplitudes in both theories, and in particular try to understand if their equivalence can be explained by the anomaly matching condition
Book Review "Advances on remote laboratories and e-learning experiences"
Directory of Open Access Journals (Sweden)
Jesús A. del Alamo
2007-08-01
Full Text Available Book Review "Advances on remote laboratories and e-learning experiences", book editors: Luís Gomes and Javier García-Zubía, University of Deusto, Spain. Reviewed by Jesús A. del Alamo, Massachusetts Institute of Technology, M.I.T.
Muon Intensity Increase by Wedge Absorbers for Low-E Muon Experiments
Energy Technology Data Exchange (ETDEWEB)
Neuffer, D. V. [Fermilab; Stratakis, D. [Fermilab; Bradley, J. [Fermilab
2017-09-01
Low energy muon experiments such as mu2e and g-2 have a limited energy spread acceptance. Following techniques developed in muon cooling studies and the MICE experiment, the number of muons within the desired energy spread can be increased by the matched use of wedge absorbers. More generally, the phase space of muon beams can be manipulated by absorbers in beam transport lines. Applications with simulation results are presented.
Status of soft photons in experiment E855
International Nuclear Information System (INIS)
Woody, C.; Lissauer, D.; Gomez del Campo, J.; Ray, A.; Shapira, D.; Tincknell, M.; Clark, R.; Erd, C.; Schukraft, J.; Willis, W.
1990-01-01
Experiment E855 was carried out at the AGS at Brookhaven National Laboratory to study soft photon production near center of mass rapidity Y cm ∼ 0 in proton-nucleus collisions at 10 at 18 GeV/c. This was the first dedicated experiment to study this phenomenon at these lower energies. It is important to note that the related process of low mass dilepton pair production has been studied extensively at these energies and an excess signal of dileptons above known hadronic backgrounds has been firmly established. E855 was designed to measure photon production from P t ∼ 5 MeV/c up to several GeV/c. A search will be made for an excess of soft photons in the P t region below the Jacobian peak from π 0 decays, above that which is expected from hadronic bremsstrahlung. Any observed signal will be correlated with the total charged multiplicity in the event in order to determine its production mechanism. This correlation can be used to distinguish purely hadronic sources of soft photons, such as mesons decays and bremsstrahlung, which vary linearly with the charged multiplicity, and a thermal source of soft photons which would exhibit a quadratic dependence on the charged multiplicity. In addition, E855 will measure low energy photons from nuclear decays which can be a background for measuring soft photons near Y cm ∼ 0. These photons are also interesting from a nuclear physics point of view, since the spectrum of photons from nuclei excited by incident high energy protons gives a measure of the temperature of the excited nucleus and the amount of excitation energy which can be transferred to a nucleus in a high energy proton collision
Li, Honglei; Aham-Anyanwu, Nnanyelugo; Tevrizci, Cemal; Luo, Xin
2015-01-01
This research aims to investigate the process and factors relevant for developing customer e-loyalty from an e-service quality experience perspective. Based on previously published loyalty studies and e-commerce literature, an integrated model of e-loyalty development process is proposed by including and validating value perception and the e-service quality scale eTailQ scale. The eTailQ scale consists of website design, security/privacy, value perception, reliability and customer support and...
User Experience: essencial no projeto de produtos e serviços
Directory of Open Access Journals (Sweden)
Antonio Mendes Silva Filho
2012-03-01
Full Text Available Simplicidade é um desejo inconsciente buscado pelo ser humano quando utiliza um produto para executar uma tarefa. Simplicidade é um objetivo de projeto que todo projetista deve ter em mente quando projeta um novo produto. O projetista deve se colocar no lugar do usuário do produto, buscando entender se as funcionalidades implementadas pelo sistema e a maneira pela qual elas podem ser acessadas são facilmente assimiladas pelos usuários. Ter essa preocupação é considerar a usabilidade como determinante no processo de desenvolvimento de um produto ou sistema. Essa atitude impacta diretamente sobre a aceitabilidade e sucesso do produto. Este artigo aborda como a experiência do usuário (user experience é essencial no desenvolvimento de novos produtos.
Fernandes, Marcos Gimenes; Nunes, Sandra Adriana Neves; Raposo, José Vasconcelos; Fernandes, Helder Miguel
2014-01-01
O presente estudo teve os seguintes objetivos: i) examinar as correlações inter-escalas entre as três dimensões de respostas (intensidade, direção e frequência) do CSAI-2R e sua relação com a experiência competitiva; e ii) verificar o efeito da experiência competitiva na ansiedade (cognitiva e somática) e na autoconfiança na amostra total e em função de diferentes tipos de modalidades (individuais vs. coletivas). A amostra foi composta por 267 atletas (196 do sexo masculino e 71 do sexo femin...
Tempo e Trânsito na Experiência Subjetiva de Motoristas
Directory of Open Access Journals (Sweden)
Ana Inez Oka Elvas de Lima
2015-03-01
Full Text Available Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas discussões grupais utilizaram-se os critérios da Análise Clássica de Conteúdo. Os resultados levaram à conclusão de que a questão do tempo e da pressa constitui um potencial gerador de erros e violações na condução de veículos, pois exerce influência decisiva sobre os comportamentos dos motoristas e configura uma realidade importante para se compreender os fatores humanos envolvidos na dinâmica do trânsito e do ambiente urbano como um todo.
“Aniversário Guanabara”: comunicação, consumo e experiência comum
Directory of Open Access Journals (Sweden)
João Luis de Araújo Maia
2015-12-01
Full Text Available Neste artigo, discutimos como experiências de consumo podem compreender muito mais que a simples venda e aquisição de bens ou serviços. Nosso foco está na experiência vivida de forma compartilhada, onde o desejo de estar junto, em meio à multidão, ganha mais destaque e relevância que a prática econômica do consumo. No evento “Aniversário Guanabara”, comprar barato é apenas um dos dados que orientam os consumidores. Tocar-se, esbarrar-se e vivenciar a confusão nos corredores do supermercado assumem um caráter de divertimento e prazer para muitos que ali estão.
Midlatitude Continental Convective Clouds Experiment (MC3E)
Energy Technology Data Exchange (ETDEWEB)
Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E
2010-04-10
The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the April–May 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administration’s (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States, combined with an extensive sounding array, remote sensing and in situ aircraft observations, NASA GPM ground validation remote sensors, and new ARM instrumentation purchased with American Recovery and Reinvestment Act funding. The overarching goal is to provide the most complete characterization of convective cloud systems, precipitation, and the environment that has ever been obtained, providing constraints for model cumulus parameterizations and space-based rainfall retrieval algorithms over land that have never before been available.
Women's expectations and experiences regarding e-health treatment: A systematic review.
Verhoeks, Carmen; Teunissen, Doreth; van der Stelt-Steenbergen, Anke; Lagro-Janssen, Antoine
2017-08-01
There is a gap in knowledge of women's perceptions of e-health treatment. This review aims to investigate women's expectations and experiences regarding e-health. A search was conducted in MEDLINE, EMBASE, CINAHL and PsycInfo in March 2016. We included articles published between 2000 and March 2016, reporting on e-health interventions. The initial search yielded 2987 articles. Eventually, 16 articles reporting on 16 studies were included. Barriers to e-health treatment were lower for women than barriers to face-to-face treatment, such as feelings of shame and time constraints. Women were able to develop an online therapeutic relationship. As reduced feelings of obligation and lack of motivation were women's greatest challenges in completing e-health treatment, they expressed a wish for more support during e-health treatment, preferably blended care. e-Health lowers the threshold for women to seek healthcare. Combining e-health interventions with face-to-face sessions may enhance women's motivation to complete treatment.
Pixel sensor evaluation and online event selection for the Mu3e experiment
Energy Technology Data Exchange (ETDEWEB)
Bruch, Dorothea vom
2017-10-27
Despite having survived numerous experimental tests, the standard model of particle physics is not a complete description of nature. The Mu3e experiment tests theories beyond the standard model by searching for the lepton flavour violating decay μ→e{sup +}e{sup -}e{sup +}, aiming at a branching ratio sensitivity of 2.10{sup -15} in a first phase of the experiment. A high precision magnetic spectrometer combined with scintillation detectors will measure the momenta, vertices and timing of the decay products of 1.10{sup 8} μ/s stopped on a target. In this work, a prototype of the high voltage monolithic active pixel sensor envisaged for the spectrometer was characterised. With an efficiency >99% and a time resolution of 14 ns, it meets the requirements imposed on the final sensor. Furthermore, an online signal selection process was developed and implemented on a graphics processing unit (GPU), keeping 98% of signal decays, while reducing the data rate of 80 Gbit/s by a factor of 140; resulting in a rate that can be stored to disk. With the computing performance achieved on the GPU, the selection process can run on the hardware planned for the experiment. Both the online selection and the silicon sensor are key aspects for the success of Mu3e.
Inclusive (e,e'N), (e,e'NN), (e,e'π),... reactions in nuclei
International Nuclear Information System (INIS)
Gil, A.; Oset, E.
1997-01-01
We study the inclusive (e,e'N), (e,e'NN), (e,e'π), (e,e'πN) reactions in nuclei using a Monte Carlo simulation method to treat the multichannel problem of the final state. The input consists of reaction probabilities for the different steps evaluated using microscopical many body methods. We obtain a good agreement with experiment in some channels where there is data and make predictions for other channels which are presently under investigation in several electron laboratories. The comparison of the theoretical results with experiment for several kinematical conditions and diverse channels can serve to learn about different physical processes occurring in the reaction. The potential of this theoretical tool to make prospections for possible experiments, aiming at pinning down certain reaction probabilities, is also emphasized. (orig.)
"Nicarágua na encruzilhada": Cortázar, Vargas Llosa e a experiência sandinista
Directory of Open Access Journals (Sweden)
Adriane Vidal Costa
2009-12-01
Full Text Available No final dos anos 1970 e início dos 80, Julio Cortázar e Mario Vargas Llosa compararam a Nicarágua sandinista com a Cuba de Fidel Castro, colocando em dia o debate sobre a revolução e o socialismo na América Latina. O presente trabalho analisa os artigos de Cortázar e Vargas Llosa para mostrar como eles compreenderam e traduziram a experiência sandinista. Em fins dos anos 1970, muitos intelectuais passaram a defender a Revolução Sandinista, como a possível revolução ideal ou uma nova chance para a experiência socialista na América Latina, como foi o caso de Cortázar. Vargas Llosa, desencantado com as esquerdas, apontava os "erros" do regime que poderiam levar a experiência sandinista a transformar o país centro-americano em uma "nova Cuba".
Directory of Open Access Journals (Sweden)
Monica Grin
2011-09-01
Full Text Available O presente artigo busca tratar comparativamente duas experiências recentes de reserva de vagas em universidades públicas, nos EUA e no Brasil, que utilizaram o critério racial, e seus impactos na opinião pública. Trata-se, no primeiro caso, da pioneira introdução de cotas para negros na UERJ, em janeiro de 2003; e, no segundo, da decisão da Suprema Corte norte-americana envolvendo a graduação (college e a Escola de Direito (Law School da Universidade de Michigan, em junho de 2003. Como hipótese inicial, sugiro que as duas experiências de cotas raciais em universidades públicas, ainda que assemelhadas, ativam princípios sociológicos, éticos e jurídicos substantivamente diferenciados.
An example of e-p colliding machine experiments at TRISTAN
International Nuclear Information System (INIS)
1980-01-01
This is a design report of a possible detector system of the e-p colliding machine experiment at TRISTAN. The aim of this note is to know what kind of detectors should be developed and what kind of requirements the TRISTAN machines and the environmental supporting facilities should fulfill. (author)
Energy Technology Data Exchange (ETDEWEB)
Varelas, Nikos [Univ. of Rochester, NY (United States)
1994-01-01
The inclusive $\\pi^0$ cross section in 520 GeV/c $\\pi^-$ Be and $\\pi^-$ Cu interactions has been measured as a function of transverse momentum and rapidity, using the E706 spectrometer at FNAL. The production of $\\pi^0$ s was studied using = 5.2 events/pb of $\\pi^-$ Be data and = 0.84 events/pb of $\\pi^-$ Cu data collected during the 1990 run of the E706 experiment. This data sample represents an order of magnitude increase in statistics over the data recorded during the initial run of the experiment in 1988. The $\\pi^0$ decay photons were detected by a finely segmented liquid argon electromagnetic calorimeter. The $\\pi^0$ cross section was measured for transverse momenta between 3.5 and 10 GeV/c and rapidities between -0.75 and 0.75. From the data on Be and Cu, we have extracted the nuclear dependence of $\\pi^0$ production. The measurements are compared with earlier results, as well as with recent next-to-leading-log calculations from Quantum Chromodynamics (QCD).
Public gaming: eSport and event marketing in the experience economy
Borowy, Michael
2012-01-01
This thesis situates organized competitive digital gaming (eSport) in the context of historical sport, the rise of the computer and video games industry, event marketing, and the experience economy. It argues that the oftentimes misattributed origins of eSport in truth first took place during the early 1980s in arcades, when the various criteria for sport, including public contest, a structured framework for victory and defeat, mediatization and promotion, professionalization, record-keeping,...
2010-10-01
... margaritaceus. uloulo-gatala, patagaloa surge wrasse Thalassoma purpureum. lape-moana red ribbon wrasse... undulated moray eel Gymnothorax undulatus. Octopodidae (Octopus) fe'e fe'e octopus octopus Octopus cyanea, Octopus ornatus. Polynemidae umiumia, i'ausi threadfin Polydactylus sexfilis. Pricanthidae (Bigeye...
Capital social e qualidade da atenção à saúde: as experiências do Brasil e da Catalunha
Directory of Open Access Journals (Sweden)
Selma Cristina Franco
2013-07-01
Full Text Available Os diferentes modelos de gestão da saúde refletem as concepções que os embasam e seus arranjos institucionais podem propiciar o aprimoramento da política de saúde. O presente artigo objetiva fazer uma reflexão sobre as potencialidades e os limites da estrutura organizacional e do capital social para produzirem mudanças no desempenho das organizações públicas de saúde na busca de melhor qualidade assistencial. A descrição e a análise de duas experiências de organização de sistemas públicos de saúde universais, na Catalunha e no Brasil, mostram similaridades nos marcos legais, porém com uma diversidade de caminhos trilhados, que deu origem a experiências distintas de gestão, uma priorizando a organização gerencial e a outra o protagonismo de atores sociais promovendo a institucionalização do capital social. Sugere-se que em modelos de gestão onde há diálogo entre um desenho organizacional eficiente e participação cidadã capaz de construir capital social, pode-se promover mudanças na cultura organizacional em prol da qualidade assistencial.
O caminho, a experiência e a aventura
Directory of Open Access Journals (Sweden)
Marcelo Rodrigues Souza Ribeiro
2009-01-01
Full Text Available http://dx.doi.org/10.5007/2178-4582.2009v43n1p265 Acompanhando o itinerário demarcado pelas palavras do título, o artigo se divide em quatro partes. Na primeira, após um prelúdio sobre os escritos de Georg Simmel, o tema do milagre do caminho como diferença do humano em relação ao animal orienta, por meio de uma interrogação histórica, um questionamento sobre o conceito de vida na modernidade. Na segunda, a questão da modernidade é desdobrada em torno do motivo da destruição ou expropriação da experiência, tal como discutido por Simmel e Walter Benjamin (entre outros. Na terceira, uma leitura de A aventura, ensaio de 1911 de Simmel, possibilita interrogar a colonialidade como condição da modernidade. Na quarta, retomando a questão da diferença entre humano e animal em relação à discussão sobre aventura, colonialidade e modernidade, esboça-se uma compreensão do conjunto das narrativas de Tarzan como exemplo paradigmático de narrativas de aventura coloniais-modernas que, ademais, articulam discursos sobre a diferença entre humano e animal.
Fast optical readout for Mu3e experiment
Energy Technology Data Exchange (ETDEWEB)
Huang, Qinhua [Institut fuer Kernphysik, Universitaet Mainz, Mainz (Germany); Collaboration: Mu3e-Collaboration
2016-07-01
Charged lepton flavour violation is highly suppressed in the Standard Model, which results in a prediction for the branching ratio of μ{sup +}→e{sup +}e{sup +}e{sup -} below O(10{sup -54}). The Mu3e experiment will search for this rare decay with a sensitivity of 10{sup -16}. An observation would be a clear sign for new physics. A high muon stopping rate of 2.10{sup 9} Hz is required so that sufficient statistics can be accumulated in about one year of data taking. The high event rate and the requirement of a full online track reconstruction demand a fast readout system which should provide a bandwidth above 1 Tbit/s. Reconfigurable devices, namely FPGAs, can easily parallelise the data processing, so it becomes possible to sort, merge, pack and route the data with low latency at high throughput. Optical fibres are the only option for the interconnection between different FPGA-based boards. The fibres also reduce the crosstalk and signal attenuation, especially over long distance links. As part of the readout system prototyping, firmware for synchronous merging of different data streams is being developed. In addition, the optical links have been tested and show a bit error rate below O(10{sup -16}) at 6.4 Gbit/s for a single fibre.
Kim, Hyoshin; Davis, Andrew H; Dohack, Jaime L; Clark, Pamela I
2017-02-01
To gain a better understanding of electronic cigarette (e-cigarette) use behavior and experience among adult e-cigarette users, with the goal of informing development of future e-cigarette use measures. Between August and October 2014 six focus groups were conducted in Seattle. Participants (63% male; 60% >35 years old; 60% White): e-cigarette users who used combustible tobacco products either currently or in the past. E-cigarette discussion topics covered: their daily use pattern (eg, frequency), product-related characteristics (eg, nicotine levels), and perceptions about health risks and benefits. Participants' descriptions of daily use were so varied that no common "unit" of a "session" easily summarized frequency or quantity of typical e-cigarette use. Most users had difficulty in tracking their own use. Participants reported nicotine craving relief when using e-cigarettes, but described e-cigarettes use as less satisfying than combustible cigarettes. Valued characteristics included "ready availability" and the possibility of using indoors. A unique aspect of the e-cigarette use experience is the option of adding flavors and having the ability to exhale "big clouds" of vapor/aerosol. Most perceived e-cigarettes as a better and safer alternative to conventional cigarettes, yet still sought further information about health consequences and safety of e-cigarettes from trusted sources. E-cigarettes users are far from homogeneous in their behavior and motivation for adopting e-cigarettes. A range of use patterns arising from both hedonic and utilitarian factors, along with product characteristics (eg, variable nicotine levels and flavors) extending beyond those of conventional cigarettes, suggest that new, specific e-cigarette use measures must be developed. The current study provides timely information on adult e-cigarette use behavior, which is a crucial step in measuring this new phenomenon and assessing the risks associated with using e-cigarette products. Our
Real remote physics experiments across Internet-- inherent part of Integrated e-Learning
Directory of Open Access Journals (Sweden)
Frantisek Lustig
2008-05-01
Full Text Available Abstract— The implementation of the real remote experiments across the Internet into teaching process, up till now not available, enables introduction of Integrated e-Learning, composed of three components: the real remote experiments across the Internet, the simulation applets and the electronic interactive textbooks. We present here the prospective remote laboratory system with data transfer using Intelligent School Experimental System (ISES as hardware and ISES WEB Control kit as software. This approach enables the simple construction of remote experiments without building any hardware and virtually no programming, only with paste and copy approach of pre-built typical blocks as camera view, controls, graphs, displays etc. In conclusion we summarize the achieved experience with remote experiments.
Guerra, Manuel Pereira Rodrigues
2011-01-01
Este trabalho Cria e Recria a Forma e Vazio com Fantasia e Imaginação,apresentando uma forte ligação entre a Forma e Vazio. Considerando mesmo,que o vazio é forma e a forma é vazio,por outro lado, é no vazio que as formas acontecem. Além das experiências que foram desenvolvidas individualmente, também trabalhei conjuntamente em grupos com os alunos. Este trabalho ajudou a uma boa cooperação entre o professor e os alunos. Estas experiências demonstram, que os pedagogos, os professores devem da...
Bringing back the book through digital experiences: e-Books and ...
African Journals Online (AJOL)
Bringing back the book through digital experiences: e-Books and digital media as platforms for reading among school children. ... for technology has changed the format of books and reading platforms from print to ereaders. ... print. Findings further showed that there is no significant difference in the attitude of boys and girls ...
The LYSO crystal calorimeter for the Mu2e experiment
International Nuclear Information System (INIS)
Pezzullo, G; Cervelli, F; Budagov, J; Davydov, Yu; Glagolev, V; Carosi, R; Cheng, C; Echenard, B; Hitlin, D; Ongmonkolkul, P; Porter, F; Cordelli, M; Corradi, G; Giovannella, S; Happacher, F; Luca, A; Martini, M; Miscetti, S; Saputi, A; Murat, P
2014-01-01
The Mu2e experiment at Fermilab searches the neutrino-less conversion of the muon into electron in the field of an Aluminum nucleus. If such a process will be observed, it will be a proof of the charged-lepton-flavor-violation (cLFV), otherwise Mu2e will set an upper limit of R μe < 6 × 10 −17 @ 90% C.L. (which represents an improvement by 3–4 order of magnitude over the existing limit). The Mu2e detector apparatus consists of a magnetic spectrometer, devoted to the measurement of the electrons momentum, and an electromagnetic calorimeter (EMC) which provides an independent measurement of the electron energy, time and position, used for validating or rejecting candidate tracks selected by the tracking system. In this paper, we describe the baseline project of the EMC and present results in terms of performances and R and D
Directory of Open Access Journals (Sweden)
Irma de Oliveira
2000-06-01
Full Text Available O presente estudo foi realizado com mães acompanhantes em um hospital escola. Os objetivos foram: compreender as interações vivenciadas, identificar os significados que o familiar acompanhante atribui à experiência de vivenciar a hospitalização da criança, identificar o que essa vivência provoca na vida do familiar e construir um modelo teórico representativo da experiência. Utilizou-se como Referencial Teórico o Interacionismo Simbólico e Referencial Metodológico a "Grounded Theory". Identificou-se os fenômenos Indo em busca de solução e Atravessando uma situação difícil. A partir desses fenômenos emergiu a categoria central Vivenciando com o filho uma passagem difícil e reveladora.This study was conducted with live-in mother in university hospital. The objectives were as follows: to understand the experienced interactions, to identify the meanings that a family attribute to the experience of going through the child's hospitalization, to identify what the experience of hospitalization provokes in the family life and construct a model theory representative of the experience. Reference Theory the Symbolic Interactionism and Reference Methodology Grounded Theory had been utilized. From results appeared the phenomenon Going in search of solution, and Going through a difficult situation. Through these phenomena, the main category Experiencing a difficult and revealing passage with her child was identified.
Energy Technology Data Exchange (ETDEWEB)
Lesne, Vincent [Blaise Pascal Univ, Aubiere (France)
2006-07-01
Dans le cadre du modele mSUGRA qui decrit un mecanisme de brisure simple de la supersym etrie, des sparticules avec des masses au-del a des limites fixees par les experiences de LEP II peuvent etre produites au Tevatron, collisionneur p$\\bar{p}$ delivrant une energie de 1.96 TeV dans le centre de masse. Un canal privilegie pour la d´ecouverte de la supersymetrie au Tevatron est la production associee du plus leger chargino, $\\tilde{χ}$$±\\atop{1}$ , et du second plus leger neutralino, $\\tilde{χ}$$0\\atop{2}$ . Les modes de desintegration leptoniques, $\\tilde{χ}$$0\\atop{2}$ → $\\tilde{χ}$$0\\atop{1}$ ℓ+ℓ- et $\\tilde{χ}$$±\\atop{1}$ → $\\tilde{χ}$$0\\atop{1}$ ℓ±νl, conduisent a une signature claire avec trois leptons et un quantite significative d’energie transverse manquante.
E-st@r-I experience: Valuable knowledge for improving the e-st@r-II design
Corpino, S.; Obiols-Rabasa, G.; Mozzillo, R.; Nichele, F.
2016-04-01
Many universities all over the world have now established hands-on education programs based on CubeSats. These small and cheap platforms are becoming more and more attractive also for other-than-educational missions, such as technology demonstration, science applications, and Earth observation. This new paradigm requires the development of adequate technology to increase CubeSat performance and mission reliability, because educationally-driven missions have often failed. In 2013 the ESA Education Office launched the Fly Your Satellite! Programme which aims at increasing CubeSat mission reliability through several actions: to improve design implementation, to define best practices for conducting the verification process, and to make the CubeSat community aware of the importance of verification. Within this framework, the CubeSat team at Politecnico di Torino developed the e-st@r-II CubeSat as follow-on of the e-st@r-I satellite, launched in 2012 on the VEGA Maiden Flight. E-st@r-I and e-st@r-II are both 1U satellites with educational and technology demonstration objectives: to give hands-on experience to university students and to test an active attitude determination and control system based on inertial and magnetic measurements with magnetic actuation. This paper describes the know-how gained thanks to the e-st@r-I mission, and how this heritage has been translated into the improvement of the new CubeSat in several areas and lifecycle phases. The CubeSat design has been reviewed to reduce the complexity of the assembly procedure and to deal with possible failures of the on-board computer, for example re-coding the software in the communications subsystem. New procedures have been designed and assessed for the verification campaign accordingly to ECSS rules and with the support of ESA specialists. Different operative modes have been implemented to handle some anomalies observed during the operations of the first satellite. A new version of the on-board software is
Directory of Open Access Journals (Sweden)
Daisy Maria Rizatto Tronchin
2015-12-01
Full Text Available RESUMO Objetivo Descrever a experiência no planejamento e desenvolvimento de um Curso de Atualização On-Line em Gerenciamento em Enfermagem destinado a enfermeiros nos contextos Brasil e Portugal. Método O desenho instrucional do Curso fundamentou-se na Teoria da Aprendizagem Significativa, na Andragogia e na Metodologia Dialética, valorizando a interação entre os atores e privilegiando os cenários de prática e a aplicação dos conceitos abordados. Resultados O Curso está estruturado em nove unidades teóricas, quatro estudos de caso e prova dissertativa. Foi avaliado positivamente pelos participantes, os quais referiram oportunidades de aquisição de novos conhecimentos; interação e intercâmbio de experiência; motivação em estudar os temas e autoaprendizagem. Conclusão Espera-se que a experiência descrita estimule a proposição de novos cursos e programas na modalidade de Educação a Distância, incrementando os processos de ensino e de aprendizagem para subsidiar análises futuras do seu impacto no desenvolvimento e no aprimoramento de competências gerenciais em enfermagem.
Test of the Behavioral Perspective Model in the Context of an E-Mail Marketing Experiment
Sigurdsson, Valdimar; Menon, R. G. Vishnu; Sigurdarson, Johannes Pall; Kristjansson, Jon Skafti; Foxall, Gordon R.
2013-01-01
An e-mail marketing experiment based on the behavioral perspective model was conducted to investigate consumer choice. Conversion e-mails were sent to two groups from the same marketing database of registered consumers interested in children's books. The experiment was based on A-B-A-C-A and A-C-A-B-A withdrawal designs and consisted of sending B…
The Material Plasma Exposure eXperiment (MPEX)
Rapp, J.; Biewer, T. M.; Bigelow, T. S.; Canik, J.; Caughman, J. B. O.; Duckworth, R. C.; Goulding, R. H.; Hillis, D. L.; Lore, J. D.; Lumsdaine, A.; McGinnis, W. D.; Meitner, S. J.; Owen, L. W.; Shaw, G. C.; Luo, G.-N.
2014-10-01
Next generation plasma generators have to be able to access the plasma conditions expected on the divertor targets in ITER and future devices. The Material Plasma Exposure eXperiment (MPEX) will address this regime with electron temperatures of 1--10 eV and electron densities of 1021--1020 m-3. The resulting heat fluxes are about 10 MW/m2. MPEX is designed to deliver those plasma conditions with a novel Radio Frequency plasma source able to produce high density plasmas and heat electron and ions separately with Electron Bernstein Wave (EBW) heating and Ion Cyclotron Resonance Heating (ICRH). Preliminary modeling has been used for pre-design studies of MPEX. MPEX will be capable to expose neutron irradiated samples. In this concept targets will be irradiated in ORNL's High Flux Isotope Reactor (HFIR) or possibly at the Spallation Neutron Source (SNS) and then subsequently (after a sufficient long cool-down period) exposed to fusion reactor relevant plasmas in MPEX. The current state of the pre-design of MPEX including the concept of handling irradiated samples will be presented. ORNL is managed by UT-Battelle, LLC, for the U.S. DOE under Contract DE-AC-05-00OR22725.
eXframe: reusable framework for storage, analysis and visualization of genomics experiments
Directory of Open Access Journals (Sweden)
Sinha Amit U
2011-11-01
Full Text Available Abstract Background Genome-wide experiments are routinely conducted to measure gene expression, DNA-protein interactions and epigenetic status. Structured metadata for these experiments is imperative for a complete understanding of experimental conditions, to enable consistent data processing and to allow retrieval, comparison, and integration of experimental results. Even though several repositories have been developed for genomics data, only a few provide annotation of samples and assays using controlled vocabularies. Moreover, many of them are tailored for a single type of technology or measurement and do not support the integration of multiple data types. Results We have developed eXframe - a reusable web-based framework for genomics experiments that provides 1 the ability to publish structured data compliant with accepted standards 2 support for multiple data types including microarrays and next generation sequencing 3 query, analysis and visualization integration tools (enabled by consistent processing of the raw data and annotation of samples and is available as open-source software. We present two case studies where this software is currently being used to build repositories of genomics experiments - one contains data from hematopoietic stem cells and another from Parkinson's disease patients. Conclusion The web-based framework eXframe offers structured annotation of experiments as well as uniform processing and storage of molecular data from microarray and next generation sequencing platforms. The framework allows users to query and integrate information across species, technologies, measurement types and experimental conditions. Our framework is reusable and freely modifiable - other groups or institutions can deploy their own custom web-based repositories based on this software. It is interoperable with the most important data formats in this domain. We hope that other groups will not only use eXframe, but also contribute their own
Quality Assurance on Undoped CsI Crystals for the Mu2e Experiment
Atanov, N.; Baranov, V.; Budagov, J.; Davydov, Yu. I.; Glagolev, V.; Tereshchenko, V.; Usubov, Z.; Cervelli, F.; Di Falco, S.; Donati, S.; Morescalchi, L.; Pedreschi, E.; Pezzullo, G.; Raffaelli, F.; Spinella, F.; Colao, F.; Cordelli, M.; Corradi, G.; Diociaiuti, E.; Donghia, R.; Giovannella, S.; Happacher, F.; Martini, M.; Miscetti, S.; Ricci, M.; Saputi, A.; Sarra, I.; Echenard, B.; Hitlin, D. G.; Hu, C.; Miyashita, T.; Porter, F.; Zhang, L.; Zhu, R.-Y.; Grancagnolo, F.; Tassielli, G.; Murat, P.
2018-02-01
The Mu2e experiment is constructing a calorimeter consisting of 1,348 undoped CsI crystals in two disks. Each crystal has a dimension of 34 x 34 x 200 mm, and is readout by a large area silicon PMT array. A series of technical specifications was defined according to physics requirements. Preproduction CsI crystals were procured from three firms: Amcrys, Saint-Gobain and Shanghai Institute of Ceramics. We report the quality assurance on crystal's scintillation properties and their radiation hardness against ionization dose and neutrons. With a fast decay time of 30 ns and a light output of more than 100 p.e./MeV measured with a bi-alkali PMT, undoped CsI crystals provide a cost-effective solution for the Mu2e experiment.
Department of Hadron Structure - Overview
International Nuclear Information System (INIS)
Eskreys, A.
2000-01-01
Full Text: The XII Department of the Institute of Nuclear Physics has been involved in 1999 in the following experiments and projects: -ZEUS experiment at HERA (DESY), which covered the main activity of the department. The group from department participating in this experiment consisted of physicists: J. Chwastowski, A. Eskreys, J. Figiel, K. Klimek, K. Olkiewicz, M.B. Przybycien, P. Stopa, M. Zachara, and L. Zawiejski and engineers and technicians: J. Andruszkow, W. Daniluk, B. Dabrowski, P. Jurkiewicz, A. Kotarba, K. Oliwa, W. Wierba, and A. Wlodarczyk; -D0 experiment at TEVATRON (FNAL), USA - one physicist: B. Pawlik from the department was involved in this experiment; -TESLA project at DESY - two engineers: J. Andruszkow and P. Jurkiewicz were participating in this project; -ATLAS project at LHC (CERN) - one physicist: K. Piotrzkowski from the department was participating in this project. 11 physicists and 8 engineers and technicians have been involved in carrying above programs. ZEUS experiment is the continuation of the investigation of e ± p interactions at HERA collider which has started over 10 years ago and has a perspective of another 5 years of activity. The upgrade of HERA and the expected 5-7 fold increase of luminosity makes the physics program very attractive. Cracow group is responsible for upgrade of the luminosity monitor to meet the new working conditions after HERA upgrade. An extended proposal for luminosity measurement after HERA upgrade, including the measurements of the Bremsstrahlung events rates by additional detectors apart from the photon calorimeter (i.e. 6m and 40m electron taggers and luminosity spectrometer), has been prepared and was accepted for realization by the ZEUS collaboration and the DESY Physics Research Committee (PRC). D0 is the (anti)pp experiment carried out at FNAL (Batavia), USA, and is now designed to deliver 100 times higher luminosity than has been achieved so far. In ATLAS project the preparation of the physics
Cuidadores Principais Ante a Experiência da Morte: Seus Sentidos e Significados
Directory of Open Access Journals (Sweden)
Carolina Peres de Lima
Full Text Available Resumo O presente trabalho teve como objetivo compreender os sentidos e significados atribuídos pelos cuidadores principais à experiência de acompanhamento de pacientes com câncer em Cuidados ao Fim de Vida. Com este intuito, foi realizada uma pesquisa qualitativa exploratória, utilizando a observação participante como recurso metodológico. A análise de conteúdo foi utilizada como método de avaliação dos resultados, no qual a Teoria Existencialista de Viktor Frankl e a literatura contemporânea sobre Cuidados Paliativos serviram de substrato teórico à compreensão da temática em questão. Após a análise do diário de campo, foram extraídas cinco categorias temáticas: A espiritualidade atribuindo sentido à experiência; O tempo de espera; Morte como alívio do sofrimento; Revisão da história de vida; Incerteza quanto ao futuro. Foi possível perceber reações e sentimentos expostos pelos cuidadores, que, apesar do esgotamento físico e emocional, desejavam permanecer ao lado de seu familiar até sua morte. Entendemos que a comunicação da equipe ao cuidador sobre a aproximação da morte pode contribuir para o processo de elaboração psíquica desta vivência. A compreensão da experiência subjetiva do cuidador viabiliza uma abordagem efetiva da equipe às reais necessidades de cuidado do familiar.
Psicologia e Práticas Restaurativas na Socioeducação: Relato de Experiência
Directory of Open Access Journals (Sweden)
Iara da Silva Ferrão
Full Text Available Resumo Este artigo tem como objetivo apresentar um relato de experiência de profissional da área da Psicologia, dentro de uma Unidade de Internação de adolescentes em conflito com a lei. Ainda pretendeu-se relacionar práticas restaurativas com possibilidade de experiência exitosa ao sistema socioeducativo. O relato tem como cenário uma unidade de Atendimento Socioeducativo de uma cidade no interior do estado do Rio Grande do Sul. Os dados obtidos são frutos da experiência profissional da autora e fazem parte de um estudo maior intitulado “Um Estudo dos Fatores de Risco e de Proteção em Jovens que Cumprem Medida Socioeducativa”. Os resultados mostraram que as práticas restaurativas realizadas nesta instituição foram apenas os círculos de compromisso. O tema da Justiça Restaurativa (JR, por ser novo e por não ter sido originalmente um modelo criado no cenário brasileiro, ainda é difícil de avaliar possíveis resultados e impactos. As experiências apresentadas sugerem que há possibilidade da JR ser uma experiência exitosa para o Sistema Socioeducativo. Indica-se a necessidade de realização de mais pesquisas com relação a essa temática.
Offline Software for the Mu2e Experiment
Energy Technology Data Exchange (ETDEWEB)
Kutschke, Robert K. [Fermilab
2012-01-01
The Mu2e experiment at Fermilab is in the midst of its R&D and approval processes. To aid and inform this process, a small team has developed an end-to-end Geant4-based simulation package and has developed reconstruction code that is already at the stage of an advanced prototype. Having these tools available at an early stage allows design options and tradeoffs to be studied using high level physics quantities. A key to the success of this effort has been, as much as possible, to acquire software and customize it, rather than to build it in-house.
Track reconstruction for the Mu3e experiment based on a novel Multiple Scattering fit
Directory of Open Access Journals (Sweden)
Kozlinskiy Alexandr
2017-01-01
Full Text Available The Mu3e experiment is designed to search for the lepton flavor violating decay μ+ → e+e+e−. The aim of the experiment is to reach a branching ratio sensitivity of 10−16. In a first phase the experiment will be performed at an existing beam line at the Paul-Scherrer Institute (Switzerland providing 108 muons per second, which will allow to reach a sensitivity of 2 · 10−15. The muons with a momentum of about 28 MeV/c are stopped and decay at rest on a target. The decay products (positrons and electrons with energies below 53MeV are measured by a tracking detector consisting of two double layers of 50 μm thin silicon pixel sensors. The high granularity of the pixel detector with a pixel size of 80 μm × 80 μm allows for a precise track reconstruction in the high multiplicity environment of the Mu3e experiment, reaching 100 tracks per reconstruction frame of 50 ns in the final phase of the experiment. To deal with such high rates and combinatorics, the Mu3e track reconstruction uses a novel fit algorithm that in the simplest case takes into account only the multiple scattering, which allows for a fast online tracking on a GPU based filter farm. An implementation of the 3-dimensional multiple scattering fit based on hit triplets is described. The extension of the fit that takes into account energy losses and pixel size is used for offline track reconstruction. The algorithm and performance of the offline track reconstruction based on a full Geant4 simulation of the Mu3e detector are presented.
Psicologia Organizacional e do Trabalho: Relato de Experiência em Estágio Supervisionado
Directory of Open Access Journals (Sweden)
Priscilla de Oliveira Martins-Silva
Full Text Available Resumo Trata-se de relato de experiência em estágio supervisionado em Psicologia Organizacional e do Trabalho (POT envolvendo um grupo de alunos de uma Instituição de Educação Superior (IES localizada no Estado do Espírito Santo. O objetivo central foi discutir os aspectos teóricos e práticos que influenciaram na formação profissional do discente em Psicologia, tendo como foco o estágio supervisionado. Além de relatar a experiência, foi realizado um levantamento junto aos ex-alunos sobre as contribuições do estágio na sua formação educacional e profissional. Da experiência relatada foi possível verificar que: a instituição das Diretrizes Curriculares Nacionais (DCN constituiu-se em um marco na flexibilização curricular dos cursos; o estágio é um componente curricular de integração entre ensino, pesquisa e prática; e o estágio em POT requer dos discentes conhecimentos multidisciplinares. Além desses aspectos, observou-se que a prática do estágio supervisionado indica o rompimento com a imagem negativa do psicólogo que atua em POT, limitada à aplicação de testes e psicotécnicas. De fato, a atividade do psicólogo em POT mostrou-se muito mais ampla e complexa, sobretudo em termos dos impactos de sua intervenção no ambiente organizacional.
Métricas da qualidade da experiência do consumidor de bares e restaurantes: uma revisão comparada
Directory of Open Access Journals (Sweden)
Gisah Moreira Akel
2012-11-01
Full Text Available A busca pela compreensão do comportamento do consumidor tem sido amplamente discutida por acadêmicos e gestores. Considerando suas especificidades, o crescente setor de alimentos e bebidas, instiga investigadores em busca de caminhos que permitam ao empreendimento proporcionar serviços e experiências memoráveis, exigências da evolução da ótica de consumo moderna. Este panorama motiva a realização deste estudo que tem por objetivo analisar métricas da qualidade da experiência do consumidor de bares e restaurantes, por meio de uma revisão bibliográfica contemplando: o comportamento do consumidor de alimentos e bebidas, expectativa, qualidade, satisfação e os componentes da qualidade da experiência do consumidor deste nicho. Esta revisão culminou na comparação de três modelos principais de medição da qualidade da experiência, sendo eles: o SERVQUAL (PARASSURAMAN et al., 1988, o DINESERV (STEVENS et al., 1995 e Qualidade da Experiência (GIMENES et al., 2012. Constatou-se que os modelos oferecem visões distintas e de certo modo, complementares. No entanto, conclui-se que o suporte de Gimenes et al. (2012 compreende uma métrica mais extensa e focada neste segmento específico. Normal 0 21 false false false PT-BR X-NONE X-NONE
Directory of Open Access Journals (Sweden)
Angélica Araújo Maia
2016-05-01
Full Text Available Nos dias atuais, as teorias fundamentadas nos Novos Letramentos representam uma importante referência para o ensino de Língua Inglesa no Brasil, propondo uma educação linguística que, ao mesmo tempo, possa fortalecer a consciência crítica e favorecer a agência cidadã. Nessa perspectiva, o presente artigo relata a experiência de um projeto de extensão voltado para o ensino de inglês para adolescentes e jovens, com foco na profissionalização e no letramento crítico, com o objetivo de evidenciar de que forma a proposta curricular e metodológica do projeto,além de promover o desenvolvimento do conhecimento da língua inglesa, constituiu-se um espaço de engajamento dialógico e de expansão de perspectiva dosparticipantes. O estudo foi desenvolvido com base na análise de fragmentos das aulas, registrados em vídeo, dos planos de aula e material didático utilizado, além das postagens dos jovens participantes acerca dos temas abordados em uma página do projeto em uma rede social. As categorias que guiaram a interpretação dos dados se referem a etapas constituintes das aulas e consistem em: preparação, exploração, problematização e expansão (EDMUNDO, 2012; e ainda: experiências com o conhecido, experiências com o novo, conceituações, conexões locais e globais, expansão de perspectiva, transformação (MONTE-MOR, 2010; DUBOC, 2015. No final, argumenta-se a favor da transposição dessa abordagem, desenvolvida em um espaço não escolar em João Pessoa - Paraíba (organização não-governamental, para o espaço da escola, de forma a ampliar,na educação básica, as possibilidades de uma aprendizagem da língua inglesa mais significativa e capaz de empoderaradolescentes e jovens no uso da linguagem.
SRF Cavity and Materials R&D at Fermilab
Khabiboulline, N; Bellantoni, L; Berenc, T; Boffo, C; Carcagno, R; Chapman, C; Edwards, H; Elementi, L; Foley, M; Hahn, E; Hicks, D; Mitchell, D; Rowe, A; Solyak, N; Terechkine, Yu
2004-01-01
Two 3.9 GHz superconducting RF cavities are under development at FNAL for use in the upgraded Photoinjector Facility. A TM110 mode cavity will provide streak capability for bunch slice diagnostics, and a TM010 mode cavity will provide linearization of the accelerating gradient before compression for better emittance. The status of these two efforts and a review of the FNAL infrastructure development will be given.
Neutrino results from the Fermilab 15-foot bubble chamber using neon-hydrogen mixtures
International Nuclear Information System (INIS)
Burnett, T.H.
1977-01-01
Neutrino results from the FNAL 15-foot bubble chamber, using two different neon-hydrogen mixtures are reviewed. Included are the measurements from four different experiments of the dilepton, or μe rate, which appear to be consistent with the charm production interpretation for this process. Also mentioned is a study of the scaling variable distributions for antineutrinos, which shows no anomalous threshold, consistent with the usual four-quark model, but indicates a slight scale breaking. The ratio of anti νn to anti νp cross sections has been extracted from the same data and is also consistent with the quark model. A study of the hadronic state produced by electron (anti)neutrinos in neon is summarized, with the conclusion that nuclear rescattering effects are the same as for hadron interactions. (orig.) [de
Directory of Open Access Journals (Sweden)
Flavia Liberman
2018-01-01
Full Text Available A imagem da capa refere-se a uma experiência realizada em um curso no Congresso Brasileiro e Latino Americano de Terapia Ocupacional em 2013 que buscou oferecer aos participantes ferramentas relacionadas às abordagens corporais e às artes plásticas e visuais para a construção de estratégias de intervenção e cuidado com diferentes populações em terapia ocupacional. As propostas sensibilizaram para os estados de presença dos corpos, buscando uma maior agregação das partes e uma conexão mais potente com o presente e com os ambientes. A experiência promoveu um espaço de criação e interação grupal e expressou a singularidade dos processos de cada participante em meio a produção coletiva. AbstractThe cover image refers to an experiment conducted in a course at the Brazilian and Latin American Congress of Occupational Therapy in 2013 that sought to provide participants with tools related to body approaches and visual arts for the construction of intervention and care strategies with different populations in occupational therapy. The proposals sensitized the states of presence of the bodies, seeking a greater aggregation of the parts and a more powerful connection with the present and with the environments. The experience promoted a space of creation and group interaction and expressed the uniqueness of the processes of each participant in the midst of collective production.Key words: Art; Body; Education; Group; Occupational Therapy.
Directory of Open Access Journals (Sweden)
Elena Syrtsova
2017-06-01
Full Text Available The article is devoted to the study of various aspects of development and implementation of e-learning at higher education institutions. This system has been created according to the main approaches and criteria used by the European Foundation for quality assurance of e-learning (EFQUEL. The article presents the main results of the experiment on Vyatka State University's e-learning system development. The article reveals the feasibility of the development of e-learning in the region. The authors consider three main strategies of implementation of e-learning system at Vyatka State University. The authors substantiate the choice of the most effective and promising strategy of them based on the analysis and considering the peculiarities of the university and the region. In the article, the fundamental results of the experiment and description of the stages of the implementation of e-learning system are presented.
FNAL Booster intensity, extraction, and synchronization control for collider operation
International Nuclear Information System (INIS)
Ducar, R.J.; Lackey, J.R.; Tawzer, S.R.
1987-03-01
Booster operation for collider physics is considerably different than for fixed target operation. Various scenarios for collider physics, machine studies, and P-Bar targeting may require that the intensity vary from 5E10 PPP to 3E12 PPP at a 15 Hertz machine cycle rate. In addition to the normal Booster single turn extraction mode, collider operations require that the Booster inject into the Main Ring a small number of beam bunches for coalescing into a single high intensity bunch. These bunches must be synchronized such that the center bunch arrives in the RF bucket which corresponds to the zero phase of the coalescing cavity. The system implemented has the ability to deliver a precise fraction of the available 84 Booster beam bunches to Main Ring or to the P-Bar Debuncher via the newly installed AP-4 beam line for tune-up and studies. It is required that all of the various intensity and extraction scenarios be accommodated with minimal operator intervention
Directory of Open Access Journals (Sweden)
Alexander Moreira de Almeida
2003-01-01
Full Text Available As experiências anômalas (EA (vivências incomuns ou que se acredita diferentes do habitual e das explicações usualmente aceitas como realidade: alucinações, sinestesia e vivências interpretadas como telepáticas... e os estados alterados de consciência (EAC são descritos em todas as civilizações de todas as eras, constituindo-se elementos importantes na história das sociedades. Apesar disso, têm recebido pouca atenção da comunidade científica, ou são abordados de forma pouco rigorosa. As EA e os EAC podem ser estudados sem que se compartilhem as crenças envolvidas, sendo possível investigá-los enquanto experiências subjetivas e, como tais, correlacionados com quaisquer outros dados. Neste artigo, procurou-se apresentar algumas diretrizes metodológicas para um estudo rigoroso do tema, entre elas: evitar uma abordagem preconceituosa e a "patologização" do diferente, a necessidade de uma teoria e de uma revisão exaustiva da literatura existente, utilizar diversos critérios de normalidade e patologia, investigar populações clínicas e não clínicas, desenvolvimento de instrumentos adequados para avaliação, cuidados na escolha dos termos e no estabelecimento de nexos causais, distinguir entre a experiência vivenciada e suas interpretações, considerar o papel da cultura, avaliar a confiabilidade e a validade dos relatos, por fim, o desafio gerado pela necessidade de criatividade e diversidade na escolha dos métodos.Anomalous experiences (AE (uncommon experiences or one that is believed to deviate from the usually accepted explanations of reality: hallucinations, synesthesia, experiences interpreted as telepathic... and altered states of consciousness (ASC are described in all societies of all ages. Even so, the scientists have long neglected the studies on this theme. To study AE and ASC is not necessary to share the believes we discuss, they can be investigated as subjective experiences and correlated like any
Nuclear E&T for Building and Sustaining Capacity from Korean Experience
International Nuclear Information System (INIS)
Nam, Youngmi
2014-01-01
Lessons learned: • A strong national initiative needs to be maintained, involving stakeholders with a staged national nuclear E&T plan and its execution together with an HRD plan. • An integrated competence based E&T for NEPIOs, operators, regulators, TSOs and etc. is an important element to become a knowledgeable customer or responsible vendor. • International cooperation is a useful mechanism by which long-term and widely ranged experience from others, including international organizations can be absorbed or transferred effectively in a relatively shorter term, minimizing trial and error
Experience of e-learning implementation through massive open online courses
Ivleva, N. V.; Fibikh, E. V.
2016-04-01
E-learning is considered to be one of the most prospective directions in education development worldwide. To have a competitive advantage over other institutions offering a wide variety of educational services it is important to introduce information and communication technologies into the educational process to develop e-learning on the whole. The aim of the research is to reveal problems which prevent from full implementation of e-learning at the Reshetnev Siberian State Aerospace University (SibSAU) and to suggest ways on solving those problems through optimization of e-learning introduction process at the university by motivating students and teaching staff to participate in massive open online courses and formation of tailored platforms with the view to arrange similar courses at the premises of the university. The paper considers the introduction and development level of e-learning in Russia and at SibSAU particularly. It substantiates necessity to accelerate e-learning introduction process at an aerospace university as a base for training of highly-qualified specialists in the area of aviation, machine building, physics, info-communication technologies and also in other scientific areas within which university training is carried out. The paper covers SibSAU’s experience in e-learning implementation in the educational process through students and teaching staff participation in massive open online courses and mastering other up-to-date and trendy educational platforms and their usage in the educational process. Key words. E-learning, distance learning, online learning, massive open online course.
"Haunting experiences: Ghosts in contemporary folklore," by Diane E. Goldstein et al.
Directory of Open Access Journals (Sweden)
Linda Levitt
2010-03-01
Full Text Available Diane E. Goldstein, Sylvia Ann Grider, and Jeannie Banks Thomas. Haunting experiences: Ghosts in contemporary folklore. Logan: Utah State University Press, 2007, paperback, $24.95 (272p ISBN 978-0-87421-636-3.
Indivíduo e pessoa na experiência da saúde e da doença
Directory of Open Access Journals (Sweden)
Luiz Fernando Dias Duarte
Full Text Available Revisão de uma linha de pesquisa no campo das ciências sociais em saúde no Brasil que se centra na hipótese metodológica de uma diferença cultural fundamental entre os modelos relacionais de "pessoa" e o modelo do "indivíduo" ocidental moderno (pensado como livre, autônomo e igual. Essa diferença cultural é de particular importância na caracterização das formas diferenciais de experiência da saúde e da doença entre as classes populares das sociedades nacionais modernas e os segmentos portadores dos saberes biomédicos eruditos, dominantes e oficiais. Estes últimos têm um compromisso originário com algumas características da ideologia do individualismo, tais como o universalismo/racionalismo e o cientificismo/fisicalismo. As representações, práticas e instituições dela dependentes ocupam um espaço de oposição à forma integrada, relacional, holista, como são pensadas e experimentadas as "doenças" (ou, como prefiro, as "perturbações físico-morais" mesmo nos segmentos "individualizados", quanto mais nos segmentos regidos por representações hierárquicas, relacionais, de "pessoa". Apresentam-se os fundamentos antropológicos dessa perspectiva analítica e as diferentes dimensões da produção acadêmica a ela associada, em comparação com as de outras tendências do campo.
Directory of Open Access Journals (Sweden)
Thaís Basso de Brito
2009-06-01
Full Text Available Este estudo foi desenvolvido com o objetivo de investigar a experiência de cuidar de adolescentes e pré-adolescentes portadores de diabetes tipo I, na perspectiva dos seus familiares. Foi utilizada a abordagem fenomenológica, modalidade de pesquisa qualitativa que se propõe a compreender os significados das experiências vividas. Foram entrevistados dez pais (9 mães e 1 pai em hospital de ensino do interior paulista. A experiência de cuidar do filho com diabetes emerge das convergências das descrições dos participantes, sendo descrita em três temas principais: o universo da doença; relação com as pessoas; reflexão sobre a experiência vivida. Os participantes descrevem suas dificuldades e estratégias para manterem a família unida e ainda oferecer suporte aos filhos. Eles acreditam que têm que aceitar e enfrentar os desafios, além de estimularem os filhos para sua segurança e qualidade de vida. Os dados mostraram a necessidade de um suporte profissional, além de um espaço para a discussão de temas tanto para as crianças com diabetes como para seus familiares.This study aimed at investigating the experience of taking care of adolescents and pre-adolescents with type 1 diabetes from the standpoint of their family members. A phenomenological approach, i.e. a type of qualitative analysis aimed at understanding the meaning of life experiences, was used. Ten parents (9 mothers and 1 father were interviewed at a teaching hospital in the interior of São Paulo state. The experience of taking care of a child with diabetes emerged from the converging points reported under 3 main themes: the universe of the disease; personal relationships; reflections on the experience. The participants described their difficulties and the strategies they use for keeping the family together besides providing support to the children. They believe they have to accept and face the challenges, besides motivating their children in order to ensure their
JSC Case Study: Fleet Experience with E-85 Fuel
Hummel, Kirck
2009-01-01
JSC has used E-85 as part of an overall strategy to comply with Presidential Executive Order 13423 and the Energy Policy Act. As a Federal fleet, we are required to reduce our petroleum consumption by 2 percent per year, and increase the use of alternative fuels in our vehicles. With the opening of our onsite dispenser in October 2004, JSC became the second federal fleet in Texas and the fifth NASA center to add E-85 fueling capability. JSC has a relatively small number of GSA Flex Fuel fleet vehicles at the present time (we don't include personal vehicles, or other contractor's non-GSA fleet), and there were no reasonably available retail E-85 fuel stations within a 15-minute drive or within five miles (one way). So we decided to install a small 1000 gallon onsite tank and dispenser. It was difficult to obtain a supplier due to our low monthly fuel consumption, and our fuel supplier contract has changed three times in less than five years. We experiences a couple of fuel contamination and quality control issues. JSC obtained good information on E-85 from the National Ethanol Vehicle Coalition (NEVC). We also spoke with Defense Energy Support Center, (DESC), Lawrence Berkeley Laboratory, and US Army Fort Leonard Wood. E-85 is a liquid fuel that is dispensed into our Flexible Fuel Vehicles identically to regular gasoline, so it was easy for our vehicle drivers to make the transition.
Experiências inovadoras de cuidado no Programa Saúde da Família (PSF: potencialidades e limites
Directory of Open Access Journals (Sweden)
Alice da Costa Uchôa
2009-06-01
Full Text Available Atualmente, o PSF convive com práticas do modelo biomédico e outras marcadoras de mudança. Este artigo aborda experiências inovadoras de cuidado baseada em pesquisa realizada em Natal no período de 2005 a 2007. Teve como objetivo compreender os sentidos da integralidade, discutir o papel da criatividade e sensibilidade dos profissionais e analisar as possibilidades de institucionalização e sustentabilidade. Utilizou análise documental; entrevista semi-estruturada com os protagonistas, observação das unidades e experiências. Dentre as concepções de integralidade encontradas destacam-se: promoção da saúde como mudança do estilo de vida; aproximações dialógicas entre saber científico e popular; fortalecimento da participação popular, auto-cuidado. Houve reconhecimento social expressos em ganho de prêmios, publicações e peças teatrais. Nenhum dos projetos contava com financiamento. Conclui-se que as experiências têm uma vocação para promoção e cuidado, mas ainda não têm sustentabilidade financeira e política.
Directory of Open Access Journals (Sweden)
Andréa de Sousa Gama
2009-11-01
Full Text Available Este estudo analisa as diferentes representações e experiências quanto ao parto vaginal e cesárea de mulheres de diferentes estratos sócio-econômicos, bem como a natureza das relações profissionais de saúde/usuárias no contexto institucional em que estão inseridas. A pesquisa de natureza qualitativa foi desenvolvida em três maternidades do Município do Rio de Janeiro, Brasil, sendo uma pública, uma conveniada com o SUS e uma particular, com mulheres que tiveram os dois tipos de parto. Os resultados revelam que o modelo de organização dos serviços público e privado apresentam variações que produzem diferentes tipos de assistência e de relação entre os profissionais de saúde e as usuárias, dando forma a experiências distintas entre as mulheres pesquisadas. Todavia, ao empreendermos uma crítica assentada nas relações de gênero, podemos verificar que o modelo de assistência ao parto permanece submetendo quem deve ser sujeito e reproduzindo o projeto da medicalização - mesmo que este processo se manifeste de formas diferenciadas entre os grupos estudados -, o que reduz o campo da assistência e inviabiliza um lugar de poder diferenciado das usuárias.This study analyzes the different representations and experiences of women from different social classes, including issues related to their relations with hospital staff in different institutional settings. This qualitative study focused on women who had experienced both types of delivery, in three maternity hospitals in Rio de Janeiro, Brazil (one public, one fully private, and another private under an outsourcing agreement with the public health system. The study showed that variations in public and private service models result in different types of delivery care and different relations with staff, and are reflected in different birthing experiences for the women. However, a critical gender perspective shows that in both cases, the service models reproduce the
Data acquisition system for Experiment E866 at the Brookhaven AGS
International Nuclear Information System (INIS)
Ashktorab, K.; LeVine, M.J.; Scheetz, R.A.
1993-01-01
Experiment E866 consists of two spectrometers and related detectors for investigations of collisions of relativistic beams of Au ions with fixed targets at the Brookhaven AGS. The data acquisition system, consisting of 11 CPUs in a single VME crate, gathers data from 8 Camac crates and 6 Fastbus crates
International Nuclear Information System (INIS)
Penel-Nottaris, E.
2004-07-01
The Jefferson Lab Hall A E89-044 experiment has measured the He 3 (e,e'p) reaction cross-sections. The extraction of the longitudinal and transverse response functions for the two-body break-up He 3 (e,e'p)d reaction in parallel kinematics allows the study of the bound proton electromagnetic properties inside the He 3 nucleus and the involved nuclear mechanisms beyond plane waves approximations, for missing momenta of 0 and +- 300 MeV/c and transferred momenta from 0.8 to 4.1 GeV 2 . Preliminary cross-sections have been obtained after calibration of the experimental setup by fitting theoretical models averaged over the experimental phase-space using a Monte-Carlo simulation. The 8% systematic error on cross-sections is linked mainly to the absolute normalization of the target density: the elastic scattering data analysis will allow to reduce this error. The preliminary results show some disagreement with theoretical predictions for the forward angles kinematics around 0 MeV/c missing momenta and sensitivity to final state interactions and He 3 waves functions for missing momenta of 300 MeV/c. The longitudinal and transverse separation should constraint theoretical models more strongly. (author)
Sustainable E-Participation through participatory experiences in education
Directory of Open Access Journals (Sweden)
Ursula Maier-Rabler
2010-09-01
Full Text Available Normal 0 21 false false false DE-AT X-NONE X-NONE The understanding of participation as a political matter has changed back and forth over the years. The latest twist back to appreciative attributions towards participation is fuelled by the development of the Internet, and especially the Social Web. Citizen participation is unanimously seen as an essential precondition for Deliberative-Collaborative eDemocracy (Petrik, 2010 enabled by Web 2.0. This paper considers participatory culture and its specific political, cultural, societal, and educational characteristics as a prerequisite for e-participation and argues that social media literacy is indispensable for e-participation to be sustainable. Young people’s affinity spaces (Jenkins, et.al., 2006 can only lay down the foundations for social media literacy, but their further development depends on education. Political Education would be well advised to adapt innovative pedagogical approaches to the acquirement of new media literacy. This paper introduces an exemplary educational tool – predominately but not exclusively for political/civic education – namely the website PoliPedia.at. Teachers can use it to deliberately create a balanced space for collaboration between Digital Immigrants and Digital Natives. PoliPedia – as a participative online tool – has the potential to facilitate participation experience in political/civic education and supports social media education. Thereby the embedding of technology in pedagogical and societal conceptualizations is crucial.
Sustainable E-Participation through participatory experiences in education
Directory of Open Access Journals (Sweden)
Ursula Maier-Rabler
2010-09-01
Full Text Available The understanding of participation as a political matter has changed back and forth over the years. The latest twist back to appreciative attributions towards participation is fuelled by the development of the Internet, and especially the Social Web. Citizen participation is unanimously seen as an essential precondition for Deliberative-Collaborative eDemocracy (Petrik, 2010 enabled by Web 2.0. This paper considers participatory culture and its specific political, cultural, societal, and educational characteristics as a prerequisite for e-participation and argues that social media literacy is indispensable for e-participation to be sustainable. Young people’s affinity spaces (Jenkins, et.al., 2006 can only lay down the foundations for social media literacy, but their further development depends on education. Political Education would be well advised to adapt innovative pedagogical approaches to the acquirement of new media literacy. This paper introduces an exemplary educational tool – predominately but not exclusively for political/civic education – namely the website PoliPedia.at. Teachers can use it to deliberately create a balanced space for collaboration between Digital Immigrants and Digital Natives. PoliPedia – as a participative online tool – has the potential to facilitate participation experience in political/civic education and supports social media education. Thereby the embedding of technology in pedagogical and societal conceptualizations is crucial.
As contribuições teórico-metodológicas de E. P. Thompson: experiência e cultura
Directory of Open Access Journals (Sweden)
Suely Aparecida Martins
2006-01-01
Full Text Available O artigo destaca as contribuições teórico-metodológicas do historiador marxista Edward Palmer Thompson e que podem ser úteis para a pesquisa sociológica. A partir de pesquisa bibliográfica, apresenta-se uma breve biografia do autor e em seguida algumas categorias importantes desenvolvidas por ele, como experiência e cultura. Ressalta-se também a ênfase de Thompson em tratar as categorias teóricas considerando-se a processualidade histórica. Por fim, são levantadas algumas possibilidades de análise da juventude do campo na atualidade a partir das contribuições teórico-metodológicas desse autor.
Discovery It is the dawn of a new era in particle physics. Physicists have incorporated decades of barriers of energy, precision and intensity to explore new frontiers in particle physics. Physicists look physics. The Standard Model is the current framework for our understanding of matter. Activities The
Energy Technology Data Exchange (ETDEWEB)
Spechty, J.; Perez Rodriguez, J. L.
2012-07-01
E.ON is one of the largest privately-owned energy companies in the world. Its portfolio of nuclear assets in composed of 21 nuclear power plants on 13 sites located in Germany and Sweden, 9 of which are directly operated by E.ON. At present E.ON develops large-scale construction projects in two of the European countries willing to commit to new nuclear build-Finland and UK - for which its experience as the best nuclear power plant operator in Europe is key. (Author)
Limits on likesign dilepton production in nu/sub μ/ interactions
International Nuclear Information System (INIS)
Baker, N.J.; Connolly, P.L.; Kahn, S.A.
1985-01-01
We have searched for the production of likesign dilepton events (nu/sub μ/ + Ne → μ - + e - + ...) in a wideband neutrino beam at FNAL using the 15' bubble chamber. We observe no signal above the background arising from conventional sources. We set 90% confidence level upper limits for the production rates of (nu/sub μ/ + Ne → μ - + e - + ...)/(nu/sub μ/ + Ne → μ - + ...) less than or equal to 8 * 10 -5 and (nu/sub μ/ + Ne → μ - + e - + ...)/(nu/sub μ/ + Ne → μ - + e + + ...) less than or equal to 6 * 10 -2
Status and first results of BNL experiment 777: A search for K+ → π+μ+e- and a study of K+ → μ+e+e-
International Nuclear Information System (INIS)
Baker, N.J.; Gordon, H.A.; Lazarus, D.M.
1987-01-01
Results of our search for short lived neutral particles emitted in K + decay are given. We also seek to make an accurate measurement of the branching ratio for π 0 → e + e - by looking for the decay chain K + → π + π 0 , π 0 → e + e - . The world average branching ratio for this decay is (1.8 +- 0.7) x 10 -7 based on about 30 events from two experiments. Theory predicts that this branching ratio should be of order 6 x 10 -8 . If the branching ratio remains at the 2 x 10 -7 level when measured with smaller errors, this could be an indication of new physics. 24 refs., 7 figs
Studies of Nu-mu to Nu-e Oscillation Appearance in the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Pereira e Sousa, Alexandre Bruno [Tufts Univ., Medford, MA (United States)
2006-02-01
The MINOS experiment uses a long baseline neutrino beam, measured 1 km downstream from its origin in the Near Detector at Fermilab, and 734 km later in the large underground Far Detector in the Soudan mine. By comparing these two measurements, MINOS can probe the atmospheric domain of the neutrino oscillation phenomenology with unprecedented precision. Besides the ability to perform a world leading determination of the Δm$2\\atop{23}$ and θ23 parameters, via vμ flux disappearance, MINOS has the potential to make a leading measurement of vμ → ve oscillations in the atmospheric sector by looking for ve appearance at the Far Detector. The observation of ve appearance, tantamount to establishing a non-zero value of the θ13 mixing angle, opens the way to studies of CP violation in the leptonic sector, the neutrino spectral mass pattern ordering and neutrino oscillations in matter, the driving motivations of the next generation of neutrino experiments. In this thesis, we study the MINOS potential for measuring θ13 in the context of the MINOS Mock Data Challenge using a multivariate discriminant analysis method. We show the method's validity in the application to ve event classification and background identification, as well as in its ability to identify a ve signal in a Mock Data sample generated with undisclosed parameters. An independent shower reconstruction method based on three-dimensional hit matching and clustering was developed, providing several useful discriminator variables used in the multivariate analysis method. We also demonstrate that within 2 years of running, MINOS has the potential to improve the current best limit on θ13, from the CHOOZ experiment, by a factor of 2.
Track following of Ξ"- hyperons in nuclear emulsion for the E07 experiment
International Nuclear Information System (INIS)
Mishina, Akihiro; Endo, Yoko; Hoshino, Kaoru
2015-01-01
The E07 experiment is expected to provide knowledge of S = -2 systems with ten times more statistics than that of the past E373 experiment. To achieve this in a reasonable time, an automated track following system is very important. This system consists of three techniques, 'emulsion surface detection', 'alignment of plate by plate connection with K"- beams' and 'followed track recognition in nuclear emulsion'. Ξ"- hyperon candidate tracks are followed from the entrance to the end point in the emulsion. If the system operates properly such that one track is processed in each plate within one minute, all Ξ"- candidate tracks can be followed successfully to their stopping points in a year. The development of softwares for the system is ongoing. (author)
Teams (M. Brice/J.C. Gadmer)
2010-01-01
CERN-HI-1006100 24: from left to right: Permanent Mission Representative A. Shybut; External Relations Office Adviser R. Voss; LHC Communications and FNAL K. Yurkewicz, Washington CSG Director for internationl programmes S. Sutcliffe-Stephenson; Technology Department Representative L. Bottura; South Dakota State Patrol D. Svendsen; CSG Executive Director and Former State Senator from Kansas D. Atkins;Office of the First Lady L. Svendsen; Office of the Governor K. Mueller; First Lady J. Rounds; South Dakota Governor M. Rounds; Washington State Senator T. Eide;Judge M. Eide; Assemblyman J. Oceguera and G. Oceguera (with son Jackson Oceguera, 5 months).
SU-E-E-05: Initial Experience On Physics Rotation of Radiological Residents
International Nuclear Information System (INIS)
Zhang, J; Williams, D; DiSantis, D; Hardy, P; Oates, M
2014-01-01
Purpose: The new ABR core exam integrates physics into clinical teaching, with an emphasis on understanding image quality, image artifacts, radiation dose and patient safety for each modality and/or sub-specialty. Accordingly, physics training of radiological residents faces a challenge. A traditional teaching of physics through didactic lectures may not fully fulfill this goal. It is also difficult to incorporate physics teaching in clinical practice due to time constraints. A dedicated physics rotation may be a solution. This study is to evaluate a full week physics workshop developed for the first year radiological residents. Methods: The physics rotation took a full week. It included three major parts, introduction lectures, hand-on experiences and observation of technologist operation. An introduction of basic concepts was given to each modality at the beginning. Hand-on experiments were emphasized and took most of time. During hand-on experiments, residents performed radiation measurements, studied the relationship between patient dose and practice (i.e., fluoroscopy), investigated influence of acquisition parameters (i.g., kV, mAs) on image quality, and evaluated image quality using phantoms A physics test before and after the workshop was also given but not for comparison purpose. Results: The evaluation shows that the physics rotation during the first week of residency in radiology is preferred by all residents. The length of a full week of physics workshop is appropriate. All residents think that the intensive workshop can significantly benefit their coming clinical rotations. Residents become more comfortable regarding the use of radiation and counseling relevant questions such as a pregnant patient risk from a CE PE examination. Conclusion: A dedicated physics rotation, assisting with didactic lectures, may fulfill the requirements of physics of the new ABR core exam. It helps radiologists deeply understand the physics concepts and more efficiently use
SU-E-E-05: Initial Experience On Physics Rotation of Radiological Residents
Energy Technology Data Exchange (ETDEWEB)
Zhang, J; Williams, D; DiSantis, D; Hardy, P; Oates, M [University of Kentucky, Lexington, KY (United States)
2014-06-01
Purpose: The new ABR core exam integrates physics into clinical teaching, with an emphasis on understanding image quality, image artifacts, radiation dose and patient safety for each modality and/or sub-specialty. Accordingly, physics training of radiological residents faces a challenge. A traditional teaching of physics through didactic lectures may not fully fulfill this goal. It is also difficult to incorporate physics teaching in clinical practice due to time constraints. A dedicated physics rotation may be a solution. This study is to evaluate a full week physics workshop developed for the first year radiological residents. Methods: The physics rotation took a full week. It included three major parts, introduction lectures, hand-on experiences and observation of technologist operation. An introduction of basic concepts was given to each modality at the beginning. Hand-on experiments were emphasized and took most of time. During hand-on experiments, residents performed radiation measurements, studied the relationship between patient dose and practice (i.e., fluoroscopy), investigated influence of acquisition parameters (i.g., kV, mAs) on image quality, and evaluated image quality using phantoms A physics test before and after the workshop was also given but not for comparison purpose. Results: The evaluation shows that the physics rotation during the first week of residency in radiology is preferred by all residents. The length of a full week of physics workshop is appropriate. All residents think that the intensive workshop can significantly benefit their coming clinical rotations. Residents become more comfortable regarding the use of radiation and counseling relevant questions such as a pregnant patient risk from a CE PE examination. Conclusion: A dedicated physics rotation, assisting with didactic lectures, may fulfill the requirements of physics of the new ABR core exam. It helps radiologists deeply understand the physics concepts and more efficiently use
Out-of-Time Beam Extinction in the MU2E Experiment
Energy Technology Data Exchange (ETDEWEB)
Prebys, E. J. [Fermilab; Werkema, S. [Fermilab
2015-06-01
The Mu2e Experiment at Fermilab will search for the conversion of a muon to an electron in the field of an atomic nucleus with unprecedented sensitivity. The experiment requires a beam consisting of proton bunches 250 ns FW long, separated by 1.7 $\\mu$ sec, with no out-of-time protons at the $10^{10}$ fractional level. Satisfying this "extinction" requirement is very challenging. The formation of the bunches is expected to result in an extinction on the order of $10^5$. The remaining extinction will be accomplished by a system of resonant magnets and collimators, configured such that only in-time beam is delivered to the experiment. Our simulations show that the total extinction achievable by the system is on the order of $10^{12}$, with an efficiency for transmitting in-time beam of 99.6%.
PREFACE: Workshop Photograph and Program
2011-07-01
Workshop photograph Workshop Program Sunday 28 March 201019:00-21:00 Reception at Okura Frontier Hotel Tsukuba(Buffet style dinner with drink) Monday 29 March 2010Introduction (Chair: André Rubbia (ETH Zurich))09:00 Welcome address (05') Atsuto Suzuki (KEK)09:05 Message from CERN on neutrino physics (10') Sergio Bertolucci (CERN)09:15 Message from FNAL on neutrino physics (10') Young Kee Kim (FNAL)09:25 Message from KEK on neutrino physics (10') Koichiro Nishikawa (KEK)09:35 Introductory remark on GLA2010 (10') Takuya Hasegawa (KEK) Special session (Chair: Koichiro Nishikawa (KEK))09:45 The ICARUS Liquid Argon TPC (45') Carlo Rubbia (CERN)10:30-11:00 Coffee break Main goals of Giant Liquid Argon Charge Imaging Experiments I (Chair: Takashi Kobayashi (KEK))11:00 Results from massive underground detectors (non accelerator) (30') Takaaki Kajita (ICRR, U. of Tokyo)11:30 Present long baseline neutrino experiments (30') Chang Kee Jung (SUNY Stony Brook)12:00-12:10 Workshop picture12:10-14:00 Lunch break Main goals of Giant Liquid Argon Charge Imaging Experiments II (Chair: Takashi Kobayashi (KEK))14:00 Physics goals of the next generation massive underground experiments (30') David Wark (Imperial College London)14:30 Near detectors for long baseline neutrino experiments (20') Tsuyoshi Nakaya (Kyoto U.) Lessons on Liquid Argon Charge Imaging technology from ongoing developments (Chair: Chang Kee Jung (SUNY Stony Brook))14:50 WARP (30') Claudio Montanari (U. of Pavia)15:20 ArDM (30') Alberto Marchionni (ETH Zurich)15:50 From ArgoNeuT to MicroBooNE (30') Bonnie Fleming (Yale U.)16:20 250L (30') Takasumi Maruyama (KEK)16:50 The DEAP/CLEAN project (20') Mark Boulay (Queen's U.)17:10-17:40 Coffee break Lessons from Xe based Liquids Imaging detectors (Chair: Flavio Cavanna (U. of L'Aquilla))17:30 MEG (20') Satoshi Mihara (KEK)17:50 The XENON project (20') Elena Aprile (Columbia U.)18:10 XMASS (20') Hiroyuki Sekiya (ICRR, U. of Tokyo) Studies on physics performance (Chair
IRPhE/STEK, Reactor Physics Experiments from Fast-Thermal Coupled Facility
International Nuclear Information System (INIS)
Dietze, Klaus; Klippel, Henk Th.; Koning, Arjan; Jacqmin, Robert
2003-01-01
1 - Description: The STEK-experiments have been performed to check neutron data of the most important reactor materials, especially of fission product nuclides, fuel isotopes and structural materials. The measured central reactivity worths (CRW) of small samples were compared with calculated values. These C/E-ratios have been used then for data corrections or in adjustment procedures. The reactors STEK (ECN Petten/ Netherlands) was a fast-thermal coupled facility of zero power. The annular thermal drivers were filled by fuel assemblies and moderated by water. The inner insertion lattices were loaded with pellets of fuel and other materials producing the fast neutron flux. The characteristics of the neutron and adjoint spectra were obtained by special arrangements of these pellets in unit cells. In this way, a hard or soft neutron spectrum or a special energy behavior of the adjoint function could be reached. The samples were moved by means of tubes to the central position (pile-oscillation technique). The original information about the facility and measurements is compiled in RCN-209, ECN-10 The 5 STEK configurations cover a broad energy range due to their increasing softness. The experiments are very valuable because of the extensive program of sample reactivity measurements with many fission product nuclides important in reactor burn-up calculations. At first, analyses of the experiments have been performed in Petten. Newer analyses were done later in Cadarache / CEA France using the European scheme for reactor calculation JEF-2.2 / ECCO / ERANOS (see Note Techniques and JEF/DOC-746). Furthermore, re-analyses were performed in O-arai / JNC Japan with the JNC standard route JENDL-3.2 / SLAROM / CITATION / PERKY. Results obtained with both code systems and different data evaluations (JEF-2.2 and JENDL-3.2) are compared in JEF/DOC-861. It contains the following documents: 31 Reports, 2 publications, 5 JEF documents, 4 conferences. 2 - Related or auxiliary programs
Summary of sensor evaluation for the Fusion ELectromagnetic Induction eXperiment (FELIX)
International Nuclear Information System (INIS)
Knott, M.J.
1982-08-01
As part of the First Wall/Blanket/Shield Engineering Test Program, a test bed called FELIX (Fusion ELectromagnetic Induction eXperiment) is now under construction at ANL. Its purpose will be to test, evaluate, and develop computer codes for the prediction of electromagnetically induced phenomenon in a magnetic environment modeling that of a fusion reaction. Crucial to this process is the sensing and recording of the various induced effects. Sensor evaluation for FELIX has reached the point where most sensor types have been evaluated and preliminary decisions are being made as to type and quantity for the initial FELIX experiments. These early experiments, the first, flat plate experiment in particular, will be aimed at testing the sensors as well as the pertinent theories involved. The reason for these evaluations, decisions, and proof tests is the harsh electrical and magnetic environment that FELIX presents
On the intrinsic charm and the recombination mechanisms in charm hadron production
International Nuclear Information System (INIS)
Anjos, J.C.; Magnin, J.; Herrera, G.
2001-09-01
We study Λ c ± production in pN and π - N interactions. Recent experimental data from the SELEX and E791 Collaborations at FNAL provide important information on the production mechanism of charm hadrons. In particular, the production of the Λ c baryon provides a good test of the intrinsic charm and the recombination mechanisms, which have been proposed to explain the so called leading particle effects. (author)
First observation and study of $K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-$ decay at the NA48/2 experiment
Misheva, M H; Arcidiacono, R; Balev, S; Batley, J R; Behler, M; Bifani, S; Biino, C; Bizzeti, A; Bloch-Devaux, B; Bocquet, G; Cabibbo, N; Calvetti, M; Cartiglia, N; Ceccucci, A; Cenci, P; Cerri, C; Cheshkov, C; Cheze, J B; Ciemencic, M; Collazuol, G; Costantini, F; Cotta Ramusino, A; Coward, D; Cundy, D; Dabrowski, A; Dalpiaz, P; Damiani, C; De Beer, M; Derre, J; Dibon, H; Dilella, L; Doble, N; Eppard, K; Falaleev, V; Fantechi, R; Fidecaro, M; Fiorini, L; Fiorini, M; Fonseca, T; Martin, M; Frabetti, P L; Gatignon, L; Gersabeck, E; Gianoli, A; Giudici, S; Gonidec, A; Goudzovski, E; Goy Lopez, S; Holder, M; Hris, P; Iacopini, E; Imbergamo, E; Jeitler, M; Kalmus, G; Kekelidze, V; Kleinknecht, K; Kozhuharov, V; Kubis, W; Lamanna, G; Lazzeroni, C; Lenti, M; Litov, L; Madigozhin, D; Maier, A; Mannelli, I; Marchetto, F; Mare, G; Markytan, M; Marouelli, P; Martini, M; Masetti, L; Mazzucato, E; Michetti, A; Mikulec, I; Molokanova, N; Monnier, E; Moosbrugger, U; Morales Morales, C; Munday, D J; Nappi, A; Neuhofer, G; Norton, A; Pa, M; Pepe, M; Peters, A; Petrucci, F; Petrucci, M C; Peyaud, B; Piccini, M; Pierazzini, G; Polenkevich, I; Potrebenikov, Yu; Raggi, M; Renk, B; Rubin, P; Ruggiero, G; Savrie, M; Scarpa, M; Shieh, M; Slater, M W; Sozzi, M; Stoynev, S; Swallow, E; Szleper, M; Valdata-Nappi, M; Vallage, B; Velasco, M; Veltri, M; Venditti, S; Wache, M; Wahl, H; Walker, A; Wanke, R; Widhalm, L; Winhart, A; Winston, R; Wood, M D; Wotton, S A; Yushchenko, A; Zinchenko, M; Ziolkowski, M
2015-01-01
A sample of almost 2000 $K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-$ rare decays with a background contamination below 3% is observed for the first time by the NA48/2 experiment at CERN/SPS. The preliminary branching ratio in the full kinematic region is obtained to be $BR(K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-)$ = (4.06 ± 0.17) x $10^{-6}$ by analyzing the data set recorded in 3-month NA48/2 run during 2003. The measured value is in agreement with the theoretical prediction within one standard deviation.
Barbosa, Tiago Manuel de Almeida
2017-01-01
Mestrado em Gestão Exame Público realizado em 20 de Dezembro de 2017 As crescentes mudanças e evoluções de tendências, produtos, serviços e tecnologias obrigam a que as organizações estejam atentas e preparadas para acompanhar essas transformações. O consumidor está ele também cada vez mais exigente e procura sobretudo as organizações que correspondam às suas expetativas. Através das Marcas as organizações têm a oportunidade de, pelas suas estratégias, potenciar Experiências aos seus co...
Design and experiment of high-current low-pressure plasma-cathode e-gun
International Nuclear Information System (INIS)
Xie Wenkai; Li Xiaoyun; Wang Bin; Meng Lin; Yan Yang; Gao Xinyan
2006-01-01
The preliminary design of a new high-power low pressure plasma-cathode e-gun is presented. Based on the hollow cathode effect and low-pressure glow discharge empirical formulas, the hollow cathode, the accelerating gap, and the working gas pressure region are given. The general experimental device of the low-pressure plasma cathode electron-gun generating high current density e-beam source is shown. Experiments has been done in continuous filled-in gases and gases-puff condition, and the discharging current of 150-200 A, the width of 60 μs and the collector current of 30-80 A, the width of 60 μs are obtained. The results show that the new plasma cathode e-gun can take the place of material cathode e-gun, especially in plasma filled microwave tubes. (authors)
Probing the eV-mass range for solar axions with the CAST experiment
International Nuclear Information System (INIS)
Vogel, J.
2009-01-01
The CERN Axion Solar Telescope (CAST) is searching for solar axions, which could be produced in the core of the Sun via the so-called Primakoff effect. For this purpose, CAST uses a decommissioned LHC prototype magnet. In its magnetic field of 9 Tesla axions could be reconverted into X-ray photons. The magnet is mounted on a structure built to follow the Sun during sunrise and sunset for a total of about 3 hours per day. The analysis of the data acquired during the first phase of the experiment with vacuum in the magnetic field region yielded the most restrictive experimental upper limit on the axion-to-photon coupling constant for axion masses up to about 0.02 eV. In order to extend the sensitivity of the experiment to a wider mass range, the CAST experiment continued its search for axions with helium in the magnet bores. In this way it is possible to restore coherence for larger masses. Changing the pressure of the helium gas enables the experiment to scan different axion masses. In the first part of this second phase of CAST, helium-4 has been used and the axion mass region was extended up to 0.4 eV. Therefore the experiment enters the regions favored by axion models. In CAST's ongoing helium-3 phase the studied mass range is now further extended. We will present the final results of CAST's helium-4 phase. Furthermore the latest upgrades of the experiments will be shown and an outlook on CAST's status and prospects will be given. (author)
The Calibration System of the E989 Experiment at Fermilab
Energy Technology Data Exchange (ETDEWEB)
Anastasi, Antonio [Univ. of Messina (Italy)
2017-01-01
The muon anomaly aµ is one of the most precise quantity known in physics experimentally and theoretically. The high level of accuracy permits to use the measurement of aµ as a test of the Standard Model comparing with the theoretical calculation. After the impressive result obtained at Brookhaven National Laboratory in 2001 with a total accuracy of 0.54 ppm, a new experiment E989 is under construction at Fermilab, motivated by the diff of aexp SM µ - aµ ~ 3σ. The purpose of the E989 experiment is a fourfold reduction of the error, with a goal of 0.14 ppm, improving both the systematic and statistical uncertainty. With the use of the Fermilab beam complex a statistic of × 21 with respect to BNL will be reached in almost 2 years of data taking improving the statistical uncertainty to 0.1 ppm. Improvement on the systematic error involves the measurement technique of ωa and ωp, the anomalous precession frequency of the muon and the Larmor precession frequency of the proton respectively. The measurement of ωp involves the magnetic field measurement and improvements on this sector related to the uniformity of the field should reduce the systematic uncertainty with respect to BNL from 170 ppb to 70 ppb. A reduction from 180 ppb to 70 ppb is also required for the measurement of ωa; new DAQ, a faster electronics and new detectors and calibration system will be implemented with respect to E821 to reach this goal. In particular the laser calibration system will reduce the systematic error due to gain fl of the photodetectors from 0.12 to 0.02 ppm. The 0.02 ppm limit on systematic requires a system with a stability of 10-4 on short time scale (700 µs) while on longer time scale the stability is at the percent level. The 10-4 stability level required is almost an order of magnitude better than the existing laser calibration system in particle physics, making the calibration system a very challenging item. In addition to the high level
Detector system for e-d scattering experiments on the VEPP-3 storage ring
International Nuclear Information System (INIS)
Isaeva, L.G.; Lazarenko, B.A.; Nikolenko, D.M.; Popov, S.G.; Rachek, I.A.; Ukraintsev, Yu.G.; Tsentalovich, E.P.; Wojtsekhowski, B.B.; Nelubin, V.V.
1993-01-01
Experiments on electron scattering from polarized deuterons were carried out on the VEPP-3 storage ring at the Novosibirsk Institute for Nuclear Physics. The e-D coincidences were detected for elastic scattering experiments, and the p-n coincidences for photo disintegration studies. The tensor analyzing power of the elastic scattering was measured in the range of momentum transfer up to 3 f -1 , and of photo disintegration in the range of photon energy up to 500 MeV. The detector system created for these experiments and the data analysis procedures are described in this paper. (orig.)
AVALIAÇÃO E DEFINIÇÃO DO PERFIL DE TEXTURA IDEAL DE QUEIJO PETIT SUISSE
Directory of Open Access Journals (Sweden)
Vanessa Rios de Souza
2011-10-01
Full Text Available A textura é um dos atributos sensoriais que afetam a aceitação do produto. Com a avaliação da textura instrumental e aceitação sensorial é possível definir o perfil de textura ideal de um determinado produto. Desta maneira, o objetivo deste trabalho foi definir o perfil de textura ideal de queijo petit suisse Para isso, foram analisadas cinco marcas comerciais de queijo tipo petit suisse Foi realizado um teste de aceitação em relação ao atributo textura, e também uma análise de TPA, sendo os parâmetros analisados dureza, coesividade, gomosidade, elasticidade, mastigabilidade, resistência e adesividade. A partir dos resultados dessas avaliações, conclui-se que a textura que apresentou a melhor aceitação sensorial possui os parâmetros de dureza variando entre 6,43 e 6,65N, coesividade variando entre 0,71 e 0,77, gomosidade variando entre 4,76 e 4,97, mastigabilidade variando entre 4,54 e 4,83, resistência variando entre 0,020 e 0,032 e adesividade variando entre 34,23 e 35,47.
Notas sobre narração e experiência em Walter Benjamin
Directory of Open Access Journals (Sweden)
Wagner de Avila Quevedo
2008-12-01
Full Text Available O objetivo deste texto é o de elucidar alguns escritos clássicos sobre o conceito de experiência (Erfahrung em Walter Benjamin, mostrando sua relação com a narração (Erzählung e a memória.
Directory of Open Access Journals (Sweden)
Atos Prinz Falkenbach
2008-12-01
Full Text Available O presente estudo investiga os sentimentos e as experiências de pais e mães de crianças com deficiência. Surge das motivações em compreender o cotidiano dos pais e mães de crianças com deficiência integrante do Projeto de Psicomotricidade Relacional da UNIVATES. De corte qualitativo, trata-se de um estudo etnográfico. Os instrumentos utilizados para a coleta de informações são: entrevistas, diários de campo e análise documental. A temática aborda os seguintes aspectos teóricos: a relação primária, a relação do profissional da saúde e a relação social da criança com necessidades especiais. O processo de coleta de informações permitiu organizar as seguintes categorias: a sentimentos manifestos no nascimento de um filho com deficiência; b comportamento dos profissionais da área da saúde no ato de dar a notícia aos pais; c necessidades dos pais e mães na relação com os demais familiares e a sociedade e sentimentos e e necessidades envolvidas na perspectiva de educar uma criança com deficiência. Conclui-se que os pais e mães das crianças com necessidades especiais reavaliam seus conceitos iniciais, aprendem a valorizar as potencialidades da criança e requisitam contínuos reforços em suas estimas pessoais que os auxiliam no processo educativo de seus filhos.The present study aims at investigating the feelings and experiences of parents of children with disabilities. It was motivated by the idea of understanding the daily life of the parents of children that take part in the Relational Psychomotricity Project at UNIVATES. The protagonists of the study are the parents integrated in the project. The instruments used for data collection in this ethnographic qualitative study were interviews, field reports and analysis of documents. The study approached the following theoretical aspects: the primary relation, the medical relation and the social relation of the child with disability. The information is organized
Nuclear structure at intermediate energies
International Nuclear Information System (INIS)
Bonner, B.E.; Mutchler, G.S.
1991-01-01
The theme that unites the sometimes seemingly disparate experiments undertaken by the Bonner Lab Medium Energy Group is a determination to understand in detail the many facets and manifestations of the strong interaction, that which is now referred to as nonperturbative QCD. Whether we are investigating the question of just what does carry the spin of baryons, or the extent of the validity of the SU(6) wavefunctions for the excited hyperons (as will be measured in their radiative decays in our CEBAF experiment), or questions associated with the formation of a new state of matter predicted by QCD (the subject of our BNL experiments E810, E854, as well as our approved experiment at RHIC), -- all these projects share this common goal. Our other experiments represent different approaches to the same broad undertaking. LAMPF E1097 will provide definitive answers to the question of the spin dependence of the inelastic channel of pion production in the n-p interaction. FNAL E683 may well open a new field of investigation in nuclear physics: that of just how quarks and gluons interact with nuclear matter as they transverse nuclei of different sizes. In most all of the experiments mentioned above, the Bonner Lab Group is playing major leadership roles as well as doing a big fraction of the hard work that such experiments require. We use many of the facilities that are unavailable to the intermediate energy physics community and we use our expertise to design and fabricate the detectors and instrumentation that are required to perform the measurements which we decide to do
Deep inelastic muon scattering from nuclei at Fermilab
International Nuclear Information System (INIS)
Kaufman, S.B.
1992-01-01
Electron scattering experiments by Friedman, Kendall, and Taylor at SLAC first showed in 1968 that the proton was composed of point-like constituents (quarks). More recently the European Muon Collaboration (EMC) found in muon scattering experiments that the structure functions of a free nucleon are different from a heavy nucleus (open-quotes EMC effectclose quotes). Fermilab experiment E665 is now studying deep inelastic scattering of 490 GeV muons from targets ranging from hydrogen to lead, including measurements of the final state hadrons in order to learn more about these effects. The author describes this experiment and presents some initial results on the effects of the nuclear environment on the quark structure of nucleons
Observation of an excess of νe, νe events in a beam dump experiment at 400 GeV
Directory of Open Access Journals (Sweden)
P. Alibran
1978-03-01
Full Text Available A beam dump experiment has been performed at CERN in Gargamelle using the neutrino facility to look for penetrating particles produced either directly in the beam interaction or by prompt decay of new particles. A total of 32 interactions with a visible energy greater than 10 GeV has been found, classified, aftercorrections, into 18 charged current νμ or νμ, 5.1 neutral current and 8.9 νe or νe charged current events. An excess of νe events remains after all subtractions from any established sources. Results are presented in terms of the product of the cross section and the leptonic decay branching ratio of the possible source.
E-learning in radiology: An Italian multicentre experience
Energy Technology Data Exchange (ETDEWEB)
Carriero, A., E-mail: profcarriero@virgilio.it [Istituto di Radiologia Diagnostica ed Interventistica, AOU Maggiore della Carità, Corso Mazzini 18, 28100 Novara (Italy); Bonomo, L., E-mail: lbonomo@rm.unicatt.it [Istituto di Radiologia, Università Cattolica del S.Cuore, Largo Gemelli 8, 00168 Roma (Italy); Calliada, F., E-mail: f.calliada@smatteo.pv.it [Istituto di Radiologia c/o IRCCS Policlinico San Matteo Ospedale Generale Regionale, Piazzale Golgi 27100, Pavia (Italy); Campioni, P., E-mail: paolo.campioni@unife.it [Dipartimento di Scienze Chirurgiche, Radiologiche e Anestesiologiche, Sezione di Diagnostica per Immagini, Università di Ferrara Corso della Giovecca No. 203, 44100, Ferrara (Italy); Colosimo, C., E-mail: colosimo@rm.unicatt.it [Istituto di Radiologia, Università Cattolica del S.Cuore, Largo Gemelli 8, 00168 Roma (Italy); Cotroneo, A., E-mail: ar.cotroneo@rad.unich.it [Istituto di Radiologia, Università degli Studi Di Chieti (Italy); Cova, M., E-mail: cova@gnbts.univ.trieste.it [UCO di Radiologia, Ospedale di Cattinara, Strada di Fiume 447, 34149 Trieste (Italy); Ettorre, G.C., E-mail: g.ettorre@unict.it [Dip. Materno-Infantile e Scienze Radiologiche, Az. Ospedaliero-Universitaria Policlinico, Via S. Sofia 86, 95123 Catania (Italy); Fugazzola, C., E-mail: carlo.fugazzola@uninsubria.it [Dipartimento di Radiologia Ospedale Di Circolo, Viale Borri, No. 57, 21100, Varese (Italy); Garlaschi, G., E-mail: giacomog@unige.it [Dipartimento di Medicina interna e Specialità mediche (DIMI) Via L.B. Alberti, 4, 16132 Genova (Italy); Macarini, L., E-mail: l.macarini@unifg.it [Radiologia Universitaria Ospedali Riuniti di Foggia, Viale Pinto, No. 1, 71100, Foggia (Italy); and others
2012-12-15
the band speed and technology of the Internet connection. Conclusions: Technological evolution is overcoming all barriers, and technology is also having a positive impact on the approach to teaching. Our multicentre teaching experience merits the following considerations: the quality of the teaching product was certified by the students’ judgements of its didactic content and the quality of reception; the economic cost of the teaching had a minimal impact on the post-graduate schools (€ 18 per lesson). In terms of breaking down national barriers, it is to be hoped that the coordination and integration of diagnostic imaging e-learning projects, with the participation of post-graduate schools in different European countries, can be developed not only in a spirit of “cultural sharing” and the exchange of teaching experiences.
E-learning in radiology: An Italian multicentre experience
International Nuclear Information System (INIS)
Carriero, A.; Bonomo, L.; Calliada, F.; Campioni, P.; Colosimo, C.; Cotroneo, A.; Cova, M.; Ettorre, G.C.; Fugazzola, C.; Garlaschi, G.; Macarini, L.
2012-01-01
the band speed and technology of the Internet connection. Conclusions: Technological evolution is overcoming all barriers, and technology is also having a positive impact on the approach to teaching. Our multicentre teaching experience merits the following considerations: the quality of the teaching product was certified by the students’ judgements of its didactic content and the quality of reception; the economic cost of the teaching had a minimal impact on the post-graduate schools (€ 18 per lesson). In terms of breaking down national barriers, it is to be hoped that the coordination and integration of diagnostic imaging e-learning projects, with the participation of post-graduate schools in different European countries, can be developed not only in a spirit of “cultural sharing” and the exchange of teaching experiences.
Políticas públicas: pontos de método e experiências
Directory of Open Access Journals (Sweden)
Sawaya Ana Lydia
2006-01-01
Full Text Available O ÊXITO das políticas públicas depende de diversos fatores. Entre esses, é fundamental o conhecimento da realidade para a definição do conteúdo e da gestão dos programas de utilidade pública. Fundamentar o conhecimento na realidade concreta, ou seja, nas circunstâncias que as pessoas vivem cotidianamente, centrando a atenção na "pessoa" e suas experiências de vida, permite maior eficiência de atuação e nova forma de intervenção, capaz de valorizar os aspectos positivos e as tentativas de resposta às necessidades já construídas pela pessoa e sua comunidade. Fortalecer essas tentativas pode então representar uma decisão importante e inovadora no panorama dos programas públicos.
New tools for scientific learning in the EduSeis project: the e-learning experiment
Directory of Open Access Journals (Sweden)
A. Zollo
2007-06-01
Full Text Available The Educational Seismological Project (EduSeis is a scientific and educational project, the main aim of which is the development and implementation of new teaching methodologies in Earth Sciences, using seismology as a vehicle for scientific learning and awareness of earthquake risk. Within this framework, we have recently been experimenting with new learning and information approaches that are mainly aimed at a high school audience. In particular, we have designed, implemented and tested a model of an e-learning environment in a high school located in the surroundings of the Mt. Vesuvius volcano. The proposed e-learning model is built on the EduSeis concepts and educational materials (web-oriented, and is based on computer-supported collaborative learning. Ten teachers from different disciplines and fifty students at the I.T.I.S. Majorana technical high school (Naples have been taking part in a cooperative e-learning experiment in which the students have been working in small groups (communities. The learning process is assisted and supervised by the teachers. The evaluation of the results from this cooperative e-learning experiment has provided useful insights into the content and didactic value of the EduSeis modules and activities. The use of network utilities and the Learning Community approach promoted the exchange of ideas and expertises between students and teachers and allowed a new approach to the seismology teaching through a multidisciplinary study.
Directory of Open Access Journals (Sweden)
O. J. Boock
1960-01-01
Full Text Available Neste trabalho são relatados os resultados obtidos em sete experiências de adubação da batatinha (Solanum tuberosum L., conduzidas em 1952-53 e 1953-54 em várias localidades do Estado de São Paulo, e nas quais foram comparadas três formas de potássio na presença de nitrogênio e fósforo. O efeito da adubação potássica foi praticamente nulo em três experiências. Em média das outras quatro a produção com NP foi de 6,66 t/ha e os aumentos provocados pela adição de 30, 60 e 90 kg/ha de K(20 foram respectivamente de 20, 23 e 27% com sulfato e cloreto de potássio aumentaram um pouco o tamanho dos tubérculos, ao passo que leucíta o diminuiu consideravelmente. A incidência de manchas internas ("chocolate" nos tubérculos não foi modificada pela adubação potássica.This paper presents the results obtained in seven experiments conducted in 1952-53 and 1953-54 at various localities of the State of São Paulo, in which three sources of potassium were tested in the presence of nitrogen and phosphorus. No response to potassium was observed in three of the experiments. Based on the average results from the other four trials the yield with NP was 6.66 tons per hectare and the increases due to additions of 30, 60 and 90 kilograms of K(20 per hectare were respectively of 20, 23 and 27% with sulphate of potassium and 12, 17 and 17% with potassium chloride; equal K(20 applications in the form of leucite did not modify the yields. While potassium sulphate and chloride incfeased a little the size of the tubers, leucite decreased it considerably. Potassium applications did not modify the incidence of internal brown spots.
SEEK-2 (Sporadic-E Experiment over Kyushu 2 − Project Outline, and Significance
Directory of Open Access Journals (Sweden)
R. Pfaff
2005-10-01
Full Text Available SEEK-2 (Sporadic-E Experiment over Kyushu 2 is an observation campaign to study the spatial structure of the field-aligned irregularity (FAI and sporadic-E(Es-layer by means of two sounding rockets and a ground-based observation network with radars and optical instruments. The experiment was successfully conducted on 3 August 2002, with successive launches of two sounding rockets from the Uchinoura Space Center (USC of the Japan Aerospace Exploration Agency (JAXA. The timing of the experiment was carefully selected, while intense quasi-periodic (QP echoes were observed with two radars in Tanegashima. The main Es-layer, with its double-layered structure, was observed at altitudes of 103–105 km, the presence of which was well accounted for by the ion accumulation due to neutral-wind shear. Several minor peaks were detected in the electron density profiles at altitudes of up to 130 km. The intensity of the electric field was 5–10 mV/m and showed intense fluctuations below 110 km. Wave-like variation of the electric field was seen above 110 km. From radar experiments, we found that QP echoes appeared around 105 km, which agreed well with the main Es-layer height. The QP echoes propagated to the west-northwest, with frontal structures elongated from north-northeast to south-southwest. Radar observations conduced throughout the SEEK-2 period, on the other hand, showed that frontal structures of the QP echoes were most frequently propagated to the southeast. This result was consistent with the direction of gravity-wave propagation observed with the OH imager during the same period. The rocket beacon experiment with the Es-layers revealed the spatial structure of the plasma densities. On the basis of these results and those from SEEK-1 in 1996, we examined the structures of the nighttime mid-latitude E-region. We concluded that the QP echoes reflect the horizontal structures of the main Es-layers. The source of the structures was not clearly
SMOG programme version for np (E=1-5 GeV) experiment
International Nuclear Information System (INIS)
Kotorobaj, F.
1975-01-01
The SMOG program, which can be used for NPD robot scanning in the described experiment, is described. A new modifiaction, set up so as to ensure its reliable use on the CDC-1604A, is considered. The program was designed for and used in processing the np (E=1-5 GeV) experiment. SMOG uses three magnetic tapes at the input (one at the extension) and one at the output containing the assembled collected events. A new SMOG variant with origination of errors according to parity during the recording time is attempted in order to continue to write the given zone five times. A short description of the work with the new SMOG program version is given
Alternative Mixed Assessment Project (ALT.A.: The Mexican E-Learning Experience
Directory of Open Access Journals (Sweden)
Mónica A. López-Campos
2010-11-01
Full Text Available The aim of this paper is to present an experiment of mixed evaluation (summative/formative of questions formulated by students in a distance-education environment carried out in the Total Quality Management course in the B.S. degree in Industrial Engineering offered by Mexican public universities. Questions generated by students were evaluated using a specially-designed quantitative tool: Matrix Observation of four criteria with binary scoring. The experiment showed: (1 how is it possible to enrich the evaluation process, and formalize students' skills hardly recognizable with traditional forms of assessment; and (2 how the teacher-student interaction can be increased significantly by the technique mixed evaluation of questions in reverse, i.e. by the students.
The next phase of the Axion Dark Matter eXperiment
Carosi, Gianpaolo; Asztalos, S.; Hagmann, C.; Kinion, D.; van Bibber, K.; Hotz, M.; Lyapustin, D.; Rosenberg, L.; Rybka, G.; Wagner, A.; Hoskins, J.; Martin, C.; Sikivie, P.; Sullivan, N.; Tanner, D.; Bradley, R.; Clarke, J.; ADMX Collaboration
2011-04-01
Axions are a well motivated dark matter candidate which may be detected by their resonant conversion to photons in the presence of a large static magnetic field. The Axion Dark Matter eXperiment recently finished a search for DM axions using a new ultralow noise microwave receiver based on a SQUID amplifier. The success of this precursor experiment has paved the way for a definitive axion search which will see the system noise temperature lowered from 1.8 K to 100 mK, dramatically increasing sensitivity to even pessimistic axion models as well as increasing scan speed. Here we discuss the implementation of this next experimental phase. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Security, LLC, Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.
Calcificações malignas da mama: correlação mamografia-anatomia patológica
Directory of Open Access Journals (Sweden)
Vianna Alberto Domingues
2002-01-01
Full Text Available Neste trabalho foram realizados 30 estudos de correlação entre os achados da mamografia e da anatomia patológica em 29 pacientes com tumores malignos na mama, cujas mamografias apresentaram calcificações relacionadas com as lesões. Os objetivos principais foram: verificar se as formas das calcificações corresponderam a tipos específicos de tumores e se as formas das calcificações estavam relacionadas aos locais onde eram formadas. Foram estudados dois aspectos objetivos das calcificações identificados nas mamografias: forma e distribuição. Este estudo concluiu que os carcinomas tipo comedo tiveram elevada freqüência de calcificações pleomorfas (95,5% e padrão de distribuição ductal em 66,5% dos casos. Os carcinomas tipo cribriforme, quando não associados ao tipo comedo, evidenciaram somente calcificações arredondadas em 66,5% dos casos e predominância de distribuição indefinida (78,5%. Os tumores micropapilares, quando não associados ao tipo comedo, mostraram somente calcificações arredondadas em 66,5% dos casos e predominância do padrão de distribuição indefinido (66,5%. Nenhum tumor mostrou padrão de distribuição lobular. Calcificações amorfas na ausência de nódulo tumoral são suspeitas de carcinoma ductal infiltrante. De acordo com o padrão histológico arquitetural dos 30 tumores, 24 (80% tiveram calcificações com as formas esperadas.
The websites of Japanese Ryokan and eWOM: their impacts on guests' expectation and experience.
Jimura, Takamitsu
2011-01-01
The research aims to investigate the impacts of the websites of ryokan and e-WordOf-Mouth (eWOM) available at the websites of Japanese e-travel agents on the guests' expectation for and experience at ryokan. The research stems from interpretivism and mainly adopts an inductive approach. Netnography is selected as a research strategy. The top three ryokan in terms of sales ranking are chosen. eWOM about these three are analysed, focusing on the impacts of websites and eWOM in developing the gu...
Experiments with the MD-1 detector at the e+e- collider VEPP-4 in the energy region of Υ mesons
International Nuclear Information System (INIS)
Baru, S.E.; Blinov, A.E.; Blinov, V.E.; Bondar, A.E.; Bukin, A.D.; Groshev, V.R.; Eidelman, Yu.I.; Kiselev, V.A.; Klimenko, S.G.; Kolachev, G.M.; Mishnev, S.I.; Onuchin, A.P.; Panin, V.S.; Petrov, V.V.; Protopopov, I.Ya.; Shamov, A.G.; Sidorov, V.A.; Skovpen, Yu.I.; Skrinsky, A.N.; Tayursky, V.A.; Telnov, V.I.; Tikhonov, Yu.A.; Tumaikin, G.M.; Undrus, A.E.; Vorobiov, A.I.; Zhilich, V.N.
1996-01-01
This paper reviews physical results obtained at the e + e - collider VEPP-4 with the MD-1 detector. The results of experiments on the Υ meson physics and study of the hadron production in continuum in the energy region 7.2-10.3 GeV as well as the results of study of the two photon reactions are presented. Among results obtained in the upsilon physics: the precise measurement of the Υ(1S), Υ(2S), Υ(3S) masses and the precise determination of the Υ(1S) and Υ(2S) electronic widths. In the experiments on study of the hadron production in continuum the precise measurement of the R was carried out. The peculiarity of the detector is the magnetic field transverse to the orbit plane which provided the possibility to study two photon reactions with tagging one or both scattered electrons even at zero emission angle. Among results on the γγ reactions is the measurement of the two photon total hadronic cross section performed in the double-tag mode. In the QED experiments a new QED effect - the impact parameter cut-off in single bremsstrahlung was discovered. (orig.)
Overview and performance of the FNAL KTeV DAQ system
International Nuclear Information System (INIS)
Nakaya, T.; O'Dell, V.; Hazumi, M.; Yamanaka, T.
1995-11-01
KTeV is a new fixed target experiment at Fermilab designed to study CP violation in the neutral kaon system. The KTeV Data Acquisition System (DAQ) is out of the highest performance DAQ's in the field of high energy physics. The sustained data throughput of the KTeV DAQ reaches 160 Mbytes/sec, and the available online level 3 processing power is 3600 Mips. In order to handle such high data throughput, the KTeV DAQ is designed around a memory matrix core where the data flow is divided and parallelized. In this paper, we present the architecture and test results of the KTeV DAQ system
D-S(+) meson production at central rapidity in proton-proton collisions at root s=7 TeV
Czech Academy of Sciences Publication Activity Database
Abelev, B.; Adam, J.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Čepila, J.; Křelina, M.; Krus, M.; Kushpil, Svetlana; Kushpil, Vasilij; Mareš, Jiří A.; Pachr, M.; Petráček, V.; Petráň, M.; Polák, Karel; Pospíšil, V.; Šmakal, R.; Šumbera, Michal; Tlustý, D.; Vajzer, Michal; Wagner, V.; Zach, Č.; Závada, Petr
2012-01-01
Roč. 718, č. 2 (2012), s. 279-294 ISSN 0370-2693 R&D Projects: GA MŠk LA08015 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : pp collision * LHC * ALICE Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.569, year: 2012 http://ac.els-cdn.com/S0370269312011033/1-s2.0-S0370269312011033-main.pdf?_tid=66494730-7f2f-11e2-9fda-00000aab0f6c&acdnat=1361785413_f665c680e47c1ab9c8c665ea58c1e2d7
Addition of photosensitive dopants to the D0 liquid argon calorimeter
International Nuclear Information System (INIS)
Amos, N.A.; Anderson, D.F.
1992-10-01
The addition of photosensitive dopants to liquid argon greatly enhances the signal from heavily ionizing particles. Since binding energy losses we correlated with the heavily ionizing component in hadronic showers, the addition of photosensitive dopants has been suggested as a mechanism to tune the e/π ratio in liquid argon calorimeters. A measurement was performed at the FNAL test beam, adding 4 ppM tetramethylgermanium to the Dφ uranium-liquid argon calorimeter. An increase in response for electromagnetic and hadronic showers was observed, with no net change in the e/π ratio
Directory of Open Access Journals (Sweden)
Luiz Fernando Dias Duarte
2003-01-01
Full Text Available Revisão de uma linha de pesquisa no campo das ciências sociais em saúde no Brasil que se centra na hipótese metodológica de uma diferença cultural fundamental entre os modelos relacionais de "pessoa" e o modelo do "indivíduo" ocidental moderno (pensado como livre, autônomo e igual. Essa diferença cultural é de particular importância na caracterização das formas diferenciais de experiência da saúde e da doença entre as classes populares das sociedades nacionais modernas e os segmentos portadores dos saberes biomédicos eruditos, dominantes e oficiais. Estes últimos têm um compromisso originário com algumas características da ideologia do individualismo, tais como o universalismo/racionalismo e o cientificismo/fisicalismo. As representações, práticas e instituições dela dependentes ocupam um espaço de oposição à forma integrada, relacional, holista, como são pensadas e experimentadas as "doenças" (ou, como prefiro, as "perturbações físico-morais" mesmo nos segmentos "individualizados", quanto mais nos segmentos regidos por representações hierárquicas, relacionais, de "pessoa". Apresentam-se os fundamentos antropológicos dessa perspectiva analítica e as diferentes dimensões da produção acadêmica a ela associada, em comparação com as de outras tendências do campo.This is a review of a research line present in Brazilian social science studies about health and illness, characterized by a methodological emphasis in the cultural distinction between relational models of the "person" and the modern Western model of the "individual" (conceived as free, autonomous and equal. That distinction is particularly important for the perception of different forms of the experience of health and illness, mostly between working classes in modern national societies and the social segments responsible for biomedical knowledge, as a learned, dominant or official ideology. This knowledge is fundamentally related to the
Conversas com o fracasso escolar: marcas e experiências de uma travessia
Silva, Camila Josefina da
2013-01-01
Esta dissertação aborda a temática do Fracasso Escolar, enquanto marca-experiências-travessia produzidas numa escola pública da rede municipal de Juiz de Fora. A pesquisa foi realizada no Ensino Fundamental I (1º ao 5º ano) no segundo semestre do ano de 2011. Esta se configura numa problematização em torno do fracasso escolar, das marcas da experiência que constituem esse lugar e também dos acontecimentos do campo investigativo. Além de problematizar a temática em torno do fracasso escolar a ...
International Nuclear Information System (INIS)
Diesener, H.; Helm, U.; Neumann-Cosel, P. von; Richter, A.; Schrieder, G.; Stascheck, A.; Stiller, A.; Carter, J.
2001-01-01
The 40 Ca(e,e'x; x=p,α) reaction has been measured in the giant resonance excitation region for E x ≅8-26 MeV. The present article is the first out of three describing the experiments and giving an overview of the results. Data were taken at four momentum transfers in the range q=0.26-0.66 fm -1 . Angular correlations for decay to the ground state and low-lying states of 39 K and 36 Ar could be extracted as a function of excitation energy in 40 Ca. Excitation energy spectra integrated over the particle emission angle were generated for the various resolved decay channels. Comparisons of the giant resonance cross-section distributions with results using other electromagnetic or hadronic probes have been made and good agreement is found in most cases
Os ideais da formação humanista e o sentido da experiência escolar
Directory of Open Access Journals (Sweden)
José Sérgio Fonseca de Carvalho
Full Text Available Resumo A sensação de que a instituição escolar vive uma profunda crise é bastante generalizada, sobretudo entre intelectuais e profissionais da educação. O consenso acerca de sua existência, no entanto, não tem implicado qualquer concordância no que concerne aos elementos que a teriam precipitado ou às características de sua atual configuração. A hipótese que guia essas reflexões visa a associar a noção de uma crise na educação escolar a um aspecto que costuma permanecer oculto na maior parte dos discursos críticos acerca da escolarização contemporânea: o esvanecimento do sentido político e existencial da experiência escolar. A fim de desenvolver tal hipótese, debruçamo-nos, inicialmente, sobre a variedade de possíveis acepções do termo “crise”, rejeitando aquelas que a vinculam de forma imediata às noções de declínio, decadência ou ocaso. A partir dos escritos de Arendt e Koselleck, a noção de crise é, então, utilizada em sua acepção primeira: a da emergência de um momento crucial que, por romper com respostas cristalizadas na tradição, exige reflexão e decisão. O que se procura realizar é, pois, um exercício de pensamento que recuse as abordagens funcionais e econômicas do sistema escolar em favor da compreensão de um sentido intrínseco para a experiência escolar: o da iniciação dos mais novos em heranças simbólicas capazes de dar inteligibilidade à experiência humana e durabilidade ao mundo comum. Uma iniciação cujo significado transcende qualquer funcionalidade exterior à experiência escolar, já que reside na própria formação de um sujeito, e não em sua possível inserção em um sistema produtivo.
Os ideais da formação humanista e o sentido da experiência escolar
Directory of Open Access Journals (Sweden)
José Sérgio Fonseca de Carvalho
2016-11-01
Full Text Available Resumo A sensação de que a instituição escolar vive uma profunda crise é bastante generalizada, sobretudo entre intelectuais e profissionais da educação. O consenso acerca de sua existência, no entanto, não tem implicado qualquer concordância no que concerne aos elementos que a teriam precipitado ou às características de sua atual configuração. A hipótese que guia essas reflexões visa a associar a noção de uma crise na educação escolar a um aspecto que costuma permanecer oculto na maior parte dos discursos críticos acerca da escolarização contemporânea: o esvanecimento do sentido político e existencial da experiência escolar. A fim de desenvolver tal hipótese, debruçamo-nos, inicialmente, sobre a variedade de possíveis acepções do termo “crise”, rejeitando aquelas que a vinculam de forma imediata às noções de declínio, decadência ou ocaso. A partir dos escritos de Arendt e Koselleck, a noção de crise é, então, utilizada em sua acepção primeira: a da emergência de um momento crucial que, por romper com respostas cristalizadas na tradição, exige reflexão e decisão. O que se procura realizar é, pois, um exercício de pensamento que recuse as abordagens funcionais e econômicas do sistema escolar em favor da compreensão de um sentido intrínseco para a experiência escolar: o da iniciação dos mais novos em heranças simbólicas capazes de dar inteligibilidade à experiência humana e durabilidade ao mundo comum. Uma iniciação cujo significado transcende qualquer funcionalidade exterior à experiência escolar, já que reside na própria formação de um sujeito, e não em sua possível inserção em um sistema produtivo.
Oficina de informática com meninos e meninas de rua: relato de uma experiência
Directory of Open Access Journals (Sweden)
Claudia Rabello de Castro
1999-01-01
Full Text Available Há evidências, tanto da dificuldade de meninos e meninas de rua em conseguir escolarizar-se, como de que valorizam a escola, embora não sejam bem sucedidos nela, o que faz com que se sintam incapazes como aprendizes. O computador pode ser pensado como instrumento mental, com status de bem de consumo valorizado, associado a domínio da tecnologia e sofisticação intelectual, e ser uma via para reintroduzir a aprendizagem formal, de forma não associada a fracassos anteriores. Dez meninos e meninas, atendidos por uma instituição não governamental, participaram de uma oficina nesse sentido. A proposta - de aprender a usar o computador para escrever suas estórias, com a meta de elaborar uma publicação - visou propiciar mudanças sócio-cognitivas e no vínculo com a aprendizagem formal. A experiência parece ter sido bem sucedida em alguns aspectos e é relatada neste trabalho. Experiências como esta podem ser ampliadas e usadas como facilitadoras na reintegração de meninos e meninas de rua em ambientes de aprendizagem formal.
The Midlatitude Continental Convective Clouds Experiment (MC3E)
Energy Technology Data Exchange (ETDEWEB)
Jensen, Mark P.; Petersen, Walt A.; Bansemer, Aaron; Bharadwaj, Nitin; Carey, Larry; Cecil, D. J.; Collis, Scott M.; Del Genio, Anthony D.; Dolan, Brenda A.; Gerlach, J.; Giangrande, Scott; Heymsfield, Andrew J.; Heymsfield, Gerald; Kollias, Pavlos; Lang, T. J.; Nesbitt, Steve W.; Neumann, Andrea; Poellot, M. R.; Rutledge, Steven A.; Schwaller, Mathew R.; Tokay, Ali; Williams, C. R.; Wolff, D. B.; Xie, Shaocheng; Zipser, Edward J.
2016-10-18
The Midlatitude Continental Convective Clouds Experiment (MC3E), a field program jointly led by the U.S. Department of Energy’s Atmospheric Radiation Measurement program and the NASA Global Precipitation Measurement (GPM) Mission, was conducted in south-central Oklahoma during April – May 2011. MC3E science objectives were motivated by the need to improve understanding of midlatitude continental convective cloud system lifecycles, microphysics, and GPM precipitation retrieval algorithms. To achieve these objectives a multi-scale surface- and aircraft-based in situ and remote sensing observing strategy was employed. A variety of cloud and precipitation events were sampled during the MC3E, of which results from three deep convective events are highlighted. Vertical structure, air motions, precipitation drop-size distributions and ice properties were retrieved from multi-wavelength radar, profiler, and aircraft observations for an MCS on 11 May. Aircraft observations for another MCS observed on 20 May were used to test agreement between observed radar reflectivities and those calculated with forward-modeled reflectivity and microwave brightness temperatures using in situ particle size distributions and ice water content. Multi-platform observations of a supercell that occurred on 23 May allowed for an integrated analysis of kinematic and microphysical interactions. A core updraft of 25 ms-1 supported growth of hail and large rain drops. Data collected during the MC3E campaign is being used in a number of current and ongoing research projects and is available through the DOE ARM and NASA data archives.
Directory of Open Access Journals (Sweden)
Ana Paula Serrata Malfitano
2011-06-01
Full Text Available O presente texto traz a apresentação de um relato de pesquisa, tendo como base a experiência metodológica desenvolvida em uma tese de doutorado. Objetiva-se discutir as possibilidades e os limites da realização de pesquisas por atores envolvidos com o objeto em estudo. Especificamente, parte-se da situação de ocupar o lugar de profissional participante da proposição, implementação e intervenção técnica em uma política social direcionada para crianças e adolescentes em situação de rua para, posteriormente, realizar uma pesquisa sobre a experiência em curso. Aportando-se na discussão sobre a metodologia materialista-histórica, a observação participante e a "objetivação participante", ou seja, a centralidade do método no ato de objetivar a participação para, consequentemente, compreender e buscar mudanças na realidade; defendem-se as potencialidades e as riquezas de investigações realizadas pelos próprios atores envolvidos no processo de trabalho. Faz-se importante, também, reconhecer a inexistência de imparcialidade no processo, inerente à compreensão de atuação da visão do pesquisador, bem como destacar a necessidade de embasamento teórico para possibilitar as reflexões que busquem ofertar uma apreensão aprofundada da realidade com a qual se está diretamente envolvido.The author of this text discusses the presentation of a research report, based on the methodological experience developed in a PhD dissertation. The aim is to discuss the possibilities and limitations of research being conducted by the actors involved with the object being studied. Specifically, the author departs from the situation of occupying the place of a professional who is a participant in the proposition, implementation and technical intervention in a social policy directed to children and teenagers living on the street, and then she carries out a research on the ongoing experience. By contributing to the discussion on the
The Next Linear Collider Design: NLC 2001
Energy Technology Data Exchange (ETDEWEB)
Larsen, Alberta
2001-08-21
Recent studies in elementary particle physics have made the need for an e{sup +}e{sup -} linear collider able to reach energies of 500 GeV and above with high luminosity more compelling than ever. Observations and measurements completed in the last five years at the SLC (SLAC), LEP (CERN), and the Tevatron (FNAL) can be explained only by the existence of at least one particle or interaction that has not yet been directly observed in experiment. The Higgs boson of the Standard Model could be that particle. The data point strongly to a mass for the Higgs boson that is just beyond the reach of existing colliders. This brings great urgency and excitement to the potential for discovery at the upgraded Tevatron early in this decade, and almost assures that later experiments at the LHC will find new physics. But the next generation of experiments to be mounted by the world-wide particle physics community must not only find this new physics, they must find out what it is. These experiments must also define the next important threshold in energy. The need is to understand physics at the TeV energy scale as well as the physics at the 100-GeV energy scale is now understood. This will require both the LHC and a companion linear electron-positron collider.
The Next Linear Collider Design: NLC 2001
International Nuclear Information System (INIS)
Larsen, Alberta
2001-01-01
Recent studies in elementary particle physics have made the need for an e + e - linear collider able to reach energies of 500 GeV and above with high luminosity more compelling than ever. Observations and measurements completed in the last five years at the SLC (SLAC), LEP (CERN), and the Tevatron (FNAL) can be explained only by the existence of at least one particle or interaction that has not yet been directly observed in experiment. The Higgs boson of the Standard Model could be that particle. The data point strongly to a mass for the Higgs boson that is just beyond the reach of existing colliders. This brings great urgency and excitement to the potential for discovery at the upgraded Tevatron early in this decade, and almost assures that later experiments at the LHC will find new physics. But the next generation of experiments to be mounted by the world-wide particle physics community must not only find this new physics, they must find out what it is. These experiments must also define the next important threshold in energy. The need is to understand physics at the TeV energy scale as well as the physics at the 100-GeV energy scale is now understood. This will require both the LHC and a companion linear electron-positron collider
Search on neutrino oscillation νμ→νe in the NOMAD experiment
International Nuclear Information System (INIS)
Valuev, Viatcheslav
1998-01-01
The NOMAD experiment is a search for neutrino oscillations using the large band neutrino beams of SPS at CERN. It is dealing with the two oscillation modes: ν μ →ν τ and ν μ →ν e . This thesis presents the results obtained in the search of oscillations ν μ →ν e with the data produced by NOMAD in 1995 and 1996. The first two chapters deal with the short presentation of the neutrino oscillation phenomenology and a summary of the experimental situation. The third chapter describes the experimental setup of the NOMAD detector at CERN, designed to identify the interactions of ν e by means of the charged current. This is done with the transition radiation detector (TRD) designed to separate the electrons from pions with a rejection factor higher then 1000 at an electron efficiency of 90%, in the 1 - 50 GeV region. Details about the TRD operation are given in chapter four. The fifth chapter gives the algorithms of electron-pion separation as well as their performances. The last two chapters present the analysis of the ν μ →ν e data obtained in 1995 and 1996 and the final results. The conclusion is that the available data give no evidence for the neutrino oscillations. The upper limit obtained for the mixing angle is sin 2 (2θ) -3 (90% C.L.). This result eliminates completely the oscillation region of LSND experiment (Liquid Scintillator Neutrino Detector) at LAMPF for Δm 2 > 15 eV 2 and gives the most constraining world limit on sin 2 (2θ) for Δm 2 > 20 eV 2
Yerdelen-Damar, Sevda; Boz, Yezdan; Aydın-Günbatar, Sevgi
2017-08-01
This study examined the relations of preservice science teachers' attitudes towards technology use, technology ownership, technology competencies, and experiences to their self-efficacy beliefs about technological pedagogical content knowledge (TPACK). The present study also investigated interrelations among preservice teachers' attitudes towards technology use, technology ownership, technology competencies, and experiences. The participants of study were 665 elementary preservice science teachers (467 females, 198 males) from 7 colleges in Turkey. The proposed model based on educational technology literature was tested using structural equation modeling. The model testing results revealed that preservice teachers' technology competencies and experiences mediated the relation of technology ownership to their TPACK self efficacy beliefs. The direct relation of their possession of technology to their TPACK self efficacy beliefs was insignificant while the indirect relation through their technology competencies and experiences was significant. The results also indicated there were significant direct effects of preservice teachers' attitudes towards technology use, technology competencies, and experiences on their TPACK self efficacy beliefs.
International Nuclear Information System (INIS)
Papavassiliou, V.
1992-01-01
Preliminary results are presented on the measurement of the cross-section ratio σ n /σ p inelastic μN scattering obtained by the E-665 experiment using the Fermilab 490 GeV/c muon beam and liquid H 2 and D 2 targets. The results extend the previously measured x range by two orders of magnitude, down to 2 x 10 -5 , at Q 2 > 10 -2 GeV 2 /C 2 . The ratio is consistent with 1 throughout the new range
A WIMS E analysis of zero energy experiments performed on the Dragon reactor
Energy Technology Data Exchange (ETDEWEB)
Lancefield, M. J.; Broadhouse, B.; Woloch, F.
1974-10-15
UKAEA methods embodied in the WINS-E modular scheme of codes are described in their application to the analysis of zero energy experiments performed on the DRAGON reactor. Measured reactivity and reaction rate distributions are compared with the predictions of the analysis.
Neutrino Oscillations Present Status and Future Plans
Thomas, Jennifer
2008-01-01
This book reviews the status of a very exciting field - neutrino oscillations - at a very important time. The fact that neutrinos have mass has only been proved in the last few years and the acceptance of that fact has opened up a whole new area of study to understand the fundamental parameters of the mixing matrix. The book summarizes the results from all the experiments which have played a role in the measurement of neutrino oscillations and briefly describes the scope of some new planned experiments. Contributions include a theoretical introduction by Stephen Parke from FNAL, as well as art
Quench Performance of the First Twin-aperture 11 T Dipole for LHC upgrades
Zlobin, A V; Apollinari, G; Barzi, E; Chlachidze, G; Nobrega, A; Novitski, I; Stoynev, S; Turrioni, D; Auchmann, B; Izquierdo Bermudez, S; Karppinen, M; Rossi, L; Savary, F; Smekens, D
2015-01-01
FNAL and CERN are developing a twin-aperture 11 T Nb$_{3}$Sn dipole suitable for installation in the LHC. A single-aperture 2-m long dipole demonstrator and two 1-m long dipole models have been fabricated and tested at FNAL in 2012-2014. The two 1 m long collared coils were then assembled into the first twin-aperture Nb$_{3}$Sn demonstrator dipole and tested. Test results of this twin-aperture Nb$_{3}$Sn dipole model are reported and discussed.
Georges Bataille, Michel Leiris e a experiência do sagrado no entreguerras
Directory of Open Access Journals (Sweden)
Júlia Vilaça Goyatá
2014-12-01
Full Text Available O presente artigo tem como objetivo elucidar os usos e sentidos da noção de sagrado nas formulações teóricas e nas trajetórias intelectuais de Georges Bataille (1897-1962 e Michel Leiris (1901-1990 na Paris dos anos 1930. Em meio às diversas experiências estético-políticas da época, que questionavam as possíveis formas da ação política tendo em vista sua ligação com a arte, destaca-se a proposta do Collège de Sociologie (1937-1939, associação animada pelos autores junto a Roger Caillois (1913-1978. O grupo toma o sagrado em dupla articulação: ao mesmo tempo que conceito descritivo, ele passa a ser entendido também como um operador político. Tal ideia é o ponto de partida para as reflexões conjugadas e ao mesmo tempo originais de Bataille e Leiris.
Directory of Open Access Journals (Sweden)
Mary Rute Gomes Esperandio
2007-08-01
Full Text Available O texto apresenta um recorte da reflexão desenvolvida na tese de doutorado: "Narcisismo e sacrifício: Modo de subjetivação e religiosidade contemporânea" (Esperandio, 2006. Trata-se de uma análise da experiência religiosa promovida pela Igreja Universal do Reino de Deus (IURD a partir da sua proposta de sacrifício. A abordagem trabalha com a concepção de narcisismo ativo e reativo e defende a idéia de que a prática do sacrifício, tal como proposta pela IURD, articula elementos do narcisismo reativo e estabelece-se como uma tecnologia do eu, usada como remédio para lidar com a experiência contemporânea da vergonha.This text presents part of the reflection developed in my Doctoral Thesis on "Narcissism and sacrifice: Mode of subjectivation and contemporary religiosity" (Esperandio, 2006. It analyses the religious experience supported by the Universal Church of the Kingdom of God (UCKG on its proposal of sacrifice. This approach sustains the conception of active and reactive narcissism and defends the idea that such practice of sacrifice proposed by UCKG relates some elements of reactive narcissism and establishes itself as a Technology of Self used as a remedy to deal with the contemporary experience of shame.
LUIS A. B. CORTEZ; JUAN M. M. PEREZ; JOSÉ D. ROCHA; RODRIGO A. JORDAN; HENRY R. M. MESA
2009-01-01
Atualmente o Brasil é o maior produtor de coco verde, com uma área plantada equivalente a 57 mil hectares, onde a maior parte da parte da produção (66,5%) se concentra na região Nordeste. O descarte do coco depois do consumo da água representa um problema para os sistemas de coleta e tratamento de lixo, pela sua lenta degradação devido ao alto teor de fibras. Neste trabalho são mostrados os resultados da pirólise lenta da fibra e da casca do coco verde. Os experimentos foram conduzidos em um ...
Lead and/or Lead Oxide Nanoparticle Generation for Inhalation Experiments
Czech Academy of Sciences Publication Activity Database
Moravec, Pavel; Smolík, Jiří; Ondráček, Jakub; Vodička, Petr; Fajgar, Radek
2015-01-01
Roč. 49, č. 8 (2015), s. 655-665 ISSN 0278-6826 R&D Projects: GA ČR(CZ) GAP503/11/2315 Institutional support: RVO:67985858 Keywords : chemical-vapor-deposition * thin films * ion batteries Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.953, year: 2015
Modeling Laser and e-Beam Generated Plasma-Plume Experiments Using LASNEX
Ho, D
1999-01-01
The hydrodynamics code LASNEX is used to model the laser and e-beam generated plasma-plume experiments. The laser used has a wavelength of 1 (micro)m and the FWHM spot size is 1 mm. The total laser energy is 160 mJ. The simulation shows that the plume expands at a velocity of about 6 cm/(micro)s. The e-beam generated from the Experimental Test Accelerator (ETA) has 5.5 MeV and FWHM spot size ranges from 2 to 3.3 mm. From the simulations, the plasma plume expansion velocity ranges from about 3 to 6 mm/(micro)s and the velocity increases with decreasing spot size. All the simulation results reported here are in close agreement with experimental data.
Success Factors for an E-Government Strategy: Austrian Experiences, Indonesian Challenges
Directory of Open Access Journals (Sweden)
Christoph Behrens
2012-02-01
Full Text Available Focus of this paper are success factors for the implementation of an E-Government strategy. While concepts for a sophisticated strategy process in Public Sector are delivered on a regular basis, the gap between ambitious planning and its implementation seems to get wider. Authors seek to define what makes a “good strategy” in order to enhance management capacity. Meanwhile some scholars from Political Science see limitation of Governments on announcements which are not followed up by sufficient action rather as systematic problems, challenging concept and rules of liberal western democracy, or owed to growing complexity of Governance under the conditions of globalization. In context of the introduction of New Public Management and its perception of citizens as customers and on the basis of new available technical options in Information Society, a key Governance reform project in European and other Countries over the last fifteen years has been the introduction of E-Government. European market leader in this field is Austria. The author reviews concept and implementation experiences of the Austrian E-Government strategy, analyzes key success factors and opens a discussion, under which conditions a successful implementation of E-Government can take place in Indonesia.
Energy Technology Data Exchange (ETDEWEB)
Ali, A; Aydin, Z Z [Hamburg Univ. (Germany, F.R.). 2. Inst. fuer Theoretische Physik
1979-01-01
The authors evaluate weak mass mixing among the neutral heavy mesons with a bottom (Q=-1/3) or top (Q=+2/3) quark and CP violation in this framework of six quark V-A models. It is argued that bottom and top mesons may distinguish the Higgs exchange mechanism of CP violation from a complex phase in the quark mass matrix, if bottom and top quark masses are sufficiently different. Estimates of weak mixing and CP violating effects for e/sup +/e/sup -/ experiments at PETRA, PEP and CESR energies are presented.
Learning from High School Students' Lived Experiences of Reading E-Books and Printed Books
Evans, Ellen
2017-01-01
E-book sales are down nationwide, and younger readers are proving to be surprisingly persistent in their preference for printed books. Although 66% of schools nationwide offer e-books, adoption is growing at a slower than expected rate. This study takes a closer look at high school students' experiences as they read John Steinbeck's fictional…
Search for supersymmetry and leptoquark states at FNAL
International Nuclear Information System (INIS)
Hagopian, S.
1994-09-01
Searches have been made for first generation scalar and vector leptoquarks by the D0 collaboration and for second generation scalar leptoquarks by the CDF collaboration. The data sample is from the 1992-93 p bar p run at √s = 1.8 TeV at the Fermilab Tevatron Collider. Assuming that leptoquarks are pair produced and decay into charged leptons and quarks with branching fraction β, mass limits at the 95% Confidence Level (CL) have been obtained. For first generation scalar leptoquarks the lower mass limit is 130 GeV/c 2 for β = 1.0 and 116 GeV/c 2 for β = 0.5. For first generation vector leptoquarks with κ, the anomalous coupling, of 1.0 and β = 1.0, the lower mass limit is 240 GeV/c 2 and for κ = 1.0, β = 0.5, the lower mass limit is 240 GeV/c 2 . For κ = 0 and β = 1.0, the lower mass limits is 190 GeV/c 2 and for κ = 0, β = 0.5, the lower mass limit is 185 GeV/c 2 . For second generation scalar leptoquarks, the mass limits are 133 GeV/c 2 for β = 1.0 and 98 GeV/c 2 for β = 0.5. A search for squarks and gluinos, predicted by Supersymmetric models, was made by D0 in the three or more jets plus E t channel. The number of events observed was consistent with background. For heavy squarks, a lower gluino mass limit of 146 GeV/c 2 was obtained, and for equal squark and gluino masses a mass limit of 205 GeV/c 2 was obtained at the 95% CL
Theoretical and experimental studies of elementary physics
International Nuclear Information System (INIS)
Bodek, A.; Ferbel, T.; Melissinos, A.C.; Olsen, S.; Slattery, P.; Tipton, P.; Das, A.; Hagen, C.R.; Rajeev, S.G.; Okubo, S.
1992-05-01
The experimental high energy physics program is directed toward the execution of experiments that probe the basic constituents of matter and the forces between them. These experiments are carried out at national and international accelerator facilities. At the current time, we are primarily concentrating on the following projects: Direct photon production in hadronic reactions; production of hybrid mesons in the nuclear Coulomb field; the D-Zero experiment at the Tevatron collider; deep inelastic neutrino- and electron-nucleon scattering at FNAL and SLAC; nonlinear QED at critical field strengths at SLAC; the experiments at KEK (AMY, 17keV neutrino); the CDF experiment at the Tevatron collider; and SSC-related detector R ampersand D on scintillating tile- and diamond-based calorimetry and microstrip tracking detectors
Spaceflight of HUVEC: An Integrated eXperiment- SPHINX Onboard the ISS
Versari, S.; Maier, J. A. M.; Norfini, A.; Zolesi, V.; Bradamante, S.
2013-02-01
The spaceflight orthostatic challenge can promote in astronauts inadequate cardiovascular responses defined as cardiovascular deconditioning. In particular, disturbance of endothelial functions are known to lead to altered vascular performances, being the endothelial cells crucial in the maintenance of the functional integrity of the vascular wall. In order to evaluate whether weightlessness affects endothelial functions, we designed, developed, and performed the experiment SPHINX - SPaceflight of HUVEC: an INtegrated eXperiment - where HUVEC (Human Umbilical Vein Endothelial Cells) were selected as a macrovascular cell model system. SPHINX arrived at the International Space Station (ISS) onboard Progress 40P, and was processed inside Kubik 6 incubator for 7 days. At the end, all of the samples were suitably fixed and preserved at 6°C until return on Earth on Soyuz 23S.
Directory of Open Access Journals (Sweden)
Polise Moreira de Marchi
2011-09-01
Full Text Available A experiência do espaço urbano tem sofrido alterações operadas por extensões, expansões e simulaçõesem virtude da incorporação do desenvolvimento tecnológico à própria constituição física e à linguagemda cidade. Entre cidade e experiência, a interface tecnológica se apresenta como possibilidade de reconhecimento,conhecimento e produção das relações espaciais reais e potenciais das cidades contemporâneas.Desde a concepção do mundo urbano, que, segundo Henri Lefebvre (1991, esteve relacionada diretamentecom o período industrial, a tecnologia tem delimitado e pontuado as diversas fases e consequentes camadasque formam a cidade, tanto em relação à dinâmica física do espaço, como em relação à sua representação.Se de fato a tecnologia sempre esteve vinculada diretamente à própria construção das cidades, por meio deiniciativas dos governos e de grandes empresas, é na sua condição atual que se potencializa como mediaçãoentre o indivíduo e o espaço urbano, este cada vez mais tecnologicamente hibridizado. Destarte, este artigotem por objetivo discutir de que modo a tecnologia tem estabelecido novas mediações e respectivas configuraçõesno espaço urbano das cidades contemporâneas, de modo a não ser mais possível dissociá-la destecontexto. Para tal propósito, tomam-se como referência projetos ou iniciativas de pesquisa que buscam nastecnologias de informação e comunicação (TICs novos meios de extensão da cidade, em interface com ambientesurbanos geolocalizados ou virtuais.
Experiences with E-learning in Ophthalmology
Directory of Open Access Journals (Sweden)
Seema Dutt Bandhu
2014-01-01
Full Text Available Introduction: E-learning is the use of internet for the purpose of education. E-learning in medical education is at a nascent stage in our country. The present study was carried out with the purpose of introducing e-learning to third year medical students in the subject of Ophthalmology and taking feedback on their attitude towards the new methodology of teaching and evaluating. Materials and Methods: E-learning was introduced to the seventh semester students of MBBS in the subject of Ophthalmology. The topics were converted to web friendly format and used for teaching and evaluating. Feedback was taken from the students on completion of the term on their attitudes towards e-learning and their views on the scope of e-learning in medical education. Results: All the students agreed on the usefulness of e-learning in medical education. Eleven students (27.5% found the medium of e-learning to be interesting, 15 (37.5% considered it to be easy and accessible, 10 (25% found it to be fast and easy, 4 (10% considered it to be a medium which can give updated information. Twenty-three (57.5% students considered that e-learning should be a medium of instruction in all the subjects, 15 (37.5% students considered its usefulness in clinical subjects only. Twenty-eight students (70% desired that e-learning should be used to provide important notes, questions, MCQs on all topics. Conclusions: E-learning is well accepted as a medium of instruction by medical students.
Experiência da UNICENTRO no Projeto Rondon em Irituia/PA: uma lição de vida e cidadania
Directory of Open Access Journals (Sweden)
Ana Paula Perardt Farias
2017-06-01
Full Text Available Esse artigo relata a experiência de extensão universitária na vida de cada estudante que se propôs a fazer o diferente e dar o melhor de si, desenvolvida na cidade Irituia – Pará, em Julho de 2013, na Operação Forte do Presépio do Projeto Rondon, cujo objetivo foi: Relatar e compartilhar as experiências obtidas pela equipe da Unicentro no Projeto Rondon. A proposta realizada foi construída pelos alunos da Universidade Estadual do Centro-Oeste (UNICENTRO e se baseou no Conjunto B, que trabalha com os temas Comunicação, Meio Ambiente, Tecnologia e Produção, e, Trabalho. O desenvolvimento das atividades consistiu na prática de ações participativas, que buscaram a participação de todos, bem como o direito de terem voz, onde se buscou a responsabilidade social e coletiva a favor da cidadania. Essa experiência extensionista foi de grande valia para todos os envolvidos, pois ampliou a visão e o conhecimento diante da realidade da comunidade, rompendo as barreiras do conhecimento e proporcionando a busca por estratégias e soluções para o trabalho contínuo, e também, para a melhoria da qualidade de vida no município e para as pessoas que vivem ali.
Energy Technology Data Exchange (ETDEWEB)
Valuev, Viatcheslav [Paris-7 Univ., 75 (France)
1998-07-07
The NOMAD experiment is a search for neutrino oscillations using the large band neutrino beams of SPS at CERN. It is dealing with the two oscillation modes: {nu}{sub {mu}}{yields}{nu}{sub {tau}} and {nu}{sub {mu}}{yields}{nu}{sub e}. This thesis presents the results obtained in the search of oscillations {nu}{sub {mu}}{yields}{nu}{sub e} with the data produced by NOMAD in 1995 and 1996. The first two chapters deal with the short presentation of the neutrino oscillation phenomenology and a summary of the experimental situation. The third chapter describes the experimental setup of the NOMAD detector at CERN, designed to identify the interactions of {nu}{sub e} by means of the charged current. This is done with the transition radiation detector (TRD) designed to separate the electrons from pions with a rejection factor higher then 1000 at an electron efficiency of 90%, in the 1 - 50 GeV region. Details about the TRD operation are given in chapter four. The fifth chapter gives the algorithms of electron-pion separation as well as their performances. The last two chapters present the analysis of the {nu}{sub {mu}}{yields}{nu}{sub e} data obtained in 1995 and 1996 and the final results. The conclusion is that the available data give no evidence for the neutrino oscillations. The upper limit obtained for the mixing angle is sin{sup 2}(2{theta}) < 1.3 {center_dot} 10{sup -3} (90% C.L.). This result eliminates completely the oscillation region of LSND experiment (Liquid Scintillator Neutrino Detector) at LAMPF for {Delta}m{sup 2} > 15 eV{sup 2} and gives the most constraining world limit on sin{sup 2}(2{theta}) for {Delta}m{sup 2} > 20 eV{sup 2} 123 refs., 82 figs., 37 tabs.
Red Light-Dose or Wavelength-Dependent Photoresponse of Antioxidants in Herb Microgreens.
Directory of Open Access Journals (Sweden)
Giedė Samuolienė
Full Text Available The purpose of this study was to evaluate the role of 638-nm and 665-nm LEDs on changes of antioxidants of basil (Ocimum basilicum and parsley (Petroselinum crispum, and to assess the effect of light quality on antioxidative status. Plants were grown in peat substrate for 19 days (21/17 ±2°C, 16 h. Experiments were performed in (I a controlled-environment: B455,R638,R665,FR731(control; B455,R*638,R665,FR731; B455,R638,R*665,FR731; R638; R665 (B-blue, R- red, FR-far-red light. PPFD was set from 231 during growth, upto 300 μmol m-2 s-1 during 3-day treatment changing R638 or R665 PPFD level; in (II greenhouse (November: high-pressure sodium lamps (HPS (control-300 μmol m-2s-1; and HPS + 638 (HPS generated 90 and red LEDs-210 μmol m-2s-1. In general, under supplemental or increased red 638 nm light, amounts of tested antioxidants were greater in basil, whereas sole 665 nm or sole 638 nm is more favourable for parsley. Increased or supplemental red light significantly increased contents of phenolics, α-tocopherol, ascorbic acid and DPPH• but suppressed accumulation of lutein and β-carotene in basil, whereas an increase of β-carotene and DPPH• was observed in parsley. Hereby, the photoresponse of antioxidant compounds suggests that photoprotective mechanism is stimulated by both light-dose-dependent and wavelength-dependent reactions.
11 T Twin-Aperture Nb$_3$Sn Dipole Development for LHC Upgrades
Zlobin, A V; Apollinari, G; Auchmann, B; Barzi, E; Izquierdo Bermudez, S; Bossert, R; Buehler, M; Chlachidze, G; DiMarco, J; Karppinen, M; Nobrega, F; Novitski, I; Rossi, L; Smekens, D; Tartaglia, M; Turrioni, D; Velev, Genadi
2015-01-01
FNAL and CERN are developing a twin-aperture 11 T Nb$_{3}$Sn dipole suitable for installation in the LHC. This paper describes the design and parameters of the 11 T dipole developed at FNAL for the LHC upgrades in both single-aperture and twin-aperture configurations, and presents details of the constructed dipole models. Results of studies of magnet quench performance, quench protection and magnetic measurements performed using short 1 m long coils in the dipole mirror and single-aperture configurations are reported and discussed.
11 T Twin-Aperture Nb$_3$Sn Dipole Development for LHC Upgrades
Energy Technology Data Exchange (ETDEWEB)
Zlobin, A. V. [Fermilab; Andreev, N. [Fermilab; Apollinari, G. [Fermilab; Auchmann, B. [CERN; Barzi, E. [Fermilab; Izquierdo Bermudez, S. [CERN; Bossert, R. [Fermilab; Buehler, M. [Fermilab; Chlachidze, G. [Fermilab; DiMarco, J. [Fermilab; Karppinen, M. [CERN; Nobrega, F. [Fermilab; Novitski, I. [CERN; Rossi, L. [CERN; Smekens, D. [CERN; Tartaglia, M. [Fermilab; Turrioni, D. [Fermilab; Velev, Genadi [Fermilab
2015-01-01
FNAL and CERN are developing a twin-aperture 11 T Nb3Sn dipole suitable for installation in the LHC. This paper describes the design and parameters of the 11 T dipole developed at FNAL for the LHC upgrades in both single-aperture and twin-aperture configurations, and presents details of the constructed dipole models. Results of studies of magnet quench performance, quench protection and magnetic measurements performed using short 1 m long coils in the dipole mirror and single-aperture configurations are reported and discussed.
Directory of Open Access Journals (Sweden)
Carlos Lessa
2008-04-01
Full Text Available Pensar nação e nacionalismo a partir da experiência brasileira exige um mergulho desde as raízes coloniais até a modernidade. Essa trajetória é marcada por descompassos, e desde o Estado Nacional até a sedimentação da nação e o sentimento de auto-estima com uma "identidade brasileira" transcorre-se mais de um século. Tanto o conceito de Brasil-nação quanto as versões nacionalistas jamais têm alta dramaticidade; as passagens históricas fundamentais - abolição, proclamação da República, Estado Novo - se sucedem com poucos traumas preliminares e, em seqüência, a trajetória opera uma rápida "conservatização". Do ponto de vista econômico, as forças produtivas se desenvolvem dinâmica e intensamente. Apesar da expansão demográfica, da ocupação territorial, da transformação e emergência de novos grupos sociais no campo e na cidade, é preservada a exclusão social de amplas frações da nacionalidade dos benefícios do dinamismo econômico. É ciclotímica a leitura dos nacionais de suas próprias características. A cultura, tanto das elites quanto a popular, fornece chaves para entender as mutações do pensar nacional em relação ao Brasil e o desdobramento de múltiplas características.This essay aims to analyze both Nation and Nationalism concepts according to the viewpoint of brazilian experience, from colonial roots to our times, from national state’s birth to the settlement of the Nation and national self-stee. The main historical landmarks happen with few preliminary traumas and are "conservative-zed". Productive forces develop dynamically; demographic expansion and territory occupation continue as society changes and new groups emerge; however, large population segments keep excluded from the welfare economic development should provide. Natives' self-perception is rather cyclothymical. Both popular and elite’s culture provide the keys to understand the mutations of national thinking about Brazil, as
An elastic lidar system for the H.E.S.S. Experiment
Energy Technology Data Exchange (ETDEWEB)
Bregeon, J.; Compin, M.; Rivoire, S.; Sanguillon, M.; Vasileiadis, G., E-mail: george.vasileiadis@lupm.in2p3.fr
2016-05-21
The H.E.S.S. experiment in Namibia, Africa, is a high energy gamma ray telescope sensitive in the energy range from ~100 Gev to a few tens of TeV, via the use of the atmospheric Cherenkov technique. To minimize the systematic errors on the derived fluxes of the measured sources, one has to calculate the impact of the atmospheric properties, in particular the extinction parameter of the Cherenkov light (~300–650 nm) exploited to observe and reconstruct atmospheric particle showers initiated by gamma-ray photons. A lidar can provide this kind of information for some given wavelengths within this range. In this paper we report on the hardware components, operation and data acquisition of such a system installed at the H.E.S.S. site.
Search for Tau Neutrinos in the τ → e Decay Channel in the OPERA Experiment
Hosseini, Behzad
2015-01-01
The OPERA (Oscillation Project with Emulsion tRacking Apparatus) experiment is a long baseline neutrino oscillation experiment that was designed to perform a conclusive test of the νμ → ντ oscillations hypothesis. The main aim of this experiment is a direct observation of τ leptons in ντ charged-current interactions. A good electromagnetic shower reconstruction is important for the τ detection in the τ → e decay channel. So far, 4 ντ candidates have been observed in the OPERA detector wi...
Intervenção grupal em pacientes com obesidade e seus familiares: relato de experiência
Directory of Open Access Journals (Sweden)
Aline Attene de Almeida Bayer
Full Text Available A modalidade de atendimento em grupo no hospital é uma forma de trabalho que permite interação e troca entre os participantes, caracterizando-se como espaço de acolhimento às angústias frente a um quadro clínico. A experiência relatada consistiu na realização simultânea de dois grupos, um de pacientes entre 8-15 anos, com quadro de obesidade e sobrepeso, e outro de pais/responsáveis. O objetivo geral foi proporcionar espaço para abordar aspectos emocionais e comportamentais associados ao quadro clínico e estabelecer relações com as dificuldades na adesão ao tratamento. Realizaram-se sete encontros semanais, com atividades que propiciaram reflexão sobre questões como: autoestima, ansiedade, limites e dificuldades na manutenção das dietas e das atividades físicas regulares. A proposta possibilitou compartilhar vivências, debater atitudes, abordar insatisfações e desconfortos e perceber a necessidade de se responsabilizarem pelo tratamento através da mudança de determinados comportamentos. A opção por grupos paralelos permitiu notar mudanças nas relações entre pais/responsáveis e pacientes que contribuíram para melhor resposta ao tratamento. Tal experiência ilustrou a importância de considerar os aspectos emocionais envolvidos na obesidade, favorecendo uma visão mais abrangente do paciente.
The E142 SLAC experiment: measurement of the neutron gn1(x) spin structure function
International Nuclear Information System (INIS)
Roblin, Y.
1995-01-01
This thesis describes the E142 experiment which has been carried out at the Stanford Linear Accelerator (SLAC), USA, from October to December 1992. This experiment of polarized inelastic scattering of a 22.6 GeV electron beam on a polarized helium 3 target has allowed the first measurement of the neutron g n 1 (x) spin structure function. The knowledge of this structure function gives informations on the nucleon spin structure. On the other hand, the g n 1 (x) structure function integral value on the 0 2 mean value of 2 GeV 2 after some extrapolations. This value is at about two standard deviations away from the theoretical predictions of the Ellis-Jaffe rule. Thanks to the existing experimental results for the proton (E143 experiment), the Bjorken sum rule has been precisely tested and is perfectly compatible with the theoretical value. The results have allowed to estimate the nucleon spin fraction carried by the quarks. (J.S.). 86 refs., 58 figs., 13 tabs
Directory of Open Access Journals (Sweden)
Silvia De Zordo
2012-07-01
Full Text Available O objetivo deste estudo qualitativo, realizado em dois hospitais-maternidade de Salvador da Bahia, foi investigar a experiência e as representações do aborto legal, analisadas em contraste com as representações do aborto ilegal, dos profissionais de saúde, em particular dos ginecologistas-obstetras.Usou-se como instrumentos um questionário e entrevistas semi-estruturadas com 25 profissionais de saúde (dos quais 13 ginecologistas-obstetras num hospital que oferece um serviço de aborto legal (P, e 20 profissionais de saúde (dos quais 9 ginecologistas-obstetras em outro hospital, que não oferece este serviço (F. Os fatores que mais influenciam as representações dos ginecologistas-obstetras entrevistados acerca do aborto e que explicam a alta taxa de objeção de consciencia no hospital P foram: 1- a criminalização do aborto e o medo de serem denunciados; 2- a estigmatização do aborto por certos grupos religiosos e pelos proprios médicos; 3- o treinamento em obstetrícia e a falta de uma formação boa no campo da epidemiologia da morbi-mortalidade materna e do aborto; 4- as representações acerca das relações de gênero. Os fatores principais associados à atitudes liberais foram: a idade - abaixo de 30/acima de 45 anos - a experiência com altas taxas de mortalidade materna devidas ao aborto e a experiência com o aborto legal.The objective of this qualitative study, carried out in two maternity-hospitals in Salvador da Bahia, was to investigate the experience and representations of health professionals, and particularly obstetricians-gynecologists, regarding legal abortion in comparison with their representations and experience with illegal abortion. A questionnaire was distributed and semi-structured interviews were conducted with 25 health professionals (13 obstetricians-gynecologists in a hospital providing legal abortion (P and with 20 health professionals (9 obstetricians-gynecologists in another hospital that does not
ARIEL E-linac Cryogenic System: Commissioning and First Operational Experience
International Nuclear Information System (INIS)
Koveshnikov, A; Bylinskii, I; Hodgson, G; Kishi, D; Laxdal, R; Ma, Y; Nagimov, R; Yosifov, D
2015-01-01
The Advanced Rare IsotopE Laboratory (ARIEL) is a major expansion of the Isotope Separator and Accelerator (ISAC) facility at TRIUMF. A key part of the ARIEL project is a 10 mA 50 MeV continuous-wave superconducting radiofrequency (SRF) electron linear accelerator (e-linac). The 1.3 GHz SRF cavities are operated at 2 K. HELIAL LL helium liquefier by Air Liquide Advanced Technologies (ALAT) with a tuneable liquid helium (LHe) production was installed and commissioned in Q4’2013 [1]. It provides 4 K liquid helium to one injector and one accelerator cryomodules that were installed and tested in 2014. The 4 K to 2 K liquid helium transition is achieved on-board of each cryomodule. The cryoplant, LHe and LN2 distributions, sub-atmospheric (S/A) system and cryomodules were successfully commissioned and integrated into the e-linac cryogenic system. Required pressure regulation for both 4 K cryoplant in the Dewar and 2 K with the S/A system was achieved under simulated load. Final integration tests confirmed overall stable performance of the cryogenic system with two cryomodules installed. The paper presents details of the cryogenic system commissioning tests as well as highlights of the initial operational experience. (paper)
Angular dependence of high-p/sub T/ pi /sup 0/ production
Lloyd-Owen, D; Bellettini, G; Braccini, Pier Luigi; Castaldi, R; Cavasinni, V; Del Prete, T; Finocchiaro, G; Grannis, P D; Jöstlein, H; Kephart, R D; Laurelli, P; Sanguinetti, G; Thun, R; Valdata-Nappi, M
1981-01-01
The authors have measured inclusive pi /sup 0/ production cross- sections at the CERN ISR for p/sub T/ <5 GeV/c at c.m. angles of theta =90 degrees and 5< theta <22 degrees at c.m. energies square root s=23 and 53 GeV. The data are in agreement with previous measurements of pi degrees production at FNAL and the ISR. The authors have compared these data with the hypothesis of radial scaling, which asserts that the inclusive cross section should be a function of x/sub R/ and p/sub T/ alone. Here x/sub R/ is the fraction of available energy carried by the produced particle. They find that radial scaling is not satisfactory over the energy and angle range of this experiment. Comparing their data with radial scaling fits to mainly FNAL data, the authors find that their cross sections approach ten times the prediction at large p/sub T/ and x/sub R/. As a more direct test of the hypothesis, the authors compare their data for which x/sub R/ variation occurs as theta varies at fixed s, with that from ISR expe...
Enfrentamento de estresse no trabalho: relações entre idade, experiência, autoeficácia e agência
Directory of Open Access Journals (Sweden)
Arlete Portella Fontes
Full Text Available Este trabalho constitui um estudo descritivo que investigou as relações entre as estratégias de enfrentamento de estresse no trabalho e o estresse percebido, a idade, o cargo e a experiência de trabalho, mediadas pelas crenças de autoeficácia e de agência, entre 71 líderes de uma companhia. Método: o trabalho incluiu um questionário de dados sociodemográficos, de escalas de avaliação do grau de estresse percebido, do enfrentamento no trabalho, de crenças de autoeficácia e de agência. O grau de estresse percebido foi 7(0-10. As estratégias de controle foram frequentemente utilizadas (M = 3,73 ; DP = ,49, esquiva, algumas vezes (M = 2,07 ; DP = ,50, e manejo de sintomas, raramente (M = 1,86 ; DP = ,44. A autoeficácia foi moderada (3,23, DP= 3,37. Foram encontradas correlações positivas entre experiência de trabalho e autoeficácia (,27, autoeficácia e controle (,53, crenças de agência pessoal e controle e autoeficácia (,67 e ,57, respectivamente. A análise de regressão logística multivariada mostrou que líderes com escores mais altos em estratégias de controle apresentaram escores mais altos em autoeficácia e agência. Conclusão: os resultados apontam o valor da experiência de trabalho, da autoeficácia e da agência para o envelhecimento e o enfrentamento dos estressores de trabalho, principalmente em tarefas que envolvem risco de vida, mostrando que as organizações deveriam valorizar sua mão de obra madura.
Intercâmbio acadêmico cultural internacional: uma experiência de crescimento pessoal e científico
Directory of Open Access Journals (Sweden)
Indiara Sartori Dalmolin
2013-06-01
Full Text Available Este estudo objetivou descrever a experiência discente ao integrar um programa de mobilidade acadêmica internacional, durante a graduação em enfermagem. Trata-se de relato da vivência acadêmica em Portugal, na Universidade do Algarve, viabilizada pela Universidade Federal de Santa Maria, Rio Grande do Sul, Brasil. A experiência de intercâmbio realizada no período de seis meses, possibilitou a aquisição de novos conhecimentos científicos e culturais, inclusive inovações de tecnologias em saúde, desenvolvimento de pesquisa e vínculos acadêmicos. Como contribuições, espera-se estimular e intensificar a mobilidade internacional especialmente no âmbito da graduação, considerando a sua importância para o aperfeiçoamento da formação acadêmica e a excelência do ensino superior brasileiro por meio do intercâmbio científico e cultural no exterior.
Biopoder e UPPs: alteridade na experiência do policiamento permanente em comunidades cariocas
Directory of Open Access Journals (Sweden)
Thiago Benedito Livramento Melicio
2012-12-01
Full Text Available O artigo visa refletir sobre a experiência do efetivo policial permanente em dois conjuntos de comunidades cariocas, inserido no escopo das Unidades de Polícia Pacificadora (UPP. Foram realizados dois estudos exploratórios, em agosto e dezembro de 2010. Na esteira do conceito foucaultiano de biopoder, discute-se a UPP como rede de relações de poder que a compõe e a legitima, pensando-se o local em que se instala, a política de Estado a que responde, os atores com que opera e as produções históricas das relações entre Estado e territórios populares. O campo de análise constitui-se, assim, nas práticas e saberes localizados no cotidiano e nos efeitos produzidos com a presença do policial na paisagem da favela. Se novas regras são trazidas com as UPPs, novas identificações são mobilizadas e as modulações de conjunto abrem lacunas, o governo de si não se produz sozinho, mas combina-se com diversidades na gestão da vida.
Directory of Open Access Journals (Sweden)
Márcia Melo de Laet Rodrigues
2005-09-01
Full Text Available Maior envolvimento masculino na saúde reprodutiva é um desafio da atualidade; em âmbito nacional e internacional existem recomendações para desenvolver pesquisas sob a perspectiva masculina. Objetivo: Compreender a experiência de homens que compartilharam do processo de abortamento espontâneo de suas parceiras. Método: Utilizou-se a abordagem qualitativa e a análise da narrativa foi o método empregado. Foram identificadas as similaridades nas experiências de nove homens entrevistados, que permitiram elaborar as seguintes categorias descritivas: Vivenciando a notícia da gravidez; identificando as possíveis causas do abortamento; expressando sentimentos relativos à experiência do abortamento; tomando atitudes em decorrência do abortamento; ponderando sobre a experiência vivida. Conclusão: Homens que compartilham da experiência do abortamento espontâneo requerem sensibilidade e envolvimento dos profissionais que os assistem, expressaram o desejo do acolhimento, o recebimento de suporte emocional e informações completas e precisas sobre o conjunto do processo.Un mayor involucramiento masculino en la salud reproductiva es un desafío de la actualidad. En el ámbito nacional e internacional existen recomendaciones para desarrollar investigaciones bajo la perspectiva masculina. Objetivo: Comprender la experiencia de hombres que comparten el proceso del aborto espontáneo de sus parejas. Método: Se utilizó el abordaje cualitativo y el análisis de la narrativa. Fueron identificadas las similaridades en las experiencias de nueve hombres entrevistados, que permitieron elaborar las siguientes categorías descriptivas: Vivenciando la noticia del embarazo; identificando las posibles causas del aborto; expresando sentimientos relativos a la experiencia del aborto; tomando actitudes en consecuencia del aborto; ponderando sobre la experiencia vivida. Conclusión: los hombres que comparten la experiencia del aborto espontáneo requieren
Directory of Open Access Journals (Sweden)
Mariana Selister Gomes
2015-10-01
Full Text Available O case relata a experiência de um roteiro educativo ao Museu da Gente Sergipana, acompanhado de uma oficina de educação patrimonial, com alunos de uma escola pública, inserido no Projeto de Extensão “Trilhas Urbanas em Aracaju: os múltiplos olhares sobre a cidade”, do Núcleo de Turismo da Universidade Federal de Sergipe. Buscou-se desenvolver o turismo cultural para a comunidade local a fim de contribuir para a educação patrimonial e para a cidadania, bem como, refletir sobre a possibilidade de o Turismo atuar como um mediador cultural. A metodologia utilizada foi a da pesquisa-ação, tendo como base a realização da ação, somada às técnicas de coletas de dados através de questionários e de observação. Percebeu-se que os estudantes desconheciam equipamentos culturais da cidade e não valorizavam o patrimônio cultural local, ao passo que conheciam e valorizavam patrimônios culturais que se tornaram hegemônicos na cultura ocidental; sendo que a ação contribuiu para reverter esta situação. Evidenciou-se o potencial do turismo cultural em despertar a cidadania e o pertencimento, bem como, sua responsabilidade em atuar como mediador cultural de lógicas diversas. Palavras-chave: Turismo Cultural. Educação Patrimonial. Cidadania. Museu da Gente Sergipana. Aracaju, SE. Cultural Tourism, Heritage Education and Citizenship: An Experiment among University, School and Museum in Sergipe - The case reports the experience of an educational route to the "Museu da Gente Sergipana", accompanied by a workshop on heritage education, with students from a public school, inserted into the Extension Project "Trilhas Urbanas em Aracaju", Núcleo de Turismo of the Universidade Federal de Sergipe. We sought to develop cultural tourism to the local community in order to contribute to heritage interpretation and education and citizenship, as well as reflect on the possibility of tourism be a cultural mediator. The methodology was action
Who Wants to Be an E-tailpreneur? Experiences from an Electronic Retailing Course
Kumar, Archana; Mukherjee, Avinandan; McGinnis, John
2015-01-01
This paper outlines the experiences of developing a new hands-on marketing course. The objective of the course was to simulate the real-world scenario of starting an online retailing business and let students become entrepreneurs. Students were challenged to assimilate and apply relevant e-retailing knowledge while being responsible for designing,…
Experiences with E-learning in Ophthalmology
Seema Dutt Bandhu; Swati Raje
2014-01-01
Introduction: E-learning is the use of internet for the purpose of education. E-learning in medical education is at a nascent stage in our country. The present study was carried out with the purpose of introducing e-learning to third year medical students in the subject of Ophthalmology and taking feedback on their attitude towards the new methodology of teaching and evaluating. Materials and Methods: E-learning was introduced to the seventh semester students of MBBS in the subject of Ophthal...
Leite, César
2010-01-01
Este texto busca, a partir de uma situação de sala de aula, interpretar a realidade dos processos de aprendizagem e constituição de sentidos de uma criança em fase inicial de aquisição da língua escrita. Este percurso será construído a partir da noção de semelhança, linguagem e experiência em Benjamin e Agamben. Para tanto a noção de uma ‘inversão’ de lógica no modo freqüente que pensamos a educação e que olhamos a escola parece necessário, nesta perspectiva alguns eixos se tornam centrais, ...
Performance of prototypes for the ALICE electromagnetic calorimeter
International Nuclear Information System (INIS)
Allen, J.; Awes, T.; Badala, A.; Baumgart, S.; Bellwied, R.; Benhabib, L.; Bernard, C.; Bianchi, N.; Blanco, F.; Bortoli, Y.; Bourdaud, G.; Bourrion, O.; Boyer, B.; Bruna, E.; Butterworth, J.; Caines, H.; Calvo Diaz Aldagalan, D.; Capitani, G.P.; Carcagno, Y.; Casanova Diaz, A.
2010-01-01
The performance of prototypes for the ALICE electromagnetic sampling calorimeter has been studied in test beam measurements at FNAL and CERN. A 4x4 array of final design modules showed an energy resolution of about 11%/√(E(GeV))+1.7% with a uniformity of the response to electrons of 1% and a good linearity in the energy range from 10 to 100 GeV. The electromagnetic shower position resolution was found to be described by 1.5mm+5.3mm/√(E(GeV)). For an electron identification efficiency of 90% a hadron rejection factor of >600 was obtained.
Experiments on Li pellet injection into Heliotron E
International Nuclear Information System (INIS)
Sergeev, V.Yu.; Khlopenkov, K.V.; Kuteev, B.V.; Sudo, S.; Kondo, K.; Zushi, H.; Besshou, S.; Sano, F.; Okada, H.; Mizuuchi, T.; Nagasaki, K.; Obiki, T.; Kurimoto, Y.
1998-01-01
Li pellets of large size were injected into electron cyclotron resonance (ECR) heated plasmas and neutral beam injection (NBI) heated plasmas of Heliotron E. The discharge behaviour, pellet ablation and wall conditioning were studied. The electron pressure is doubled after injection into the NBI plasma and remains unchanged in the case of ECR heating. This may be due to the energy exchange between the electrons and thermal ions with the fast ions from the neutral beam. The observed discrepancy between the experimental and modelled ablation rates may be caused by both the plasma cooling due to pellet ablatant and the ablation stimulated by the fast ions in the NBI-heated regime and by the fast electrons in the ECR-heated regime. In preliminary experiments on wall conditioning by Li pellet injection, no improvement of plasma performance after Li pellet injection was observed in the divertor or limiter configuration, with the limiter radii r L =24-25cm. (author)
Directory of Open Access Journals (Sweden)
Solange Maria Sobottka Rolim de Moura
2005-04-01
Full Text Available Este artigo analisa, sob a perspectiva da relação entre a família e instituições de saúde, os sentidos produzidos sobre a maternidade em um programa de saúde neonatal desenvolvido na rede pública - o Programa Mãe Canguru. A partir de entrevistas e observações feitas com usuárias durante sua participação no programa, buscamos apreender como as práticas discursivas e não discursivas sobre maternidade e maternagem, difundidas nesse processo, se articulam com as experiências concretas dessas mulheres para produzir novas configurações subjetivas. Na interpretação dos dados, realizada através de análise do discurso, os aspectos mais significativos das falas das entrevistadas foram agrupados em quatro núcleos de sentido: família e religião; o impacto do nascimento prematuro; desconfiança e resistência nas relações com instituições e profissionais de saúde; e a experiência com o Programa Mãe Canguru. Ao final, procurou-se identificar as principais estratégias e formas de singularização utilizadas por essas mulheres ao atribuírem sentidos ao papel materno.This article analises, under the perspective of the relationship between the family and health institutions, the senses produced upon motherhood on a neonatal health program developed at the public system - The Kangaroo Mother Program. As from interviews and observations made with users during their involvement on the program, we tried to perceive how discursive and non discursive practices about motherhood and maternal care, spreaded on this process, become linked with the factual experiences of this women in order to produce new subjective configurations. On data interpretation, realized through speech analysis, the most significant aspects of interviewees talks were gathered in four senses nucleus: family and religion; the impact of a premature birth; distrust and resistance on relations with institutions and health professionals; and the experience with the
Developing the Precision Magnetic Field for the E989 Muon g{2 Experiment
Energy Technology Data Exchange (ETDEWEB)
Smith, Matthias W. [Washington U., Seattle
2017-01-01
The experimental value of $(g\\hbox{--}2)_\\mu$ historically has been and contemporarily remains an important probe into the Standard Model and proposed extensions. Previous measurements of $(g\\hbox{--}2)_\\mu$ exhibit a persistent statistical tension with calculations using the Standard Model implying that the theory may be incomplete and constraining possible extensions. The Fermilab Muon g-2 experiment, E989, endeavors to increase the precision over previous experiments by a factor of four and probe more deeply into the tension with the Standard Model. The $(g\\hbox{--}2)_\\mu$ experimental implementation measures two spin precession frequencies defined by the magnetic field, proton precession and muon precession. The value of $(g\\hbox{--}2)_\\mu$ is derived from a relationship between the two frequencies. The precision of magnetic field measurements and the overall magnetic field uniformity achieved over the muon storage volume are then two undeniably important aspects of the e xperiment in minimizing uncertainty. The current thesis details the methods employed to achieve magnetic field goals and results of the effort.
Results and future plans of the Lithium Tokamak eXperiment (LTX)
Energy Technology Data Exchange (ETDEWEB)
Schmitt, J.C., E-mail: jschmitt@pppl.gov [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Abrams, T. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Baylor, L.R. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Berzak Hopkins, L. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Biewer, T. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Bohler, D.; Boyle, D.; Granstedt, E. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Gray, T. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Hare, J.; Jacobson, C.M.; Jaworski, M.; Kaita, R.; Kozub, T.; LeBlanc, B.; Lundberg, D.P.; Lucia, M. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Maingi, R. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Majeski, R.; Merino, E. [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); and others
2013-07-15
The Lithium Tokamak eXperiment (LTX) is a spherical tokamak with the unique capability of studying the low-recycling regime by coating nearly 90% of the first wall with lithium in either solid or liquid form. Several grams of lithium are evaporated onto the plasma-facing side of the first wall. Without lithium coatings, the plasma discharge is limited to less than 5 ms and only 10 kA of plasma current, and the first wall acts as a particle source. With cold lithium coatings, plasma discharges last up to 20 ms with plasma currents up to 70 kA. The lithium coating provides a low-recycling first wall condition for the plasma and higher fueling rates are required to realize plasma densities similar to that of pre-lithium walls. Traditional puff fueling, supersonic gas injection, and molecular cluster injection (MCI) are used. Liquid lithium experiments will begin in 2012.
Results and future plans of the Lithium Tokamak eXperiment (LTX)
International Nuclear Information System (INIS)
Schmitt, J.C.; Abrams, T.; Baylor, L.R.; Berzak Hopkins, L.; Biewer, T.; Bohler, D.; Boyle, D.; Granstedt, E.; Gray, T.; Hare, J.; Jacobson, C.M.; Jaworski, M.; Kaita, R.; Kozub, T.; LeBlanc, B.; Lundberg, D.P.; Lucia, M.; Maingi, R.; Majeski, R.; Merino, E.
2013-01-01
The Lithium Tokamak eXperiment (LTX) is a spherical tokamak with the unique capability of studying the low-recycling regime by coating nearly 90% of the first wall with lithium in either solid or liquid form. Several grams of lithium are evaporated onto the plasma-facing side of the first wall. Without lithium coatings, the plasma discharge is limited to less than 5 ms and only 10 kA of plasma current, and the first wall acts as a particle source. With cold lithium coatings, plasma discharges last up to 20 ms with plasma currents up to 70 kA. The lithium coating provides a low-recycling first wall condition for the plasma and higher fueling rates are required to realize plasma densities similar to that of pre-lithium walls. Traditional puff fueling, supersonic gas injection, and molecular cluster injection (MCI) are used. Liquid lithium experiments will begin in 2012
Ensaio sobre arte e testemunho: Rodrigo Braga e a invenção da experiência
Directory of Open Access Journals (Sweden)
Tania Rivera
2016-04-01
Full Text Available Resumo O ensaio enfoca o testemunho como uma posição discursiva e explora seu papel na simbolização do trauma. Considerando-o como transmissão de centelhas do Real, defende que uma de suas modalidades seria a invenção da experiência, tal como aponta parte da produção contemporânea em artes visuais. Para melhor explorar essa hipótese, propõe um diálogo com alguns dos trabalhos apresentados pelo artista brasileiro Rodrigo Braga em sua exposição Mais Força que o Necessário, realizada na Bélgica em 2010.
Directory of Open Access Journals (Sweden)
Maria Ruth Santos
2010-12-01
Full Text Available O presente artigo é parte da tese de doutorado Perfil dos Agentes Comunitários de Saúde da Região de Juiz de Fora-MG e apresenta o perfil dos Agentes Comunitários de Saúde (ACS sob a ótica das equipes de saúde da família, dos usuários e deles próprios. Discute os modelos e experiências sobre os ACS praticadas no Brasil antes da iniciativa do Ceará, na década de 80. Contextualiza os movimentos ocorridos para o sucesso da reforma dos ACS, que caracterizam um recurso humano central e estratégico para a implementação de ações de promoção da saúde, viabilizando o desenvolvimento de ações básicas voltadas para a comunidade. Demonstra que o agente comunitário de saúde constitui fator chave para viabilizar o apoio, a implementação e o desenvolvimento de ações básicas voltadas para a comunidade, de forma a expandi-las e a fortalecê-las em nível nacional, porém a promoção da saúde não concerne exclusivamente ao próprio setor e nem a um único profissional de saúde. Ela é resultado de ações intersetoriais, agindo nos determinantes gerais e da qualidade de vida.This paper is part of the doctoral thesis Profile of Community Health Workers in the region of Juiz de Fora, MG, and presents a profile of Community Health Agents (CHA from the perspective of family health teams, of users and themselves. It discusses the models and experiences on the CHA practiced in Brazil before the initiative of Ceará State, in the 1980's. It contextualizes the movements for the successful reform of the CHA, which characterize a central human resource and strategic for the implementation of health promotion actions, enabling the development of basic community-related actions. It shows that community health agents are a key factor to enable the support, implementation and development of basic community-related actions, to expand them and strengthen them nationwide, but health promotion concerns not only the sector itself nor a single
Alibran, P; Arnold, R; Bartley, J H; Bellotti, E; Bertrand, D; Blaes, R; Blondel, A; Blum, D; Bolognese, T; Bonetti, S; Bonneaud, G R; Bourotte, J; Bullock, F W; Burmeister, H; Carnesecchi, G; Cavalli, D; Conforto, G; Degrange, B; Dewit, M; Erriquez, O; Escoubés, B; Fiorini, Ettore; Frodesen, A G; Gillespie, J; Haguenauer, Maurice; Heusse, P; Jacquet, F; Jones, T W; Lutz, A M; Matteuzzi, C; Morfín, J G; Muciaccia, M T; Musset, P; Natali, S; Nguyen-Khac, U; Nuzzo, S; Pascaud, C; Pattison, B; Paty, M; Petitjean, P; Price, M; Pullia, Antonio; Riester, J L; Rognebakke, A; Rollier, M; Romano, F; Sacton, J; Skjeggestad, O; Sleeman, J C; Van Doninck, W K; Vialle, J P; Weerts, H; Welch, L; Willutzky, M; Zanotti, L
1978-01-01
A beam dump experiment has been performed at CERN in Gargammelle using the neutrino facility to look for penetrating particles produced either directly in the beam interaction or by prompt decay of new particles. A total of 32 interactions with a visible energy greater than 10 GeV has been found, classified, after corrections, into 18 charged current nu /sub mu / or nu /sub mu /, 5.1 neutral current and 8.9 nu /sub e/ or nu /sub e/ charged current events. An excess of nu /sub e/ events remains after all subtractions from any established sources. Results are presented in terms of the product of the cross section and the leptonic decay branching ratio of the possible source. (11 refs).
Sou do mundo, sou Minas Gerais: o ser da experiência em "Para Lennon e McCartney"
Directory of Open Access Journals (Sweden)
Rafael Senra Coelho
2018-04-01
Full Text Available RESUMO: A canção “Para Lennon e McCartney” imagina um diálogo entre músicos latino americanos e anglo-saxões. Os dois cantores citados no título tornam-se uma metonímia de toda a indústria musical do eixo Europa/EUA. Nessa composição, a condição simultânea rural e urbana que compõe o espaço da periferia permite que o sujeito da experiência persista na modernidade. A voz do narrador experiente confronta todo o projeto de identidade supostamente coerente da metrópole, baseado no acúmulo de informação. PALAVRAS-CHAVE: Identidade, Globalização, Experiência, Música Popular. ___________________________________ ABSTRACT: The song "Para Lennon e McCartney" imagines a dialogue between Latin American and Anglo-Saxon musicians. The two singers mentioned in the title symbolize the entire music industry from Europe and United States. In this composition, the simultaneous rural and urban condition of poor countries allows the permanence of the experienced person in modernity. The voice of the experienced narrator confronts the coherent identity project from people in North metropolis, based in accumulation of information. KEYWORDS: Identity, Globalization, Experience, Popular Music.
The abstract geometry modeling language (AgML): experience and road map toward eRHIC
International Nuclear Information System (INIS)
Webb, Jason; Lauret, Jerome; Perevoztchikov, Victor
2014-01-01
The STAR experiment has adopted an Abstract Geometry Modeling Language (AgML) as the primary description of our geometry model. AgML establishes a level of abstraction, decoupling the definition of the detector from the software libraries used to create the concrete geometry model. Thus, AgML allows us to support both our legacy GEANT 3 simulation application and our ROOT/TGeo based reconstruction software from a single source, which is demonstrably self- consistent. While AgML was developed primarily as a tool to migrate away from our legacy FORTRAN-era geometry codes, it also provides a rich syntax geared towards the rapid development of detector models. AgML has been successfully employed by users to quickly develop and integrate the descriptions of several new detectors in the RHIC/STAR experiment including the Forward GEM Tracker (FGT) and Heavy Flavor Tracker (HFT) upgrades installed in STAR for the 2012 and 2013 runs. AgML has furthermore been heavily utilized to study future upgrades to the STAR detector as it prepares for the eRHIC era. With its track record of practical use in a live experiment in mind, we present the status, lessons learned and future of the AgML language as well as our experience in bringing the code into our production and development environments. We will discuss the path toward eRHIC and pushing the current model to accommodate for detector miss-alignment and high precision physics.
Gharib, Mitra; Zolfaghari, Mitra; Mojtahedzadeh, Rita; Mohammadi, Aeen; Gharib, Atoosa
2016-01-01
Background With the increasing popularity of e-learning programs, educational stakeholders are attempting to promote critical thinking in the virtual education system. This study aimed to explore the experiences of both the instructors and the students about critical thinking promotion within the virtual education system. Methods This qualitative study recruited the instructors and students from four academic disciplines provided by the Virtual School of Tehran University of Medical Sciences (Tehran, Iran). All programs were master’s degree programs and utilized a blended (combination of e-learning and face to face) training. Semistructured interviews with the participants were used to collect data. Results The participants had a variety of experiences about how to promote critical thinking. These experiences were conceptualized in four main themes, namely, instructional design, educational leadership and management, local evidence, and belief systems. Conclusion The present study clarified the factors affecting critical thinking promotion in e-learning. Not only the instructors but also the educational designers and leaders can benefit from our findings to improve the quality of virtual education programs and promote critical thinking. PMID:27217807
Gharib, Mitra; Zolfaghari, Mitra; Mojtahedzadeh, Rita; Mohammadi, Aeen; Gharib, Atoosa
2016-01-01
With the increasing popularity of e-learning programs, educational stakeholders are attempting to promote critical thinking in the virtual education system. This study aimed to explore the experiences of both the instructors and the students about critical thinking promotion within the virtual education system. This qualitative study recruited the instructors and students from four academic disciplines provided by the Virtual School of Tehran University of Medical Sciences (Tehran, Iran). All programs were master's degree programs and utilized a blended (combination of e-learning and face to face) training. Semistructured interviews with the participants were used to collect data. The participants had a variety of experiences about how to promote critical thinking. These experiences were conceptualized in four main themes, namely, instructional design, educational leadership and management, local evidence, and belief systems. The present study clarified the factors affecting critical thinking promotion in e-learning. Not only the instructors but also the educational designers and leaders can benefit from our findings to improve the quality of virtual education programs and promote critical thinking.
A experiência em família de uma pessoa com diabetes mellitus e em tratamento por hemodiálise
Directory of Open Access Journals (Sweden)
Magda de Mattos
2009-12-01
Full Text Available A experiência de adoecimento incorpora processos biológicos, mas também processos subjetivos, que devem serabordados nas práticas de atenção em saúde. No entanto, revelar os processos subjetivos da experiência tem sido umdesafio aos profissionais de saúde. A antropologia interpretativa tem subsídiado a compreensão deste processo namedida que integra aspectos socioculturais ao adoecimento. Estudo de natureza qualitativa, tipo Estudo de Caso tevepor objetivo compreender a experiência em família de uma pessoa com diabetes mellitus, insuficiência renal crônicaem tratamento por hemodiálise. O estudo foi realizado com um usuário em hemodiálise, em uma clínica no Estado deMato Grosso e com sua esposa, no período de fevereiro a julho de 2008, por meio da entrevista. A análise dos dadosnos permitiu apreender que vivenciar o adoecimento é uma experiência no qual os significados são reconstruídos evividos com base nas experiências anteriores e nas perspectivas de vida, tendo a família como referência. Aspectosimportantes do adoecimento marcaram a experiência de Moisés e sua esposa como o significado atribuído a famílianuclear, a fragmentação da estrutura social, as limitações e restrições, o reflexo da doença na vida em família, oscomportamentos, a construção da subjetividade masculina e o transplante renal.
Um um caminho de liberdade: a experiência da disciplina semiologia e semiotécnica
Directory of Open Access Journals (Sweden)
Ademilda Maria Gomes de Sousa Garcia
1998-06-01
Full Text Available O trabalho relata a vivência da construção da disciplina Semiologia e Semiotécnica, integrante do novo currículo de Enfermagem. Os objetivos foram: incentivar a criatividade e a sensibilidade que o cuidar comporta no desenvolvimento de técnicas; valorizar os sentimentos e emoções no estabelecimento do relacionamento enfermeira-cliente; possibilitar uma reflexão e auto-conhecimento na vivência coletiva; e estabelecer uma interação docentediscente permeada pela parceria, compromisso e no sentir/aprender/fazer mútuos. A trajetória metodológica privilegiou a sensibilização como etapa necessária para o processo de formação e concomitante a este, desenvolvida a partir da arte e criatividade, e compreendeu a realização de oficinas e dinâmicas de grupos. Os resultados validam a experiência como oportunidade de desenvolver o potencial crítico, criativo e técnico rumo à consciência que conduz à liberdade na Enfermagem.
International Nuclear Information System (INIS)
Mohania, Praveen; Rajput, Vikas; Baxy, Deodatta; Agrawal, Ankur; Mahawar, Ashish; Adarsh, Kunver; Singh, Pratap; Shrivastava, Purushottam
2011-01-01
RRCAT is developing a Vertical Test Stand (VTS) to test and qualify 1.3 GHz/650 MHz, SCRF Cavities in collaboration with Fermi National Accelerator Laboratory (FNAL) under Indian Institutions' Fermilab Collaboration. The technical details for VTS is being provided by FNAL, USA. The RF System of VTS needs to provide stable RF power to SCRF cavity with control of amplitude, relative phase and frequency. The incident, reflected, transmitted power and field decay time constant of the cavity are measured to evaluate cavity performance parameters (E, Qo). RF Power is supplied via 500 W Solid State amplifier, 1270-1310 MHz being developed by PHPMS, RRCAT. VTS system is controlled by PXI Platform and National Instruments LabVIEW software. Low Level RF (LLRF) system is used to track the cavity frequency using Phase Locked Loop (PLL). The system is comprised of several integrated functional modules which would be assembled, optimized, and tested separately. Required components and instruments have been identified and procurement for the same is underway. Inhouse development for the Solid State RF amplifier and instrument interfacing is in progress. This paper describes the progress on the development of the RF system for VTS. (author)
Midlatitude Continental Convective Clouds Experiment (MC3E)
Energy Technology Data Exchange (ETDEWEB)
Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E
2010-04-01
Convective processes play a critical role in the Earth’s energy balance through the redistribution of heat and moisture in the atmosphere and subsequent impacts on the hydrologic cycle. Global observation and accurate representation of these processes in numerical models is vital to improving our current understanding and future simulations of Earth’s climate system. Despite improvements in computing power, current operational weather and global climate models are unable to resolve the natural temporal and spatial scales that are associated with convective and stratiform precipitation processes; therefore, they must turn to parameterization schemes to represent these processes. In turn, the physical basis for these parameterization schemes needs to be evaluated for general application under a variety of atmospheric conditions. Analogously, space-based remote sensing algorithms designed to retrieve related cloud and precipitation information for use in hydrological, climate, and numerical weather prediction applications often rely on physical “parameterizations” that reliably translate indirectly related instrument measurements to the physical quantity of interest (e.g., precipitation rate). Importantly, both spaceborne retrieval algorithms and model convective parameterization schemes traditionally rely on field campaign data sets as a basis for evaluating and improving the physics of their respective approaches. The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the April–May 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administration’s (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States
Quality Assurance on a Custom SiPMs Array for the Mu2e Experiment
Energy Technology Data Exchange (ETDEWEB)
Atanov, N.; et al.
2017-11-20
The Mu2e experiment at Fermilab will search for the coherent $\\mu \\to e$ conversion on aluminum atoms. The detector system consists of a straw tube tracker and a crystal calorimeter. A pre-production of 150 Silicon Photomultiplier arrays for the Mu2e calorimeter has been procured. A detailed quality assur- ance has been carried out on each SiPM for the determination of its own operation voltage, gain, dark current and PDE. The measurement of the mean-time-to-failure for a small random sample of the pro-production group has been also completed as well as the determination of the dark current increase as a function of the ioninizing and non-ioninizing dose.
Directory of Open Access Journals (Sweden)
Patrick Pardini
Full Text Available Enquanto experiência artística, o projeto fotográfico "Arborescência - fisionomia do vegetal na paisagem amazônica" proporciona ao autor uma série de descobertas: a paisagem como entrelaçamento de Natureza e Cultura (a presença indireta do homem; o face a face com 'sujeitos vegetais'; as relações de continuidade, indiferenciação e equivalência entre o 'natural' (heterogêneo, espontâneo, nativo, rural e o 'cultural' (homogêneo, cultivado, exótico, urbano na experiência da paisagem vegetal; a arborescência como "imagem cósmica" (Gaston Bachelard, onde o alto (céu, luz, galhos, água celeste e o baixo (terra, sombra, raízes, água terrestre são pólos equivalentes e reversíveis. Tal experiência encontra ressonâncias na eco-cosmologia das sociedades da floresta amazônica. A cosmologia ameríndia é uma "ecologia simbólica" (Philippe Descola, pois elabora "uma complexa dinâmica de trocas e transformações entre sujeitos humanos e não humanos, visíveis e invisíveis" (Bruce Albert; a ecologia ameríndia é uma "cosmologia posta em prática" (Kaj Århem, na qual animais caçados e plantas cultivadas são 'parentes' que é preciso seduzir ou coagir. Tal modelo constitui uma forma de "socialização da natureza" (Descola, de "humanização da floresta" (Evaristo Eduardo de Miranda e de "antropização indireta" dos ecossistemas amazônicos (Descola, geradora de "matas culturais" (William Balée.
Design of experiments (DoE) in pharmaceutical development.
N Politis, Stavros; Colombo, Paolo; Colombo, Gaia; M Rekkas, Dimitrios
2017-06-01
At the beginning of the twentieth century, Sir Ronald Fisher introduced the concept of applying statistical analysis during the planning stages of research rather than at the end of experimentation. When statistical thinking is applied from the design phase, it enables to build quality into the product, by adopting Deming's profound knowledge approach, comprising system thinking, variation understanding, theory of knowledge, and psychology. The pharmaceutical industry was late in adopting these paradigms, compared to other sectors. It heavily focused on blockbuster drugs, while formulation development was mainly performed by One Factor At a Time (OFAT) studies, rather than implementing Quality by Design (QbD) and modern engineering-based manufacturing methodologies. Among various mathematical modeling approaches, Design of Experiments (DoE) is extensively used for the implementation of QbD in both research and industrial settings. In QbD, product and process understanding is the key enabler of assuring quality in the final product. Knowledge is achieved by establishing models correlating the inputs with the outputs of the process. The mathematical relationships of the Critical Process Parameters (CPPs) and Material Attributes (CMAs) with the Critical Quality Attributes (CQAs) define the design space. Consequently, process understanding is well assured and rationally leads to a final product meeting the Quality Target Product Profile (QTPP). This review illustrates the principles of quality theory through the work of major contributors, the evolution of the QbD approach and the statistical toolset for its implementation. As such, DoE is presented in detail since it represents the first choice for rational pharmaceutical development.
The design and basic performance of a Spiral Fiber Tracker for the J-PARC E36 experiment
Energy Technology Data Exchange (ETDEWEB)
Mineev, O., E-mail: oleg@inr.ru [Institute for Nuclear Research of RAS, Moscow (Russian Federation); Bianchin, S. [Canada' s National Laboratory for Particle and Nuclear Physics (TRIUMF) (Canada); Hasinoff, M.D. [University of British Columbia (Canada); Horie, K. [Osaka University (Japan); Igarashi, Y.; Imazato, J. [High Energy Accelerator Research Organization (KEK) (Japan); Ito, H.; Kawai, H.; Kodama, S. [Chiba University (Japan); Kohl, M. [Hampton University (United States); Kudenko, Yu. [Institute for Nuclear Research of RAS, Moscow (Russian Federation); National Research Nuclear University MEPhI, Moscow (Russian Federation); Moscow Institute of Physics and Technology (Russian Federation); Shimizu, S. [Osaka University (Japan); Tabata, M. [Chiba University (Japan); Toyoda, A. [High Energy Accelerator Research Organization (KEK) (Japan); Yershov, N. [Institute for Nuclear Research of RAS, Moscow (Russian Federation)
2017-03-01
A spiral fiber tracker (SFT) has been designed and produced for the J-PARC E36 experiment as an element of the tracking system for conducting a high-resolution momentum measurement of charged particles from kaon decays. A novel technique to wind the pre-made fiber ribbons spirally was employed for the configuration with four detector layers made of 1 mm diameter plastic scintillating fibers. Good position alignment and sufficiently high detection efficiency for charged particles with minimum ionizing energy were confirmed in cosmic ray test. The tracker was successfully used in the E36 experiment.
An analytical comparative exercise on the OECD-SETH PKL E2.2 experiment
International Nuclear Information System (INIS)
Reventos, F.; Freixa, J.; Batet, L.; Pretel, C.; Luebbesmeyer, D.; Spaziani, D.; Macek, J.; Lahovsky, F.; Kasahara, F.; Umminger, K.; Wegner, R.
2008-01-01
The 'First Workshop on Analytical Activities related to the SETH-OECD project' was held in Barcelona at the UPC's Institute of Energy Technologies (INTE), from 2nd to 3rd September 2003. The workshop gave the participants an opportunity to present the main results of the calculations performed as pre- and post-test simulations of SETH experiments. Among all the post-tests that were both presented and discussed, PKL experiment E2.2 holds special interest as it has been widely studied. Test E2.2 examined the most conservative case in terms of the maximum size that condensate slugs can reach and how far boron concentration can drop on resumption of natural circulation following a cold-side SB-LOCA. The analyses were performed by different working groups belonging to different countries and different codes were used. This paper goes deeper into the comparison of results of the different authors. Its aim is to both show and compare the results obtained by different working groups in their simulation of the experiment and to analyse the main parameters involved in order to draw conclusions on improvements that can be made in the analytical approach to such tests. All the participants managed to successfully predict the overall thermal-hydraulic system behaviour. Vessel fill-up together with slug build-up by reflux-condensation are phenomena that were correctly predicted, while simulation of natural circulation restart and transport of low-borated water slugs still need some improvement
Studies of the Impact of Magnetic Field Uncertainties on Physics Parameters of the Mu2e Experiment
Energy Technology Data Exchange (ETDEWEB)
Bradascio, Federica [Pisa U.
2016-01-01
The Mu2e experiment at Fermilab will search for a signature of charged lepton flavor violation, an effect prohibitively too small to be observed within the Standard Model of particle physics. Therefore, its observation is a signal of new physics. The signature that Mu2e will search for is the ratio of the rate of neutrinoless coherent conversion of muons into electrons in the field of a nucleus, relative to the muon capture rate by the nucleus. The conversion process is an example of charged lepton flavor violation. This experiment aims at a sensitivity of four orders of magnitude higher than previous related experiments. The desired sensitivity implies highly demanding requirements of accuracy in the design and conduct of the experiment. It is therefore important to investigate the tolerance of the experiment to instrumental uncertainties and provide specifications that the design and construction must meet. This is the core of the work reported in this thesis. The design of the experiment is based on three superconducting solenoid magnets. The most important uncertainties in the magnetic field of the solenoids can arise from misalignments of the Transport Solenoid, which transfers the beam from the muon production area to the detector area and eliminates beam-originating backgrounds. In this thesis, the field uncertainties induced by possible misalignments and their impact on the physics parameters of the experiment are examined. The physics parameters include the muon and pion stopping rates and the scattering of beam electrons off the capture target, which determine the signal, intrinsic background and late-arriving background yields, respectively. Additionally, a possible test of the Transport Solenoid alignment with low momentum electrons is examined, as an alternative option to measure its field with conventional probes, which is technically difficult due to mechanical interference. Misalignments of the Transport Solenoid were simulated using standard
International Nuclear Information System (INIS)
Takeuchi, T.; Chainani, A.; Takata, Y.; Tanaka, Y.; Oura, M.; Tsubota, M.; Senba, Y.; Ohashi, H.; Mochiku, T.; Hirata, K.; Shin, S.
2009-01-01
We have developed an ultrahigh-vacuum instrument for resonant diffraction experiments using polarized soft x rays in the energy range of hν=300-2000 eV at beamline BL17SU of SPring-8. The diffractometer consists of modified differentially pumped rotary feedthroughs for θ-2θ stages, a sample manipulator with motor-controlled x-y-z-, tilt (χ)-, and azimuth (φ)-axes, and a liquid helium flow-type cryostat for temperature dependent measurements between 30 and 300 K. Test results indicate that the diffractometer exhibits high reproducibility (better than 0.001 deg.) for a Bragg reflection of α-quartz 100 at a photon energy of hν=1950 eV. Typical off- and on-resonance Bragg reflections in the energy range of 530-1950 eV could be measured using the apparatus. The results show that x-ray diffraction experiments with energy-, azimuth-, and incident photon polarization-dependence can be reliably measured using soft x rays in the energy range of ∼300-2000 eV. The facility can be used for resonant diffraction experiments across the L-edge of transition metals, M-edge of lanthanides, and up to the Si K-edge of materials.
Essential results of analyses accompanying the leak rate experiments E22 at HDR
International Nuclear Information System (INIS)
Grebner, H.; Hoefler, A.; Hunger, H.
1994-01-01
Under the E22 test group of phase III of the HDR safety programme, experiments were performed on the crack opening and leak rate behaviour of pipe components of smaller nominal bores. The experiments were complemented by computations, in particular verifications, to qualify the computation models as one of the main aims of the HDR safety programme. Most of the analyses to determine crack openings were performed by means of the finite-element method, including elastic-plastic materials behaviour and, complementarily, assessing engineering methods. The leak rate was calculated by means of separate 2-phase computation models. Altogether, it may be concluded from the structural and fracture mechanical experiments with pipes, elbows and branch pieces, that crack openings and incipient cracks at loading with internal pressure or bending moment can be described with good accuracy by means of the finite-element programme ADINA and the developed FE-models. (orig.) [de
Directory of Open Access Journals (Sweden)
Edy Purwo Saputro
2011-06-01
Full Text Available Electronic service (e-service via a web channel is one of the options that many companies use to provide service and support to customers. E-service is becoming increasingly important not only in determining the success or failure of electronic commerce, but also in providing consumers with a superior experience with respect to the interactive flow of information. The purpose of this paper is to review research and is to gather conceptual perspectives on the role and nature of e-service, and the e-service experience. Recent advances in technology have created a surge in technology-based self-service or e-service, and there is an increasing recognition of its role in differentiation and customer interfaces. In order to understand e-service experiences it is necessary to go beyond studies of e-service quality dimensions and to also take into account the inherent characteristics of e-service delivery and the factors that differentiate one service experience from another. The paper reviews the factors that impact on the nature of the e-service experience, taking a wider perspective than that adopted by many researcher on e-service when they focus on the identification of the dimensions of e-service quality. In order to manage the e-service experience it is important to develop a clear articulation of the nature, boundaries, components and elements of specific e-service experiences, and to further investigate the interaction between these factors and service quality dimensions.
Directory of Open Access Journals (Sweden)
Sílvia Ramos
2006-01-01
Full Text Available O artigo discute aspectos das respostas brasileiras à violência urbana, focalizando tanto políticas governamentais de segurança pública como ações da sociedade civil. Identifica e inexistência de uma política nacional de segurança pública, indica experiências governamentais bem-sucedidas em estados e municípios e focaliza a atuação das polícias. Ao analisar as respostas da sociedade civil, destaca a experiência da campanha do desarmamento e o papel da mídia. O trabalho situa o surgimento de grupos de jovens de favelas organizados em torno de experiências culturais que, em vários aspectos, se caracterizam como "novos mediadores" na sociedade. Esses grupos tematizam a violência e procuram construir novos estereótipos que dissociem os jovens de periferia das imagens de criminalidade. O artigo descreve em particular o caso do grupo cultural AfroReggae, do Rio de Janeiro, e a experiência piloto em batalhões da Polícia Militar de Minas Gerais, o projeto Juventude e Polícia. Argumentase que o grupo AfroReggae é tipicamente um novo mediador e que a iniciativa de realizar um projeto com a polícia abre novas perspectivas no campo da reduzida tradição participativa de organizações da sociedade civil na esfera da segurança pública e em projetos de cooperação com a polícia.This article points out some aspects of the Brazilian's response to the urban violence, focusing both official policies of public security and civil society's actions. Identifies a lack on the national policy of public security, indicates successful governmental experiences carried out on some states and counties, and concentrates on the Police's actions. Analyzing the responses of the civil society, points out the experience of the Campaign for Disarmament and the role of the media. The paper shows the rising of groups of young people living in the favelas that became organized around cultural experiences that, in multiple aspects, characterize them as
Metodologias ativas de ensino e aprendizagem: uma experiência com docentes da educação básica
Antônio Eustáquio Ferreira
2017-01-01
Relato com o objetivo de descrever a experiência de um curso de formação continuada de professores, cujo título é Metodologias Ativas de Ensino e Aprendizagem: uma experiência com docentes da educação básica, desenvolvido em parceria com a Universidade Federal da Grande Dourados, sob a coordenação e execução do autor. Os resultados evidenciaram que o contato dos docentes da educação básica com algumas técnicas das Metodologias Ativas de Ensino e Aprendizagem provocam reflexões sobre suas atit...
Directory of Open Access Journals (Sweden)
Romeu Gomes
2006-01-01
Full Text Available O presente estudo tem como objetivo analisar os êxitos e os limites de experiências nacionais na prevenção da violência e indicar possibilidades de enfrentamento do problema.A pesquisa que dá origem ao artigo consistiu em um estudo de caso de nove experiências, seguindo princípios da triangulação de métodos. Foram aplicados questionários quantitativos e realizadas entrevistas (individuais e grupais. Os resultados apontam que os principaisêxitos relatados são: informação para a cidadania; preparação para o trabalho; envolvimento de crianças e adolescentes em atividades lúdicas e educativas e o fortalecimento da auto-estima dos jovens e crianças participantes. As maiores dificuldades das experiências são a manutenção financeira e a articulação de suas propostas com as de outros grupos e instituições. O estudo leva a concluir que essas experiências, ainda que não sejam as únicas bem-sucedidas no País, apontam para um horizonte novo pela forma como atuam, inovando e criando uma práxis diferenciada na abordagem da violência.The present study analyzes the success of Brazilian experiences engaged in prevention of violence as well as their limitations, and seeks to show ways for a solution of the problem. The investigation underlying this article consisted in a case study of nine experiences, using triangulation of methods. For this purpose, we used questionnaires and interviewed individuals and groups. Successful results were mainly: informed citizenship,work preparation, involvement of children and adolescents in recreating and educative activities, and increased self-esteem of the children and teens involved in the experiences. The greatest difficulties found were the lack of funds and of articulation of proposals with other groups and institutions. These experiences are not the only successful ones carried out in the country, but they point to a new horizon by innovating and creating a different practical approach
Docinhos e ensaios de não inferioridade: uma experiência pedagógica criativa
Directory of Open Access Journals (Sweden)
David William Moraes
Full Text Available Os novos desafios na área da educação surgem com o próprio desenvolvimento do conhecimento. Novas técnicas de pesquisa possibilitaram grandes descobertas na ciência e, com isso, uma crescente complexificação dos temas estudados. Os alunos, inseridos no universo dinâmico da internet, também evoluíram e não se encaixam mais nas prescrições da pedagogia tradicional. Para essas novas realidades, a forma de educar no século XXI exige dos educadores um esforço de criatividade para transmitir um conhecimento cada vez mais complexo. Para ilustrar essa nova situação, relatamos uma experiência pedagógica que buscou, com a criatividade de uma intervenção fictícia, favorecer o ensino dos ensaios clínicos de não inferioridade. A experiência demonstra a utilidade de tais ensaios clínicos quando se necessita testar a eficácia de tratamentos. A utilização dos docinhos e a participação dos alunos como sujeitos do ensaio configuraram-se como uma metodologia ativa, de aproximação entre os educandos e seu objeto de estudo. O exercício realizado está de acordo com os modelos pedagógicos sugeridos pela teoria da aprendizagem significativa e pode servir de referência para iniciativas semelhantes.
Directory of Open Access Journals (Sweden)
Paulo Amarante
Full Text Available O presente trabalho busca refletir sobre as inovações produzidas pela Reforma Psiquiátrica para o governo da Saúde Mental no Brasil, especialmente por meio de um movimento artístico-cultural de construção de novas concepções sobre a loucura e o sofrimento mental. Desse modo, o artigo analisa as rupturas com o paradigma psiquiátrico que vêm sendo operadas a partir das experiências artístico-culturais brasileiras, por meio de inúmeros projetos de arte-cultura no campo da Saúde Mental, nos quais os atores do processo de reforma psiquiátrica vêm produzindo não só novas possibilidades de vida, expressão e inclusão social para os sujeitos em sofrimento mental, mas também a construção de um novo lugar social para a loucura. Finalmente, reflete-se sobre as mudanças no imaginário social no sentido da solidariedade, frente a permanências e resistências às mudanças e o surgimento de outras formas de exclusão e medicalização.
Long term data preservation for CDF at INFN-CNAF
International Nuclear Information System (INIS)
Amerio, S; Chiarelli, L; Dell'Agnello, L; Girolamo, D De; Gregori, D; Pezzi, M; Prosperini, A; Ricci, P; Rosso, F; Zani, S
2014-01-01
Long-term preservation of experimental data (intended as both raw and derived formats) is one of the emerging requirements coming from scientific collaborations. Within the High Energy Physics community the Data Preservation in High Energy Physics (DPHEP) group coordinates this effort. CNAF is not only one of the Tier-1s for the LHC experiments, it is also a computing center providing computing and storage resources to many other HEP and non-HEP scientific collaborations, including the CDF experiment. After the end of data taking in 2011, CDF is now facing the challenge to both preserve the large amount of data produced during several years of data taking and to retain the ability to access and reuse it in the future. CNAF is heavily involved in the CDF Data Preservation activities, in collaboration with the Fermilab National Laboratory (FNAL) computing sector. At the moment about 4 PB of data (raw data and analysis-level ntuples) are starting to be copied from FNAL to the CNAF tape library and the framework to subsequently access the data is being set up. In parallel to the data access system, a data analysis framework is being developed which allows to run the complete CDF analysis chain in the long term future, from raw data reprocessing to analysis-level ntuple production. In this contribution we illustrate the technical solutions we put in place to address the issues encountered as we proceeded in this activity.
Directory of Open Access Journals (Sweden)
Denise Fagundes Jardim
2000-11-01
Full Text Available O "trânsito internacional" dos palestinos nos permite tratar das várias faces da experiência da diáspora. A diáspora tem sido uma categoria difundida por organizações de defesa da causa palestina que se confunde com a reivindicação de um Estado Palestino. É uma expressão que comporta um uso genérico como uma experiência "de todos os palestinos" que evadiram de um território originário. Uma outra expressão que encontro no trabalho de campo, é a diáspora referida a família "espalhada", que visita-se constantemente, entre cidades, entre países, mas que não se reúne em um único lugar, um lugar "de todos". Demonstro um dos eixos desta experiência de diáspora relacionada ao trânsito internacional. Viagens que são propostas pela família de orientação aos seus membros. A experiência pode ser vista como um momento da migração, a inserção de uma primeira geração, onde os laços familiares gradativamente vão se centrando no lugar escolhido para viver. Todavia, seja como uma característica de primeira ou segunda geração dos migrantes, as famílias são uma realidade intransponível neste trânsito, uma de suas condições sociais e nos permitem desvendar o itinerário da descoberta e da pertinência da identidade palestina para os filhos de migrantes nascidos no Brasil e ingressantes na vida adulta. Analiso como as famílias - aquelas que realizaram viagens internacionais - vivem esta experiência singular através dos relatos de seus filhos. Esta não é exatamente uma viagem de "retorno", pois nem sempre é algo a reconhecer. Aqui, saliento a viagem como uma "iniciação" dos jovens, de forma proporcionada e planejada pela família. Esta experiência tem resultado na "re-descoberta" e "recriação" da pertinência do tema da "origem comum". Longe de ser uma experiência individual, casual e disponível a qualquer um, está de acordo com uma experiência coletiva de alteridades."Diasporas, Travels and Alterities
Energy Technology Data Exchange (ETDEWEB)
Penel-Nottaris, Emilie [Univ. Joseph Fourier Grenoble (France)
2004-07-01
The Jefferson Lab Hall A experiment has measured the 3He(e,e'p) reaction cross sections. The separation of the longitudinal and transverse response functions for the two-body breakup reaction in parallel kinematics allows to study the bound proton electromagnetic properties in the 3He nucleus and the involved nuclear mechanisms beyond impulse approximation. Preliminary cross sections show some disagreement with theoretical predictions for the forward angles kinematics around 0 MeV/c missing momenta, and sensitivity to final state interactions and 3He wave functions for missing momenta of 300 MeV/c.
Fermilab experiment E-687: Recent results on charm
International Nuclear Information System (INIS)
Shephard, W.D.
1990-12-01
About 10 4 charm decays have been reconstructed from first-run data of Fermilab experiment E687 using the Fermilab Wide-Band Photon Spectrometer with the world's highest energy photon beam. Charm selection strategies and preliminary results are discussed. Lifetime values are (.50 ± .06 ± .03)ps for the D s + and (.20 ± .03 ± .03)ps for the Λ c + . Preliminary D + and D 0 lifetimes are consistent with current world averages. Signals for charm baryon and Cabibbo-suppressed charm meson decays are shown. Preliminary branching ratios are: B(D 0 → π + π - π + π - )/B(D 0 → K - π + π + π - ) = .10 ± .02 ± .02; B(D 0 → bar K 0 K + K - )/B(D 0 → bar K 0 π + π - ) = .20 ± .06(stat); B(D 0 → bar K 0 φ)/B(D 0 → bar K 0 π + π - ) = .16 ± .06(stat). Preliminary results are given on D* ± and D ±,0 photoproduction for photon energies from 100 to 350 GeV. 13 refs., 3 figs
Dismorfia muscular e o uso de suplementos ergogênicos em desportistas
Directory of Open Access Journals (Sweden)
Litiane Dorneles de Lima
2010-12-01
Full Text Available A dismorfia muscular (DM é um transtorno da imagem corporal que acomete principalmente homens que, apesar da grande hipertrofia muscular, consideram-se pequenos e fracos. Tendo em vista o crescente uso de substâncias ergogênicas para o aumento de massa muscular e o elevado número de indivíduos com transtornos corporais, o objetivo deste trabalho foi avaliar a presença de DM e o uso de suplementos ergogênicos em desportistas frequentadores de academia. Foram avaliados 23 indivíduos do sexo masculino com média de idade de 24 ± 3,8 anos, praticantes de treinamento de força, com idades entre 18 e 35 anos. Para a avaliação corporal foi realizado o teste de bioimpedância, com o qual se obteve os dados de massa magra e gorda, respectivamente, de 66,5 ± 10,1kg e 10,5 ± 3,1kg. Para detectar o risco de DM, foi usada uma escala (MASS - Muscle Appearance Satisfaction Scale; se o resultado desta fosse acima de 52 pontos, estes apresentavam o risco de DM. Juntamente, foi respondido outro questionário para o conhecimento do uso de suplementos. A análise dos resultados identificou que, dos avaliados, 17,4% (n = 4 apresentaram risco positivo para o desenvolvimento deste transtorno corporal; porém, destes, apenas 25% declararam fazer uso de suplementos alimentares. Conclui-se que não houve relação entre o uso de suplementos e a presença de dismorfia muscular.
Heat generation and cooling of SSC magnets at high ramp rates
International Nuclear Information System (INIS)
Snitchler, G.; Capone, D.; Kovachev, V.; Schermer, R.
1992-01-01
This presentation will address a summary of AC loss calculations (SSCL), experimental results on cable samples (Westinghouse STC), short model magnets test results (FNAL, KEK-Japan), and recent full length magnets test data on AC losses and quench current ramp rate sensitivity (FNAL, BNL). Possible sources of the observed enhanced heat generation and quench sensitivity for some magnets will be discussed. A model for cooling conditions of magnet coils considering heat generation distribution and specific anisotropy of the heat transfer will be presented. The crossover contact resistance in cables and curing procedure influence on resistivity, currently under study, will be briefly discussed. (author)
IRPhE/RRR-SEG, Reactor Physics Experiments from Fast-Thermal Coupled Facility
International Nuclear Information System (INIS)
Weiss, Frank-Peter; Dietze, Klaus; Jacqmin, Robert; Ishikawa, Makoto
2003-01-01
1 - Description: The RRR-SEG-experiments have been performed to check neutron data of the most important reactor materials, especially of fission product nuclides, fuel isotopes and structural materials. The measured central reactivity worths (CRW) of small samples were compared with calculated values. These C/E-ratios have been used then for data corrections or in adjustment procedures. The reactor RRG-SEG (at RC Rossendorf / Germany) was a fast-thermal coupled facility of zero power. The annular thermal drivers were filled by fuel assemblies and moderated by water. The inner insertion lattices were loaded with pellets of fuel and other materials producing the fast neutron flux. The characteristics of the neutron and adjoint spectra were obtained by special arrangements of these pellets in unit cells. In this way, a hard or soft neutron spectrum or a special energy behavior of the adjoint function could be reached. The samples were moved by means of tubes to the central position (pile-oscillation technique). The original information about the facility and measurements is compiled in Note Technique SPRC/LEPh/93-230 (SEG) The SEG experiments are considered 'clean' integral experiments, simple and clear in geometry and well suited for calculation. In all SEG configurations only a few materials were used, most of these were standards. Due to the designed adjoint function (energy-independent or monotonously rising), the capture or scattering effect was dominant, convenient to check separately capture or scattering data. At first, analyses of the experiments have been performed in Rossendorf. Newer analyses were done later in Cadarache / CEA France using the European scheme for reactor calculation JEF-2.2 / ECCO / ERANOS (see Note Techniques and JEF/DOC-746). Furthermore, re-analyses were performed in O-arai / JNC Japan with the JNC standard route JENDL-3.2 / SLAROM / CITATION / PERKY. Results obtained with both code systems and different data evaluations (JEF-2.2 and
Ytarget optimization for E93050 experiment. Pt. 1. Q2 = 1 GeV2
International Nuclear Information System (INIS)
Jaminion, S.; Fonvieille, H.
1998-01-01
The Espace y tg optimization that has been performed for experiment E93050 at Q 2 = 1 GeV 2 is summarized. The method and results are presented. The optic Y tensor elements obtained can be used for first pass analysis, although a more refined analysis may need further optimized optic elements. (author)
Hamsatu, Pur; Yusufu, Gambo; Mohammed, Habib A.
2016-01-01
This study was conducted to explore teachers' perceptions, and students' experiences in e-Examination in University of Maiduguri. Questionnaires were distributed to 30 teachers and 50 students, and the 80 collated instruments were valid for data analysis, representing a response rate of 100%. The validity of the questionnaire was approved by some…
Determination of strange sea distributions from {nu}N deep inelastic scattering
Energy Technology Data Exchange (ETDEWEB)
Alekhin, S. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)]|[Inst. for High Energy Physics, Protvino (Russian Federation); Kulagin, S. [Academy of Sciences of Russia, Moscow (Russian Federation). Inst. for Nuclear Research; Petti, R. [South Carolina Univ., Columbia, SC (United States). Dept. of Physics and Astronomy
2008-12-15
We present an analysis of the nucleon strange sea extracted from a global Parton Distribution Function fit including the neutrino and anti-neutrino dimuon data by the CCFR and NuTeV collaborations, the inclusive charged lepton-nucleon Deep Inelastic Scattering and Drell-Yan data. The (anti-)neutrino induced dimuon analysis is constrained by the semi-leptonic charmed-hadron branching ratio B{sub {mu}}=(8.8{+-}0.5)%, determined from the inclusive charmed hadron measurements performed by the FNAL-E531 and CHORUS neutrino emulsion experiments. Our analysis yields a strange sea suppression factor {kappa}(Q{sup 2}=20 GeV{sup 2})=0.62{+-}0.04, the most precise value available, an x-distribution of total strange sea that is slightly softer than the non-strange sea, and an asymmetry between strange and anti-strange quark distributions consistent with zero (integrated over x it is equal to 0.0013{+-}0.0009 at Q{sup 2}=20 GeV{sup 2}). (orig.)
Essential results of analyses accompanying the leak rate experiments E22 at HDR
International Nuclear Information System (INIS)
Grebner, H.; Hoefler, A.; Hunger, H.
1997-01-01
During phase III of the HDR Safety Programme (HDR: decommissioned overheated steam reactor in Karlstein, Germany), experiments were performed in test group E22 on small-bore austenitic straight piping and on pipe elbows and branches containing through-wall cracks. The main aim was the determination of crack opening and leak rate behaviour for the cracked components under almost operational pressure and temperature loading conditions, especially including transient bending moments. In addition to machined slits, naturally grown fatigue cracks were also considered to cover the leakage behaviour. The experiments were accompanied by calculations, mainly performed by GRS. The paper describes the most important aspects and the essential results of the calculations and analysis. The main outcome was that the crack opening and initiation of crack growth can be described with the finite element techniques applied with sufficient accuracy. However, the qualification of the leak rate models could not be completed successfully, and therefore more sophisticated experiments of this kind are needed. (orig.)
Elementary particle physics at the Florida State University. Progress report
International Nuclear Information System (INIS)
1976-11-01
This report covers the thirteen-month period from October 1, 1975, to October 31, 1976. The experimental program involved two bubble chamber experiments: one from SLAG at 15 GeV/c π + d and the other from FNAL at 250 GeV/c. In addition, the preparation for a BNL Multiparticle Spectrometer experiment to search for XI*-has started and is going on at full steam. The theoretical research has concentrated both in gravitation and strong interaction phenomenology. Some of the theoretical work has been in collaboration with the experimental physicists. Two of our members spent three months in the U.S.S.R. as exchange scientists and another member is currently at Cambridge University, England, planning for a possible future bubble chamber experiment
2013-01-01
The HEPiX forum brings together worldwide Information Technology staff, including system administrators, system engineers, and managers from the High Energy Physics and Nuclear Physics laboratories and institutes, to foster a learning and sharing experience between sites facing scientific computing and data challenges. Participating sites include BNL, CERN, DESY, FNAL, IN2P3, INFN, JLAB, NIKHEF, RAL, SLAC, TRIUMF and many others. Sponsor logo here Sponsor logo here Sponsor logo here Sponsor logo here Hosted by ATLAS Great Lakes Tier 2 at the University of Michigan in Ann Arbor Michigan.
Directory of Open Access Journals (Sweden)
Sílvia Ramos
2006-06-01
Full Text Available This article discusses some aspects of the Brazilian response to urban violence, focusing both official public safety policies and actions of the civil society. The text identifies the lack of a national public safety policy, indicates successful governmental experiences carried out in some states and municipalities, and concentrates on the actions of the police. Analyzing the responses of the civil society, the paper is emphasizing the campaign for disarming the population and the role played by the media. It shows the appearance of groups of young people living in the favelas, organized in turn of cultural experiences that, in multiple aspects, are characterized as "new mediators" in society. These groups thematize violence and try to build new stereotypes dissociating them from the image of criminality. The article describes in particular the cases of the Grupo Cultural AfroReggae, of Rio de Janeiro, and the pilot experience carried out in collaboration with the Minas Gerais Military Police, called "Youth and the Police". The AfroReggae group is a typical example of such a "new mediator", and the initiative of carrying out a work in cooperation with the police opens new perspectives for the traditionally scarce participation of civil organizations engaged in public safety in cooperative projects with the police.O artigo discute aspectos das respostas brasileiras à violência urbana, focalizando tanto políticas governamentais de segurança pública como ações da sociedade civil. Identifica a inexistência de uma política nacional de segurança pública, indica experiências governamentais bem-sucedidas em estados e municípios e focaliza a atuação das polícias. Ao analisar as respostas da sociedade civil, destaca a experiência da campanha do desarmamento e o papel da mídia. O trabalho situa o surgimento de grupos de jovens de favelas organizados em torno de experiências culturais que, em vários aspectos, caracterizam-se como "novos
Photon detector for high energy measurements in the SELEX spectrometer (Fermilab experiment E781)
International Nuclear Information System (INIS)
Goncharenko, Yu.M.; Grachov, O.A.; Kurshetsov, V.F.; Landsberg, L.G.; Nurushev, S.B.; Vasil'ev, A.N.
1995-01-01
A possibility to use one- or two-photon lead glass detectors for high energy measurements in the SELEX spectrometer with E γ up to 500 GeV is studied. It is shown that a single photon detector equipped with radiation-resistant lead glass counters is applicable for the experiment discussed. It is concluded that for the best energy resolution in the case of Primakoff effect like π - = γ * → π - + γ the combined method would be used with weighted combination of direct E γ measurement in the Photon-3 detector and the π - beam energy precise measurement. 11 refs., 4 tabs., 17 figs
Preços de transferência : a experiência internacional e o caso brasileiro
Guerra, Andre Morgado
2010-01-01
Este trabalho analisa a legislação brasileira de preços de transferência. O objetivo principal é sugerir mudanças que possam aperfeiçoar a legislação existente, sem que isto afete negàtivamente o influxo de investimento estrangeiro direto para o Brasil. A experiência internacional é usada como referência. São utilizados a leqislação-dos Estados Unidos da América (EUA) e as diretrizes da Organização para Cooperação e Desenvolvimento Econômico (OCDE), como principais fontes' d...
E-squared nine do-it-yourself energy experiments that prove your thoughts create your reality
Grout, Pam
2013-01-01
E-Squared is a lab manual with simple experiments to prove once and for all that there really is a good, loving, totally hip force in the universe. Rather than take it on faith, you are invited to conduct ten 48-hour experiments to prove each of the principles in this book. Yes, you read that right. It says prove. The experiments, each of which can be conducted with absolutely no money and very little time expenditure, demonstrate that spiritual principles are as dependable as gravity, as consistent as Newton's 2nd law of motion. For years, you've been hoping and praying that spiritual principles are true. Now, you can know.
Directory of Open Access Journals (Sweden)
Caroline Evelin Nascimento Kluczynik
2012-08-01
Full Text Available BACKGROUND: Studies have suggested an association between the presence of acanthosis nigricans (AN and the development of diabetes. OBJECTIVE: To investigate the association between AN and insulin resistance (IR in overweight children and adolescents receiving care at the Center for Childhood Obesity, Campina Grande, PB. METHODS: This cross-sectional study was conducted between April 2009 and April 2010 including 194 individuals of 2 to 18 years of age receiving care within the Brazilian national health network. The presence of acanthosis nigricans was verified and anthropometric measurements were taken. The following tests were performed: insulin, triglycerides, HDL-cholesterol, glucose and homeostasis model of assessment - insulin resistance (HOMA-IR. Statistical analyses were performed using the SPSS software program, version 17.0. RESULTS: There was a greater prevalence of females (66%, brown-skinned individuals (63.4%, adolescents (61.3% and severely obese individuals (66.5%. Acanthosis nigricans was identified in 58.2% and IR in 42.7% of the participants. Acanthosis nigricans was associated with being non-white (p = 0.003, with being an adolescent (p = 0.003 and with IR (p = 0.001. Non-white individuals, adolescents and those with insulin resistance were 5.4, 2.47 and 2.66 times more likely to have acanthosis nigricans, respectively. CONCLUSION: The results of this study indicate a need to train healthcare professionals to identify acanthosis nigricans, since this condition is associated with IR. Identifying acanthosis nigricans in childhood permits the safe and timely treatment of cardiometabolic disorders through careful monitoring and appropriate treatment.FUNDAMENTOS: Estudos sugerem haver associação entre a presença de Acantose Nigricans e o desenvolvimento do diabetes. OBJETIVO: Verificar a associação entre Acantose Nigricans e Resistência Insulínica (RI em crianças e adolescentes com excesso de peso, atendidos no Centro de
Mehta, S; Clarke, F; Fleming, P S
2016-08-12
Purpose/objectives The aims of this study were to describe the development of a novel e-learning resource and to assess its impact on student learning experiences and orthodontic knowledge.Methods Thirty-two 4th year dental undergraduate students at Queen Mary University of London were randomly allocated to receive electronic access to e-learning material covering various undergraduate orthodontic topics over a 6-week period. Thirty-one control students were not given access during the study period. All students were asked to complete electronic quizzes both before (T0) and after (T1) the study period and a general questionnaire concerning familiarity with e-learning. The test group also completed a user satisfaction questionnaire at T1. Two focus groups were also undertaken to explore learners' experiences and suggestions in relation to the resource.Results The mean quiz result improved by 3.9% and 4.5% in the control and test groups, respectively. An independent t-test, however, demonstrated a lack of statistical significance in knowledge gain between control and test groups (P = 0.941). The qualitative feedback indicated that students believed that use of the resource enhanced knowledge and basic understanding with students expressing a wish to ingrain similar resources in other areas of undergraduate teaching.Conclusions Use of the novel orthodontic e-resource by 4th year undergraduate students over a 6-week period did not result in a significant improvement in subject knowledge. However, the e-learning has proven popular among undergraduates and the resources will continue to be refined.
Experiência e tradição em Walter Benjamin: ressonâncias para a educação
Directory of Open Access Journals (Sweden)
Sérgio Luiz Alves da Rocha
2016-02-01
Full Text Available O proceso educativo faz com que diferentes gerações tenham que relacionar-se. Diante das modifcações dos últimos anos, alguns professores, adotam ora uma perspectiva saudosista, ora um discurso que valoriza de modo extremo os jovens e o novo. A ênfase, seja na experiência dos mais velhos, com a consequente desvalorização dos mais jovens, ou da experiência dos mais jovens, renegando-se a experiência dos mais velhos, nos impede de estabelecer pontes entre as gerações. Utilizo alguns textos de Walter Benjamin para refetir sobre o significado da experiência e da tradição. As ideias de Benjamin me permitem pensar sobre a relação entre as gerações no interior da escola a partir de uma postura ética que reconheça nosso papel como representantes de uma determinada tradição sem deixar de estarmos abertos às experiências dos jovens.
Study of the (e,e'p) quasi-elastic reaction in complex nuclei: theory and experiment
Energy Technology Data Exchange (ETDEWEB)
Herraiz, Joaquin Lopez [Complutense Univ. of Madrid (Spain)
2010-03-01
Experimental coincidence cross section and transverse-longitudinal asymmetry ATL have been obtained for the quasielastic (e,e'p) reaction in 16O, 12C, and {sup 208}Pb in constant q-ω kinematics in the missing momentum range -350 < pmiss < 350 MeV/c. In these experiments, performed in experimental Hall A of the Thomas Jefferson National Accelerator Facility (JLAB), the beam energy and the momentum and angle of the scattered electrons were kept fixed, while the angle between the proton momentum and the momentum transfer q was varied in order to map out the missing momentum distribution. The experimental cross section and ATL asymmetry have been compared with Monte Carlo simulations based on Distorted Wave Impulse Approximation (DWIA) calculations with both relativistic and non-relativistic spinor structure. The spectroscopic factors obtained for both models are in agreement with previous experimental values, while ATL measurements favor the relativistic DWIA calculation. This thesis describes the details of the experimental setup, the calibration of the spectrometers, the techniques used in the data analysis to derive the final cross sections and the ATL, the ingredients of the theoretical calculations employed and the comparison of the results with the simulations based on these theoretical models.
Cosmic rays from 1017eV to beyond 1020eV: evidence from the fly's eye experiment and ground arrays.
Sokolsky, P.
The study of cosmic rays with energies well above the knee (1015eV) of the spectrum has a long history. Beginning with the pioneering work of Linsley and the Volcano Ranch array, followed by the SUGAR, Haverah Park, Yakutsk, Akeno and AGASA array and the Fly's Eye detector, evidence has been steadily accumulating that the spectrum exhibits a change in slope near 10×1018eV. This flattening may indicate that the spectrum in this region is largely extragalactic in origin. If the sources of this spectrum are sufficiently distant, a cut-off due to the interaction of near 1020eV protons with black body photons should be observed. Recent data from the AGASA and Fly's Eye detectors have brought to bear information of spectral shape, composition and anisotropy to this study. In addition to clarifying the nature of the spectral structure, these new results lead to the surprising conclusion that nearby cosmic ray sources must exist that produce particles with energies well in excess of 1020eV. New experiments are being designed which will have the enormous apertures necessary for detecting these very rare events.
Cartografia e deficiência visual: experiências no Colégio Pedro II
Directory of Open Access Journals (Sweden)
Rafael Medeiros de Andrade
2014-01-01
Full Text Available O processo de construção de uma escola inclusiva perpassa um conjunto de esforços cognitivos e técnicos por parte da comunidade escolar que são necessários para a adequada educação e desenvolvimento do aluno. No que diz respeito ao ensino de Geografia para alunos deficientes visuais, fazem parte deste conjunto de medidas o domínio do sistema Braille, a confecção de materiais e mapas táteis, a gravação de textos em áudio e, entre outras, a realização de trabalhos de campo. O presente relato de experiência refere-se à um projeto de dedicação exclusiva, implementado no Colégio Pedro II de 2008 a 2010, cujo objetivo foi aprimorar o ensino de Geografia para os alunos deficientes visuais. Conclui-se que a adoção dessas medidas representa o início de um longo trabalho de toda comunidade escolar que não pode ser resumido à existência de alguns materiais táteis. Deve, por outro lado, envolver um processo de construção e adequação instrumental, acompanhado da capacitação profissional e da sensibilização da comunidade escolar.
Caminhos do cativeiro: a experiência de escravos e libertos em Castro (1800-1830
Directory of Open Access Journals (Sweden)
Bruna Marina Portela
2010-12-01
Full Text Available Este artigo analisa a configuração de uma comunidade escrava em Castro, São Paulo, durante as três primeiras décadas do século XIX. Busca compreender o que significou para esses cativos viver em uma vila voltada quase que exclusivamente para a criação e o comércio de animais. Para isso, foi utilizado como principal corpo documental inventários post-mortem de proprietários de escravos e, além deles, Listas Nominativas de Habitantes e outros documentos oriundos do poder judiciário. Através desta documentação, foi possível seguir a trajetória de alguns escravos e examinar aspectos da constituição de suas famílias e de seus vínculos com a vida agro-pastoril. Suas experiências semelhantes, fosse conduzindo tropas, cuidando do gado ou buscando uma vida melhor fora da vila de Castro, após receberem sua liberdade, fizeram com que configurassem uma comunidade escrava com ideais, interesses e visões de mundo particulares.
Directory of Open Access Journals (Sweden)
Sonia Kramer
1999-03-01
Full Text Available Este artigo apresenta pesquisa sobre narrativa, experiências de leitura/escrita e memória de professores. Baseado na teoria crítica da cultura e da modernidade, em especial em Walter Benjamin, procura conhecer práticas de leitura e escrita de professores e compreender como foi construída - ao longo de suas trajetórias - sua relação com a escrita e de que forma tal relação influencia a prática escolar. Discute questões de natureza teórico-metodológica; apresenta as etapas da pesquisa, seus desafios e os principais achados, tratando do período exploratório (entrevistas com professores de pré-escola e 1as séries do 1º grau e da investigação (entrevistas com professores que atuaram nas décadas de 20/30/40 e 50/60; e sintetiza o ensaio que vem sendo feito a partir de acervo de fotografias de situações de leitura e escrita captadas no cotidiano do Rio de Janeiro.This article presents a research about narrative, reading and writing experiences and teachers' biographies. Based on critical theory of culture and modernity, particularly on Walter Benjamin, the research intends to study reading and writing teachers' practices, to understand their relation with written language and to understand also in which way this relation influences pedagogic action. The article begins analysing theorethical and methodological questions; than it presents the phases performed by the research - exploratory period (when pre-school and elementary school teachers were interviewed, field study (when teachers that worked at the 20/30/40ies and the 50/60ies were interviewed, the main results; and, at the end, it summarizes the analyses that are being developed concerning reading and writing photographies in Rio de Janeiro daily life.
Kang, K.; Fried, H. M.; Tan, C.-I.
1994-02-01
The Table of Contents for the book is as follows: * Preface * `Overview' on Elastic Scattering and Total Cross-Sections * A Precise Measurement of the Real Part of the Elastic Scattering Amplitude at the {S bar{p}pS} * Luminosity Dependent Measurement of the p bar{p} Total Cross Section at √{s} = 541 GeV * Status of Fermilab E-710 * Luminosity-Independent Measurement of bar{p}p Elastic Scattering, Single Diffraction, Dissociation and Total Cross Section at √{s} = 546 and 1800 GeV * Phase Relations Revisited: A Challenge for SSC and LHC * Status of Near-Forward Elastic Scattering * bar{p}p Collisions at √{s} = 1.8 TeV: p, σt and B * p bar{p} Forward Scattering Parameters Results from Fermilab E760 * Photoproduction Results from H1 at HERA * Total and Jet Photoproduction Cross Sections at HERA and Fermilab * Minijet Model for High Energy γp Cross Sections * The Pomeron as Massive Gluons * Large N Theories with Glueball-like Spectra * Unitarity Relations for Gluonic Pomeron * The Donnachie-Landshoff Pomeron vs. QCD * The Odderon Intercept in Perturbative QCD * Theoret. and Phenomenol. Aspects of the Odderon * First Theorist's Gaze at HERA Data at Low xB * H1 Results for Structure Functions at Small x * Partial Photoproduction Cross Sections at √{s} ≈prox 180 GeV and First Results on F2 of the Proton from the ZEUS Experiment * Observation of a New Class of Events in Deep Inelastic Scattering * Jet Production in Muon-Proton and Muon-Nuclei Scattering at Fermilab-E665 * D0 Studies of Perturbative QCD * Large Rapidity Gaps and Single Diffraction Dissociation in High Energy pp and bar{p}p Collisions * Hadron and Reggeon Structure in High Energy Collisions * Monte Carlo Studies of Diffractive Processes in Deep Inelastic Scattering * Elastic Parton-Parton Amplitudes in Geometrical Models * Non-Perturbative QCD Calculations of High-Energy Observables * Effective Field Theory for Diffractive QCD Processes * High Energy Behavior of σtot, ρ, and B - Asymptotic
Integralidade e redes de cuidado: uma experiência do PET-Saúde/Rede de Atenção Psicossocial
Directory of Open Access Journals (Sweden)
Maria Lenz Cesar Kemper
2015-12-01
Full Text Available O presente artigo aborda a formação em saúde a partir da experiência do PET- Saúde/Rede de Atenção Psicossocial: priorizando o enfrentamento do álcool, crack e outras drogas, da Universidade Federal do Rio de Janeiro - UFRJ. Compreendendo o cuidado em saúde mental como uma prática integral que inclui redes variadas e complexas (formal, territorial e familiar, a metodologia deste PET se utiliza da cartografia, convidando o pesquisador a estar no território e no cotidiano do usuário. Assim, aposta-se numa formação ampliada dos alunos de graduação, ao se ofertar um campo de interlocução entre teoria e prática. Alguns casos são apresentados para ilustrar essa experiência, que visa a identificar e intervir na dinâmica das redes de cuidado. A ampliação da compreensão de rede e o mapeamento de territórios afetivos expandem as possibilidades de um cuidado integral, promovendo saúde e qualidade de vida.
Performance of prototypes for the ALICE electromagnetic calorimeter
Allen, J; Badala, A; Baumgart, S; Bellwied, R; Benhabib, L; Bernard, C; Bianchi, N; Blanco, F; Bortoli, Y; Bourdaud, G; Bourrion, O; Boyer, B; Bruna, E; Butterworth, J; Caines, H; Calvo Diaz Aldagalan, D; Capitani, G P; Carcagno, Y; Casanova Diaz, A; Cherney, M; Conesa Balbastre, G; Cormier, T M; Cunqueiro Mendez, L; Delagrange, H; Del Franco, M; Dialinas, M; Di Nezza, P; Donoghue, A; Elnimr, M; Enokizono, A; Estienne, M; Faivre, J; Fantoni, A; Fichera, F; Foglio, B; Fresneau, S; Fujita, J; Furget, C; Gadrat, S; Garishvili, I; Germain, M; Giudice, N; Gorbunov, Y; Grimaldi, A; Guardone, N; Guernane, R; Hadjidakis, C; Hamblen, J; Harris, J W; Hasch, D; Heinz, M; Hille, P T; Hornback, D; Ichou, R; Jacobs, P; Jangal, S; Jayananda, K; Klay, J L; Knospe, A G; Kox, S; Kral, J; Laloux, P; LaPointe, S; La Rocca, P; Lewis, S; Li, Q; Librizzi, F; Madagodahettige Don, D; Martashvili, I; Mayes, B; Milletto, T; Muccifora, V; Muller, H; Muraz, J F; Nattrass, C; Noto, F; Novitzky, N; Odyniec, G; Orlandi, A; Palmeri, A; Pappalardo, G S; Pavlinov, A; Pesci, W; Petrov, V; Petta, C; Pichot, P; Pinsky, L; Ploskon, M; Pompei, F; Pulvirenti, A; Putschke, J; Pruneau, C A; Rak, J; Rasson, J; Read, K F; Real, J S; Reolon, A R; Riggi, F; Riso, J; Ronchetti, F; Roy, C; Roy, D; Salemi, M; Salur, S; Sharma, M; Silvermyr, D; Smirnov, N; Soltz, R; Sparti, V; Stutzmann, J.-S; Symons, T J.M; Tarazona Martinez, A; Tarini, L; Thomen, R; Timmins, A; van Leeuwen, M; Vieira, R; Viticchie, A; Voloshin, S; Wang, D; Wang, Y; Ward, R M
2010-01-01
The performance of prototypes for the ALICE electromagnetic sampling calorimeter has been studied in test beam measurements at FNAL and CERN. A $4\\times4$ array of final design modules showed an energy resolution of about 11% /$\\sqrt{E(\\mathrm{GeV})}$ $\\oplus$ 1.7 % with a uniformity of the response to electrons of 1% and a good linearity in the energy range from 10 to 100 GeV. The electromagnetic shower position resolution was found to be described by 1.5 mm $\\oplus$ 5.3 mm /$\\sqrt{E \\mathrm{(GeV)}}$. For an electron identification efficiency of 90% a hadron rejection factor of $>600$ was obtained.
arXiv The MuPix System-on-Chip for the Mu3e Experiment
Augustin, Heiko
2017-02-11
Mu3e is a novel experiment searching for charged lepton flavor violation in the rare decay $\\mu^+ \\rightarrow e^+e^-e^+$. Decay vertex position, decay time and particle momenta have to be precisely measured in order to reject both accidental and physics background. A silicon pixel tracker based on $50\\,\\mu$m thin high voltage monolithic active pixel sensors (HV-MAPS) in a 1 T solenoidal magnetic field provides precise vertex and momentum information. The MuPix chip combines pixel sensor cells with integrated analog electronics and a periphery with a complete digital readout. The MuPix7 is the first HV-MAPS prototype implementing all functionalities of the final sensor including a readout state machine and high speed serialization with 1.25 Gbit/s data output, allowing for a streaming readout in parallel to the data taking. The observed efficiency of the MuPix7 chip including the full readout system is $\\geq99\\%$ in a high rate test beam.
Directory of Open Access Journals (Sweden)
Valdinéa Sonia Petinari
2009-01-01
Full Text Available Objetivo: Relatar uma experiência de atuação em Unidade Informacional inserida em um Hospital Universitário, que visa disponibilizar informações, em quaisquer suportes, com foco centrado nas necessidades informacionais voltada para os profissionais da área de saúde. Resultado: Existe uma demanda de acesso rápido a informação e orientação dos profissionais da área de saúde por profissionais da área de informação. Conclusão: Ao relatar esta experiência de atuação em uma Unidade Informacional inserida em Hospital Universitário, pode-se entender que a sua existência propicia o rápido acesso a informação e que há demanda.
Directory of Open Access Journals (Sweden)
Adriana Nogueira Accioly NÓBREGA
Full Text Available RESUMO Este artigo tem por objetivo analisar relatos de experiência produzidos espontaneamente por crianças e jovens adolescentes em sala de aula de língua inglesa. Inserido na área de Linguística Aplicada, o estudo está fundamentado na perspectiva teórica sociocultural (VYGOTSKY, 1998, 2001, segundo a qual a linguagem é uma ferramenta mediadora na socioconstrução de conhecimentos, em interface com uma visão de linguagem orientada para o uso e a serviço de propósitos sociocomunicativos, como proposto pela Linguística Sistêmico-Funcional (HALLIDAY; HASAN, 1989. Nessa arquitetura teórica e com base em uma tradição qualitativa de pesquisa (DENZIN; LINCOLN, 2006, discutimos como os relatos analisados atuam na socioconstrução do conhecimento pedagógico a partir da experiência pessoal, tornando os saberes significativos e compartilhados em sala de aula. Além disso, sugerimos que a experiência de mundo colabora para a construção do conhecimento curricular e esse, em retorno, serve como suporte para a construção da experiência particular do estudante, conforme proposto por Nóbrega (2003, 2009.
Barbosa, Rita Cristiana
2015-01-01
As experi?ncias de Educa??o ? Dist?ncia (EaD) desenvolvidas no Brasil t?m como objetivo principal formar professores(as) que atuam no magist?rio sem a forma??o superior e tamb?m atingir a grande demanda de pessoas que n?o t?m acesso ? educa??o superior, situa??o agravada em lugares distantes dos grandes centros e nos Estados mais pobres do pa?s. Assim, os cursos EaD de forma??o docente contam com alunado composto majoritariamente por mulheres trabalhadoras com mais de 30 anos. Dentre as vanta...
A Experiência Do Tempo No Sagrado E No Profano À Luz Da Interpretação De Mircea Eliade
Directory of Open Access Journals (Sweden)
Rodrigo Danubio Queiroz
2014-10-01
Full Text Available O presente trabalho se propõe a analisar e descrever a experiência humana do tempo no sagrado e no profano a partir do pensamento do filósofo e historiador Mircea Eliade. A pesquisa tem como ponto de partida a constatação da dualidade sagrado/profano que resulta na afirmação de dois modos de ser no mundo, a saber, religioso e não-religioso. Dessa forma, objetivamos analisar a dimensão da temporalidade heterogênea na vida do homem religioso e a-religioso. Entretanto, a compreensão desta experiência só pode ser estabelecida quando se percebe a importância das construções de templos, das festas religiosas, dos rituais e do mito que se apresentam como uma linguagem do sagrado que só ganha sentido devido à inomogeneidade do tempo.
JASMIN: Japanese-American study of muon interactions and neutron detection
Energy Technology Data Exchange (ETDEWEB)
Nakashima, Hiroshi; /JAEA, Ibaraki; Mokhov, N.V.; /Fermilab; Kasugai, Yoshimi; Matsuda, Norihiro; Iwamoto, Yosuke; Sakamoto, Yukio; /JAEA, Ibaraki; Leveling, Anthony F.; Boehnlein, David J.; Vaziri, Kamran; /Fermilab; Matsumura, Hiroshi; Hagiwara, Masayuki; /KEK, Tsukuba /Tohoku U. /Shimizu, Tokyo /Kyushu U. /Kyoto U. /Tsukuba U. /Pohang Accelerator Lab. /Tokai, ROIST
2010-08-01
Experimental studies of shielding and radiation effects at Fermi National Accelerator Laboratory (FNAL) have been carried out under collaboration between FNAL and Japan, aiming at benchmarking of simulation codes and study of irradiation effects for upgrade and design of new high-energy accelerator facilities. The purposes of this collaboration are (1) acquisition of shielding data in a proton beam energy domain above 100GeV; (2) further evaluation of predictive accuracy of the PHITS and MARS codes; (3) modification of physics models and data in these codes if needed; (4) establishment of irradiation field for radiation effect tests; and (5) development of a code module for improved description of radiation effects. A series of experiments has been performed at the Pbar target station and NuMI facility, using irradiation of targets with 120 GeV protons for antiproton and neutrino production, as well as the M-test beam line (M-test) for measuring nuclear data and detector responses. Various nuclear and shielding data have been measured by activation methods with chemical separation techniques as well as by other detectors such as a Bonner ball counter. Analyses with the experimental data are in progress for benchmarking the PHITS and MARS15 codes. In this presentation recent activities and results are reviewed.
An e-Learning System with MR for Experiments Involving Circuit Construction to Control a Robot
Takemura, Atsushi
2016-01-01
This paper proposes a novel e-Learning system for technological experiments involving electronic circuit-construction and controlling robot motion that are necessary in the field of technology. The proposed system performs automated recognition of circuit images transmitted from individual learners and automatically supplies the learner with…
Current results for μ→e+γ decay search with the MEGA experiment
International Nuclear Information System (INIS)
Zhang, Y.
1993-01-01
The MEGA experiment at LAMPF is designed to search for the rare decay μ → e+γ with a branching ratio sensitivity of 4x10 -13 . The detector consists of an electron spectrometer (a set of low-mass MPWCs and two barrels of scintillators) and a photon arm (three-layer pair spectrometer) in a 1.5-T solenoidal magnetic field. The experimental design maximizes rate capability, retains large solid angle, and suppresses the background to below the experimental sensitivity. In the summer of 1992, the MEGA collaboration successfully finished whole-system tests and got 163.6 million μ→E+γ candidate events by using the electron arm and two of the three photon pair spectrometers. The status of the data analysis will be described
Proceedings of Summer Institute on particle physics: Lepton-Hadron scattering
International Nuclear Information System (INIS)
Hawthorne, J.
1992-09-01
The nineteenth annual SLAC Summer Institute on Particle Physics took place from August 5 to 16, 1991, attracting 236 participants from 10 different countries. The theme was lepton-hadron scattering, the subjects ranging from the pioneering SLAC-MIT experiments, through the new era of e-p collisions to be ushered in by HERA. Richard Taylor led off the Institute with a historical review of lepton-proton scattering experiments, from Rutherford to the 1960s, while Sid Drell laid out the theoretical framework, in terms of parton distributions and sum rules. Frank Sciulli picked up where Richard Taylor left off, at the discovery of scaling violation, and brought us up to the present. Joel Feltesse and Roberto Peccei described the physics opportunities at HERA, most notably the investigation of the low x behavior of structure functions. Traudl Hansl-Kozanecka reviewed the current experimental status of QCD, at e + e - and hadron colliders as well as in deep-inelastic lepton-hadron scattering. Bob Hollebeek lectured on techniques for electromagnetic and hadronic calorimetry. Finally, Bob Siemann gave a series of lectures on the many uses of superconductivity in particle accelerators, from bending magnets at FNAL HERA and the SSC to RF cavities at CEBAF and LEP. Following the school, the topical conference provided us with a spectrum of current experimental and theoretical developments. Lepton-hadron scattering experiments at CERN and Fermilab were well represented. The existence of the 17 0 , keV neutrino was debated in two separate talks. We heard the latest results from the CDF and UA2 hadron collider experiments; from the four LEP experiments; and from ARGUS and CLEO. Also presented were overviews of the rare K decay program at BNL, the CP violation experiments at CERN and Fermilab, B physics, neutrino masses and mixings, and precision electroweak theory
Utilização de experiências musicais como terapia para sintomas de náusea e vômito em quimioterapia
Directory of Open Access Journals (Sweden)
Gabriela Jorge Silva
2014-07-01
Full Text Available Objetivou-se aplicar as experiências musicais para avaliação dos efeitos terapêuticos em náuseas e vômitos associados à quimioterapia antineoplásica e identificar alterações nos parâmetros vitais dos pacientes que participaram da experiência. Estudo descritivo, transversal, nível II, de abordagem quantitativa, realizado com treze pacientes de um ambulatório de quimioterapia de um hospital particular no município de São Paulo. Foram utilizados dois instrumentos, sendo um deles proposto pela MASCC (Multinational Association on Supportive Care in Cancer. A maior parte da amostra foi composta por pacientes do sexo feminino, com idade entre 40 a 60 anos, casadas e com câncer de mama. Reduziu-se a frequência cardíaca em 77% da amostra; a náusea diminuiu em 100% dos pacientes após a primeira experiência musical, e em 85% após a segunda. Concluiuse ter havido houve redução estatisticamente significativa dos sintomas de náusea e vômito após as experiências musicais.
Utilização de experiências musicais como terapia para sintomas de náusea e vômito em quimioterapia
Directory of Open Access Journals (Sweden)
Gabriela Jorge Silva
Full Text Available Objetivou-se aplicar as experiências musicais para avaliação dos efeitos terapêuticos em náuseas e vômitos associados à quimioterapia antineoplásica e identificar alterações nos parâmetros vitais dos pacientes que participaram da experiência. Estudo descritivo, transversal, nível II, de abordagem quantitativa, realizado com treze pacientes de um ambulatório de quimioterapia de um hospital particular no município de São Paulo. Foram utilizados dois instrumentos, sendo um deles proposto pela MASCC (Multinational Association on Supportive Care in Cancer. A maior parte da amostra foi composta por pacientes do sexo feminino, com idade entre 40 a 60 anos, casadas e com câncer de mama. Reduziu-se a frequência cardíaca em 77% da amostra; a náusea diminuiu em 100% dos pacientes após a primeira experiência musical, e em 85% após a segunda. Concluiuse ter havido houve redução estatisticamente significativa dos sintomas de náusea e vômito após as experiências musicais.
c, b, and tau lifetime measurements in e+e- interactions
International Nuclear Information System (INIS)
Jaros, J.A.
1983-01-01
Experiments at e + e - storage rings have successfully measured the tau and D 0 lifetimes and set interesting limits on the B lifetime. So far, the conventional wisdom has prevailed. The tau lifetime is consistent with prediction; there is no sign (but little sensitivity) of a violation of universality. The charmed particle lifetimes are roughly as expected, but richer in their phenomenology than anticipated. The B lifetime is still unknown. The experimental art is developing rapidly. Several experiments have by now installed vertex detectors. Measurements of charmed particle lifetimes from e + e - experiments will complement the work that has been done at fixed target machines. Measurements of tau and B lifetimes may be the exclusive province of e + e - experiments for the next few years
Uma experiência de organização e desenvolvimento curricular com Pedagogia de Projetos
Directory of Open Access Journals (Sweden)
Alana Fuzaro de Barros Rodrigues
2018-05-01
Full Text Available This paper presents the alternate pedagogy of a school located in the interior of the Sao Paulo State (Brazil, as part of the data of a masters’ research. The schools’ framework is based on Project Based Learning and its curriculum is organized on Multiple Intelligences. The framework is also supported by both the Brazilian National Curricular Parameters and the Sao Paulo State Curriculum, regarding school levels. Besides the theoretical issues, there is an exposition of an experience by the mathematics teacher and students of the 6th grade when developing a Project around the theme “From machine to cyborg” that exemplifies the pedagogical proposal of said school. Este artigo apresenta a natureza pedagógica diferenciada de uma escola localizada no interior do Estado de São Paulo (Brasil, como recorte da coleta de dados de uma pesquisa de mestrado em um Programa de Pós-Graduação em Ensino e Processos Formativos. A Escola apresenta como fundamentação teórica a Pedagogia de Projetos e no que diz respeito à matriz curricular, as disciplinas estão divididas de acordo com Inteligências Múltiplas e delineadas pelos Parâmetros Curriculares Nacionais (PCN e documentos oficiais do Estado de São Paulo conforme o nível de ensino. Além dos pressupostos teóricos, há descrição de uma experiência vivenciada pela professora de matemática e por alunos do 6° ano ao desenvolverem um Projeto em torno do tema “De máquina a ciborgue” que exemplifica a proposta pedagógica da referida escola.
Energy and time resolution of a LYSO matrix prototype for the Mu2e experiment
Energy Technology Data Exchange (ETDEWEB)
Atanov, N.; Baranov, V. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Colao, F.; Cordelli, M.; Corradi, G.; Dané, E. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Davydov, Yu.I. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Flood, K. [California Institute of Technology, Pasadena (United States); Giovannella, S., E-mail: simona.giovannella@lnf.infn.it [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Glagolev, V. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Happacher, F. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Hitlin, D.G. [California Institute of Technology, Pasadena (United States); Martini, M. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Università “Guglielmo Marconi”, Roma (Italy); Miscetti, S. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Miyashita, T. [California Institute of Technology, Pasadena (United States); Morescalchi, L. [INFN Sezione di Pisa, Pisa (Italy); Dipartimento di Fisica dell' Università di Siena, Siena (Italy); Ott, P. [Institut für Kernphysik, University of Mainz, Mainz (Germany); Pezzullo, G. [INFN Sezione di Pisa, Pisa (Italy); Dipartimento di Fisica dell' Università di Pisa, Pisa (Italy); Saputi, A.; Sarra, I. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); and others
2016-07-11
We have measured the performances of a LYSO crystal matrix prototype tested with electron and photon beams in the energy range 60–450 MeV. This study has been carried out to determine the achievable energy and time resolutions for the calorimeter of the Mu2e experiment.
Energy and time resolution of a LYSO matrix prototype for the Mu2e experiment
International Nuclear Information System (INIS)
Atanov, N.; Baranov, V.; Colao, F.; Cordelli, M.; Corradi, G.; Dané, E.; Davydov, Yu.I.; Flood, K.; Giovannella, S.; Glagolev, V.; Happacher, F.; Hitlin, D.G.; Martini, M.; Miscetti, S.; Miyashita, T.; Morescalchi, L.; Ott, P.; Pezzullo, G.; Saputi, A.; Sarra, I.
2016-01-01
We have measured the performances of a LYSO crystal matrix prototype tested with electron and photon beams in the energy range 60–450 MeV. This study has been carried out to determine the achievable energy and time resolutions for the calorimeter of the Mu2e experiment.
Khetriwal, Deepali Sinha; Kraeuchi, Philipp; Widmer, Rolf
2009-01-01
E-waste, a relatively recent addition to the waste stream in the form of discarded electronic and electric equipment, is getting increasing attention from policy makers as the quantity being generated is rising rapidly. One of the most promising policy options to address this issue is to extend the producers responsibility for their products beyond the point of sale, until end-of-product-life. This paper briefly introduces the concept of extended producer responsibility (EPR) and its applicability in the area of the end-of-life management of electronic and electrical equipment (EEE). It then examines the decade-long experience of Switzerland in using EPR to manage its e-waste, elaborating on the experience of the Swiss system in overcoming specific issues, and finally wrapping up with a synopsis of the lessons for policy makers. We consider each issue as an enquiry of questions confronting a policy maker and the choices that may present themselves. The five issues discussed are: (i) the challenges in getting an EPR based system started; (ii) securing financing to ensure a self-sustaining and smooth functioning system; (iii) organising a logistics network for the take back and collection of the e-waste; (iv) ensuring compliance of the various actors involved; and finally (v) reducing the threat of monopolistic practices.
Azevedo, Vanessa Mourão Ferreira Sampaio
2017-01-01
Tese de Doutoramento em Psicologia Aplicada Introdução. As experiências de vida são um tema frequente quer na investigação, quer na prática clínica. Contudo, o atual estado da arte apresenta-se bastante fragmentado e polarizado, o que resulta em lacunas significativas. Mais especificamente, as evidências disponíveis limitam-se a um conjunto restrito de experiências, sobretudo aquelas consideradas negativas, e a fases desenvolvimentais específicas (e.g., infância vs. vida adulta...
Fast, microprocessor driven, data acquisition for Fermilab Experiment E-705
International Nuclear Information System (INIS)
Conetti, S.; Haire, M.; Kuchela, K.
1985-01-01
Data rate in excess of 10 5 16-bit CAMAC words/sec, with peak rates of up to 2X10 6 words/sec, are expected from Fermilab experiment E-705. To handle such rate, a fast Data Acquisition System was designed, composed of several CAMAC Smart Controllers, sending their data, in a combined serial/parallel organization, to a VME based data collection and forwarding system. Such a system, contained in a VME Crate, consists of homebuilt data receiver and transmitter boards, a Motorola VME-110, 68000 based, Single Board Computer acting as a supervisor, and a large (greater than or equal to4 Mbytes) buffer memory. Data filtering capabilities will be added to the system with the inclusion of several MK 75602 Single Board Computers, acting as processing cells
Directory of Open Access Journals (Sweden)
Matjaž Eržen
2007-01-01
Full Text Available E-books are an essential part of the digitized material, which is available to the users of academic libraries. Compared to e-journals, which have already been embraced by the users, e-books do not meet the publishers’ expected usage level. The article also describes Central Technical Library’s experience with different suppliers and different e-books business models; and highlights the results of the one-year usage of NetLibrary e-books, which are accessible to the users of the University of Ljubljana. The usage results, comparisons and experiences imply some possible reasons and indicate some solutions that may result in a better usage of that material.