On-board attitude determination for the Explorer Platform satellite

Science.gov (United States)

Jayaraman, C.; Class, B.

1992-01-01

This paper describes the attitude determination algorithm for the Explorer Platform satellite. The algorithm, which is baselined on the Landsat code, is a six-element linear quadratic state estimation processor, in the form of a Kalman filter augmented by an adaptive filter process. Improvements to the original Landsat algorithm were required to meet mission pointing requirements. These consisted of a more efficient sensor processing algorithm and the addition of an adaptive filter which acts as a check on the Kalman filter during satellite slew maneuvers. A 1750A processor will be flown on board the satellite for the first time as a coprocessor (COP) in addition to the NASA Standard Spacecraft Computer. The attitude determination algorithm, which will be resident in the COP's memory, will make full use of its improved processing capabilities to meet mission requirements. Additional benefits were gained by writing the attitude determination code in Ada.

Prevention of Crevice Corrosion of STS 304 Stainless Steel by a Mg-alloy Galvanic Anode

International Nuclear Information System (INIS)

Lim, U. J.; Yun, B. D.; Kim, J. J.

2006-01-01

Prevention of crevice corrosion was studied for STS 304 stainless steel using a Mg-alloy galvanic anode in solutions with various specific resistivity. The crevice corrosion and corrosion protection characteristics of the steel was investigated by the electrochemical polarization and galvanic corrosion tests. Experimental results show that the crevice corrosion of STS 304 stainless steel does not occur in solutions of high specific resistivity, but it occurs in solutions of low specific resistivity like in solutions with resistivities of 30, 60 and 115 Ω · m. With decreasing specific resistivity of the solution, the electrode potential of STS 304 stainless steel in the crevice is lowered. The potential of STS 304 stainless steel in the crevice after coupling is cathodically polarized more by decreasing specific resistivity indicating that the crevice corrosion of STS 304 stainless steel is prevented by the Mg-alloy galvanic anode

19 CFR 115.14 - Meeting on program.

Science.gov (United States)

2010-04-01

... Administration § 115.14 Meeting on program. If determined necessary by Customs, each Certifying Authority's... 19 Customs Duties 1 2010-04-01 2010-04-01 false Meeting on program. 115.14 Section 115.14 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY...

Effect of STS space suit on astronaut dominant upper limb EVA work performance

Science.gov (United States)

Greenisen, Michael C.

1987-01-01

The STS Space Suited and unsuited dominant upper limb performance was evaluated in order to quantify future EVA astronaut skeletal muscle upper limb performance expectations. Testing was performed with subjects standing in EVA STS foot restraints. Data was collected with a CYBEX Dynamometer enclosed in a waterproof container. Control data was taken in one g. During one g testing, weight of the Space Suit was relieved from the subject via an overhead crane with a special connection to the PLSS of the suit. Experimental data was acquired during simulated zero g, accomplished by neutral buoyancy in the Weightless Environment Training Facility. Unsuited subjects became neutrally buoyant via SCUBA BC vests. Actual zero g experimental data was collected during parabolic arc flights on board NASA's modified KC-135 aircraft. During all test conditions, subjects performed five EVA work tasks requiring dominant upper limb performance and ten individual joint articulation movements. Dynamometer velocities for each tested movement were 0 deg/sec, 30 or 60 deg/sec and 120 or 180 deg/sec, depending on the test, with three repetitions per test. Performance was measured in foot pounds of torque.

Genetic and Proteomics Analyses of Space Flown Mice Skin

Science.gov (United States)

Terada, Masahiro; Takahashi, Rika; Yamada, Shin; Masaya, Seki; Higashibata, Akira; Majima, Hideyuki J.; Ohira, Yoshinobu; Mukai, Chiaki; Ishioka, Noriaki

2013-02-01

Many astronauts stay in the International Space Station (ISS) for a long period of time. Therefore, the development of astronaut health care technologies is very important. Especially, an understanding of the effects of the space environment, such as microgravity and radiation, on protein, gene, and mineral metabolism is important for developing countermeasures against the adverse effects experienced by astronauts who are in space for long periods of time. Since December 2009, the Japan Aerospace Exploration Agency (JAXA) has initiated a human research study to investigate the effects of long-term space flight on gene expression and mineral metabolism by analyzing hair samples from ISS crew members who have been in space (experiment nicknamed “HAIR”). As animal control experiments, we could have an opportunity to analyze rodents samples by participating the tissue sharing program of space-flown mice organized by Italian Space Agency (AGI) and National Aeronautics and Space Administration (NASA). It will reasonably complement human hair experiment because we able to conduct more detailed skin analysis which is enable in human experiment. The purpose of this flown-mice experiment is to study the effects of long-term exposure to space environment. In this experiment, we analyzed mice skin contained hair roots. The samples were taken from space-flown (3-month and 2-week) and 3-month hindlimb suspensioned and 3-month 2G exposed mice, and ground-control mice. For the skin contained hair roots, the extracted and amplified RNA was used to DNA microarray analysis, and was further analyzed with expression on the interesting genes by real time Reverse Transcription Polymerase Chain Reaction (RT-PCR) method. And the extracted protein was used to Mass Spectrometer analysis. Data analysis on the specimen are in progress.

A densitometric analysis of IIaO film flown aboard the space shuttle transportation system STS #3, 7, and 8

Science.gov (United States)

Hammond, Ernest C., Jr.

1989-01-01

Since the United States of America is moving into an age of reusable space vehicles, both electronic and photographic materials will continue to be an integral part of the recording techniques available. Film as a scientifically viable recording technique in astronomy is well documented. There is a real need to expose various types of films to the Shuttle environment. Thus, the main objective was to look at the subtle densitometric changes of canisters of IIaO film that was placed aboard the Space Shuttle 3 (STS-3).

STS-93 Commander Collins poses in front of Columbia

Science.gov (United States)

1999-01-01

STS-93 Commander Eileen Collins poses in front of the Space Shuttle orbiter Columbia following her textbook landing on runway 33 at the Shuttle Landing Facility. Main gear touchdown occurred at 11:20:35 p.m. EDT on July 27. On this mission, Collins became the first woman to serve as a Shuttle commander. Also on board were her fellow STS-93 crew members: Pilot Jeffrey S. Ashby and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). The mission's primary objective was to deploy the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. This was the 95th flight in the Space Shuttle program and the 26th for Columbia. The landing was the 19th consecutive Shuttle landing in Florida and the 12th night landing in Shuttle program history.

Op. No A4495 Columbia, STS-93 Chandra - Breakfast, Suiting, and Walkout

Science.gov (United States)

1999-01-01

The primary objective of the STS-93 mission was to deploy the Advanced X-ray Astrophysical Facility, which had been renamed the Chandra X-ray Observatory in honor of the late Indian-American Nobel Laureate Subrahmanyan Chandrasekhar. The mission was launched at 12:31 on July 23, 1999 onboard the space shuttle Columbia. The mission was led by Commander Eileen Collins. The crew was Pilot Jeff Ashby and Mission Specialists Cady Coleman, Steve Hawley and Michel Tognini from the Centre National d'Etudes Spatiales (CNES). This videotape shows the astronauts after breakfast getting into spacesuits, walking out to board the bus, and boarding the bus prior to launch.

Thai primary students' understanding of nature of science (NOS) in learning about force and motion for explicit NOS through STS approach

Science.gov (United States)

Jimakorn, Narakorn; Yuenyong, Chokchai

2018-01-01

This paper aimed to study of primary school students' understanding of nature of science in learning about force and motion for Explicit Nature of Science through science technology and society (STS) approach. Participants were 11 Grade 5 students who study in Baan Khongtaphet, Bothong, Chonburi, Thailand. This research regarded interpretive paradigm. The intervention of STS physics provided 4 weeks of teaching about force and motion through Yuenyong (2006) science technology and society (STS) approach. The issues of making skate board was brought into the class in order to enhance students learning about force and motion and applying knowledge for designing skate board. The intervention was also designed to allow students explicitly mentioning their ideas about nature of science related to learning activities of STS force and motion. Students' understanding of nature of science was interpreted through students' worksheets, participant observation, students' journal writing and informal interview. The findings revealed that majority of students could reflect their ideas related to many aspects of nature of science. This included Science demands and relies on empirical evidence; knowledge production in science shares many common factors and shared habits of mind, norms, logical thinking and methods; tentative of scientific knowledge; historical, cultural and social influences on science; historical, cultural and social influences on science; science and its methods cannot answer all questions. The study has implications for NOS teaching in Thailand primary school.

Design and "As Flown" Radiation Environments for Materials in Low Earth Orbit

Science.gov (United States)

Minow, Joseph; McWilliams, Brett; Altstatt, Richard; Koontz, Steven

2006-01-01

A conservative design approach was adopted by the International Space Station Program for specifying total ionizing radiation dose requirements for use in selecting and qualifying materials for construction of the International Space Station. The total ionizing dose design environment included in SSP 30512 Space Station Ionizing Radiation Design Environment is based on trapped proton and electron fluence derived from the solar maximum versions of the AE-8 and AP-8 models, respectively, specified for a circular orbit at 500 km altitude and 51.7 degree inclination. Since launch, the range of altitudes utilized for Space Station operations vary from a minimum of approximately 330 km to a maximum of approximately 405 km with a mean operational altitude less than 400 km. The design environment, therefore, overestimates the radiation environment because the particle flux in the South Atlantic Anomaly is the primary contributor to radiation dose in low Earth orbit and flux within the Anomaly is altitude dependent. In addition, a 2X multiplier is often applied to the design environment to cover effects from the contributions of galactic cosmic rays, solar energetic particle events, geomagnetic storms, and uncertainties in the trapped radiation models which are not explicitly included in the design environment. Application of this environment may give radiation dose overestimates on the order of 1OX to 30X for materials exposed to the space environment, suggesting that materials originally qualified for ten year exposures on orbit may be used for longer periods without replacement. In this paper we evaluate the "as flown" radiation environments derived from historical records of the ISS flight trajectory since launch and compare the results with the SSP 30512 design environment to document the magnitude of the radiation dose overestimate provided by the design environment. "As flown" environments are obtained from application of the AE-8/AP-8 trapped particle models along

Evaluation of STS 430 and STS 444 for SOFC Interconnect Applications

International Nuclear Information System (INIS)

Kim, S. H.; Huh, J. Y.; Jun, J. H.; Kim, D. H.; Jun, J. H.

2007-01-01

Ferritic stainless steels for the SOFC interconnect applications are required to possess not only a good oxidation resistance, but also a high electrical conductivity of te oxide scale that forms during exposure at the SOFC operating environment. In order to understand the effects of alloying elements on the oxidation behavior of ferritic stainless steels and on the electrical properties of oxide scales, two kinds of commercial ferritic stainless steels, STS 430 and STS 444, were investigated by performing isothermal oxidations at 800 .deg. C in a wet air containing 3% H 2 O. The results showed that STS 444 was superior to STS 430 in both of the oxidation resistance and the area specific resistance. Although STS 444 contained a less amount of Mn for the (Mn, Cr) 3 O 4 spinel formation than STS 430, the minor alloying elements of Al and Mo in STS 444, which were accumulated in the base metal region adjacent the scale, were suggested to reduce the scale growth rate and to enhance the scale adherence to the base metal

Mutations in cauliflower and sprout broccoli grown from seeds flown in space

Science.gov (United States)

Wu, Hong; Huang, Congli; Zhang, Keping; Sun, Yeqing

2010-11-01

Cauliflower and sprout broccoli are widely planted vegetables particularly in Fujian Province, China. To study the mutation in these two types of vegetables induced from spaceflight, we flew the seeds on the 20th Chinese recoverable satellite which orbited the Earth for 18 days. After returning to the Earth, the cauliflower seeds were planted for two generations and the sprout broccoli seeds for one generation at the Xiamen Agriculture Research Institute. Of the 12 cauliflowers planted for the first generation, two showed significant phenotypical changes in both the size of the plant and the weight of the flower head. In addition, most of the space flown plants were found to be resistant to the black rot attack in the field. Cauliflowers planted for the second generation from the seeds in one of the two plants that displayed phenotypical changes in the first generation showed similar mutations. For the first generation of sprout broccoli, the rate of emergence from the flown seeds was lower than that of the control by 30%. No significant changes in the phenotype between the sprout broccolis planted from the flown seeds and the control were observed except one of the mutated sprout broccolis showed a change in the appearance in the lesser bud of the chief flower head. Results of the study demonstrated that DNA damages in some of the genes may have occurred in the seeds flown in space, and some of the changes in the genes may have inherited from the first to the second generation. The improved resistance to the black rot attack and increased size of the flower head are apparently beneficial.

Hematological measurements in rats flown on Spacelab shuttle SL-3

International Nuclear Information System (INIS)

Lange, R.D.; Andrews, R.B.; Gibson, L.A.; Congdon, C.C.; Wright, P.; Dunn, C.D.R.; Jones, J.B.

1987-01-01

Previous studies have shown that a decrease in red cell mass occurs in astronauts, and some studies indicate a leukocytosis occurs. A life science module housing young and mature rats was flown on shuttle mission Spacelab 3 (SL-3), and the results of hematology studies of flight and control rats are presented. Statistically significant increases in the hematocrit, red blood cell counts, and hemoglobin determinations, together with a mild neutrophilia and lymphopenia, were found in flight animals. No significant changes were found in bone marrow and spleen cell differentials or erythropoietin determinations. Clonal assays demonstrated an increased erythroid colony formation of flight animal bone marrow cells at erythropoietin doses of 0.02 and 1.0 U/ml but not 0.20 U/ml. These results agree with some but vary from other previously published studies. Erythropoietin assays performed by radioimmunoassay and clonal studies were performed for the first time

Equivalent dose measurements on board an Armenian Airline flight and Concord (9-17 km)

International Nuclear Information System (INIS)

Akopova, A.B.; Melkonyan, A.A.; Tatikyan, S.Sh.; Capdevielle, J-N.

2002-01-01

The results of investigations of the neutron component (E=1-10 MeV) of cosmic radiation on board the 'Armenian Airlines' aircrafts using nuclear photoemulsion are presented. The emulsions were exposed on the flights from Yerevan to Moscow, St.-Petersburg, Beirut, Athens, Frankfurt, Amsterdam, Paris and Sofia, and on Concord supersonic flights from Paris to New York. The dependence of the neutron fluxes, and on absorbed and equivalent doses on the flight parameters were investigated. On the flights of the supersonic Concord, with an altitude of 17 km, the neutron fluxes were essentially higher in comparison to those measured on Armenian airliners. It is interesting to note, that the neutron flux and equivalent dose rate decrease with altitude up to 470 km in space, for example, on board the STS-57. The shape of the differential energy spectrum for fast neutrons is the same on all Armenian airlines flights, but significantly different at 17 km altitude, where the flux in the energy region above 3 MeV is increasing

Equivalent dose measurements on board an Armenian Airline flight and Concord (9-17 km)

Energy Technology Data Exchange (ETDEWEB)

Akopova, A.B. E-mail: akopova@lx2.yerphi.am; Melkonyan, A.A.; Tatikyan, S.Sh.; Capdevielle, J-N

2002-12-01

The results of investigations of the neutron component (E=1-10 MeV) of cosmic radiation on board the 'Armenian Airlines' aircrafts using nuclear photoemulsion are presented. The emulsions were exposed on the flights from Yerevan to Moscow, St.-Petersburg, Beirut, Athens, Frankfurt, Amsterdam, Paris and Sofia, and on Concord supersonic flights from Paris to New York. The dependence of the neutron fluxes, and on absorbed and equivalent doses on the flight parameters were investigated. On the flights of the supersonic Concord, with an altitude of 17 km, the neutron fluxes were essentially higher in comparison to those measured on Armenian airliners. It is interesting to note, that the neutron flux and equivalent dose rate decrease with altitude up to 470 km in space, for example, on board the STS-57. The shape of the differential energy spectrum for fast neutrons is the same on all Armenian airlines flights, but significantly different at 17 km altitude, where the flux in the energy region above 3 MeV is increasing.

The Problem: Low-Achieving Districts and Low-Performing Boards

Directory of Open Access Journals (Sweden)

David E. Lee

2014-10-01

Full Text Available Effective school districts maintain superintendent and school board collegiality which can foster success and connectedness among members. Delagardelle and Alsbury (2008 found that superintendents and board members are not consistent in their perceptions about the work the board does, and Glass (2007 found that states do not require boards to undergo evaluation for effectiveness. In the current study, 115 board meetings were observed using the School Board Video Project (SBVP survey, which was created in 2012 by researchers to uncover school board meetings’ effectiveness. MANOVA, Univariate ANOVA, and Pearson Chi-Square test results revealed significant differences between low-, medium-, and high-performing districts’ school board meetings. Evidence indicated that low-performing districts’ board meetings were: less orderly; had less time spent on student achievement; lacked respectful and attentive engagement across speakers; had board meeting members who seemed to advance their own agenda; had less effective working relationships among the governance team; had fewer board members who relied on the superintendent for advice and input; had one member, other than the board president, stand out for taking excessive time during meetings; and did not focus on policy items as much as high- and medium-performing school districts. The research concluded that more school board members from low-performing districts needed training to improve their effectiveness. Furthermore, highly refined and target-enhanced school board training programs might lead to lasting governance success and more effective teaming that could improve district, and ultimately, student achievement.

Governing Board of the Pension Fund

CERN Multimedia

2007-01-01

The Governing Board of the Pension Fund held its penultimate (158th) and final (159th) meetings in its current form on 24 September and 25 October 2007 respectively. A number of items, notably the triennial actuarial review and the Fund's Budget for 2008, appeared on the agenda of both meetings. The Governing Board took note of the Fund's financial position as at 30 June 2007 on the basis of the intermediate closing of the accounts on that date. In the first half of 2007, the Fund had achieved a satisfactory return on its assets compared with the position on 1 January 2007. Regarding the indexation of pensions, at the second of its two meetings, the Governing Board took note of the inflation rate in Geneva between August 2006 and August 2007 - no rise was observed in the cost-of-living during the period under consideration. As a consequence, the adjustment rate for the forthcoming three-year period, calculated by the Actuary pursuant to Article II 1.15 – Anne...

Governing Board of the Pension Fund

CERN Multimedia

HR Department

2007-01-01

The Governing Board of the Pension Fund held its penultimate (158th) and final (159th) meetings in its current form on 24 September and 25 October 2007 respectively. A number of items, notably the triennial actuarial review and the Fund’s Budget for 2008, appeared on the agenda of both meetings. The Governing Board took note of the Fund’s financial position as at 30 June 2007 on the basis of the intermediate closing of the accounts on that date. In the first half of 2007, the Fund had achieved a satisfactory return on its assets compared with the position on 1 January 2007. Regarding the indexation of pensions, at the second of its two meetings, the Governing Board took note of the inflation rate in Geneva between August 2006 and August 2007 - no rise was observed in the cost-of-living during the period under consideration. As a consequence, the adjustment rate for the forthcoming three-year period, calculated by the Actuary pursuant to Article II 1.15 – Annex C of the...

Radiation environment measurements with the cosmic ray experiments on-board the KITSAT-1 and PoSAT-1 micro-satellites

International Nuclear Information System (INIS)

Underwood, C.I.; Brock, D.J.; Williams, P.S.; Kim, S.; Dilao, R.; Santos, P.R.; Brito, M.C.; Dyer, C.S.; Sims, A.J.

1994-01-01

The success of the Cosmic Radiation Environment and Dosimetry (CREDO) experiment carried on-board the UoSAT-3 micro-satellite (launched in 1990) has lead to the development of a new instrument called the Cosmic-Ray Experiment (CRE) which has flown on-board the KITSAT-1 and PoSAT-1 micro-satellites, launched in 1992 and 1993 respectively. The results from both CRE instruments show excellent agreement with those of CREDO for the galactic cosmic-ray environment. However, there are some differences in the CRE and CREDO response to the trapped proton environment of the South Atlantic Anomaly which can be explained by the differences in the detector response time. The fit between the flight results and predictions from the standard models is generally good, but some differences are noted. The CRE and CREDO instruments should provide continuous coverage of the near-Earth radiation environment across a complete solar cycle. This is important in view of the dynamic nature of the radiation environment - as amply demonstrated by the results from the CRRES spacecraft

Separation of sup(115m)In from mother 115Cd

International Nuclear Information System (INIS)

Kersulis, V.J.

1979-01-01

The methods of the accelerated isolation of the metallic sup(115m)In from the mother solution of 115 Cd were worked out. The sample was dissolved in the concentrated HCl with the presence of H 2 O 2 . After the injection of 5 mg (recalculated for the metallic In) of the carrier, the solution was evaporated dry, the remainder was dissolved in 2n HCl. The obtained solution was lead through an ion-exchange column (9 mm in diameter and with the 250 mm height of the layer with the anionite Dowex 2x8 (50-100 mesh). The sup(115m)In was eluated by 0.15n HCl, and 115 Cd - by 1.5n HCl. Radiochemical purity of the sup(115m)In was not less than 99.99%. The isolation of the sup(115m)In from the eluent (alkalined up to ph=2.3) was carried out electrochemically during approximately 1 hour on the platinum cathode at high (400 mA/cm 2 ) cathode density of current

Flight Testing of the Forward Osmosis Bag for Water Recovery on STS-135

Science.gov (United States)

Roberts, Michael S.; Soler, Monica; Mortenson, Todd; McCoy, LaShelle; Woodward, Spencer; Levine, Howard G.

2011-01-01

The Forward Osmosis Bag (FOB) is a personal water purification device for recovery of potable liquid from almost any non-potable water source. The FOB experiment was flown as a sortie mission on STS-135/ULF7 using flight-certified materials and a design based on the X-Pack(TradeMark) from Hydration Technology Innovations (Albany, OR). The primary objective was to validate the technology for use under microgravity conditions. The FOB utilizes a difference in solute concentration across a selectively permeable membrane to draw water molecules from the non-potable water while rejecting most chemical and all microbial contaminants contained within. Six FOB devices were tested on STS-135 for their ability to produce a potable liquid permeate from a feed solution containing 500 mL potassium chloride (15 g/L) amended with 0.1% methyl blue dye (w:v) tracer against an osmotic gradient created by addition of 60 mL of concentrate containing the osmolytes fructose and glucose, and 0.01% sodium fluorescein (w:v) tracer. Three FOB devices were physically mixed by hand for 2 minutes by a crewmember after loading to augment membrane wetting for comparison with three unmixed FOB devices. Hydraulic flux rate and rejection of salt and dye in microgravity were determined from a 60-mL sample collected by the crew on orbit after 6 hours. Post-flight analysis of samples collected on orbit demonstrated that the Forward Osmosis Bag achieved expected design specifications in microgravity. The hydraulic flux rate of water across the membrane was reduced approximately 50% in microgravity relative to ground controls that generated an average of 50 mL per hour using the same water and osmolyte solutions. The membrane rejected both potassium and chloride at >92% and methyl blue dye at >99.9%. Physical mixing of the FOB during water recovery did not have any significant effect on either flux rate or rejection of solutes from the water solution. The absence of buoyancy-driven convection in

Corporate sponsored education initiatives on board the ISS

Science.gov (United States)

Durham, Ian T.; Durham, Alyson S.; Pawelczyk, James A.; Brod, Lawrence B.; Durham, Thomas F.

1999-01-01

This paper proposes the creation of a corporate sponsored ``Lecture from Space'' program on board the International Space Station (ISS) with funding coming from a host of new technology and marketing spin-offs. This program would meld existing education initiatives in NASA with new corporate marketing techniques. Astronauts in residence on board the ISS would conduct short ten to fifteen minute live presentations and/or conduct interactive discussions carried out by a teacher in the classroom. This concept is similar to a program already carried out during the Neurolab mission on Shuttle flight STS-90. Building on that concept, the interactive simulcasts would be broadcast over the Internet and linked directly to computers and televisions in classrooms worldwide. In addition to the live broadcasts, educational programs and demonstrations can be recorded in space, and marketed and sold for inclusion in television programs, computer software, and other forms of media. Programs can be distributed directly into classrooms as an additional presentation supplement, as well as over the Internet or through cable and broadcast television, similar to the Canadian Discovery Channel's broadcasts of the Neurolab mission. Successful marketing and advertisement can eventually lead to the creation of an entirely new, privately run cottage industry involving the distribution and sale of educationally related material associated with the ISS that would have the potential to become truly global in scope. By targeting areas of expertise and research interest in microgravity, a large curriculum could be developed using space exploration as a unifying theme. Expansion of this concept could enhance objectives already initiated through the International Space University to include elementary and secondary school students. The ultimate goal would be to stimulate interest in space and space related sciences in today's youth through creative educational marketing initiatives while at the

STS-102 Onboard Photograph-The Payload Equipment Restraint System

Science.gov (United States)

2001-01-01

In this Space Shuttle STS-102 mission image, the Payload Equipment Restraint System H-Strap is shown at the left side of the U.S. Laboratory hatch and behind Astronaut James D. Weatherbee, mission specialist. PERS is an integrated modular system of components designed to assist the crew of the International Space Station (ISS) in restraining and carrying necessary payload equipment and tools in a microgravity environment. The Operations Development Group, Flight Projects Directorate at the Marshall Space Flight Center (MSFC), while providing operation support to the ISS Materials Science Research Facility (MSRF), recognized the need for an on-orbit restraint system to facilitate control of lose objects, payloads, and tools. The PERS is the offspring of that need and it helps the ISS crew manage tools and rack components that would otherwise float away in the near-zero gravity environment aboard the Space Station. The system combines Kevlar straps, mesh pockets, Velcro and a variety of cornecting devices into a portable, adjustable system. The system includes the Single Strap, the H-Strap, the Belly Pack, the Laptop Restraint Belt, and the Tool Page Case. The Single Strap and the H-Strap were flown on this mission. The PERS concept was developed by industrial design students at Auburn University and the MSFC Flight Projects Directorate.

Changes in pituitary growth hormone cells prepared from rats flown on Spacelab 3

Science.gov (United States)

Grindeland, R.; Hymer, W. C.; Farrington, M.; Fast, T.; Hayes, C.; Motter, K.; Patil, L.; Vasques, M.

1987-01-01

The effect of exposure to microgravity on pituitary gland was investigated by examining cells isolated from anterior pituitaries of rats flown on the 7-day Spacelab 3 mission and, subsequently, cultured for 6 days. Compared with ground controls, flight cells contained more intracellular growth hormone (GH); however, the flight cells released less GH over the 6-day culture period and after implantation into hypophysectomized rats than did the control cells. Compared with control rats, glands from large rats (400 g) contained more somatotrophs (44 percent compared with 37 percent in control rats); small rats (200 g) showed no difference. No major differences were found in the somatotroph ultrastructure (by TEM) or in the pattern of the immunoactive GH variants. However, high-performance liquid chromatography fractionation of culture media indicated that flight cells released much less of a biologically active high-molecular weight GH variant, suggesting that space flight may lead to secretory dysfunction.

Tethered Satellite System Contingency Investigation Board

Science.gov (United States)

1992-11-01

The Tethered Satellite System (TSS-1) was launched aboard the Space Shuttle Atlantis (STS-46) on July 31, 1992. During the attempted on-orbit operations, the Tethered Satellite System failed to deploy successfully beyond 256 meters. The satellite was retrieved successfully and was returned on August 6, 1992. The National Aeronautics and Space Administration (NASA) Associate Administrator for Space Flight formed the Tethered Satellite System (TSS-1) Contingency Investigation Board on August 12, 1992. The TSS-1 Contingency Investigation Board was asked to review the anomalies which occurred, to determine the probable cause, and to recommend corrective measures to prevent recurrence. The board was supported by the TSS Systems Working group as identified in MSFC-TSS-11-90, 'Tethered Satellite System (TSS) Contingency Plan'. The board identified five anomalies for investigation: initial failure to retract the U2 umbilical; initial failure to flyaway; unplanned tether deployment stop at 179 meters; unplanned tether deployment stop at 256 meters; and failure to move tether in either direction at 224 meters. Initial observations of the returned flight hardware revealed evidence of mechanical interference by a bolt with the level wind mechanism travel as well as a helical shaped wrap of tether which indicated that the tether had been unwound from the reel beyond the travel by the level wind mechanism. Examination of the detailed mission events from flight data and mission logs related to the initial failure to flyaway and the failure to move in either direction at 224 meters, together with known preflight concerns regarding slack tether, focused the assessment of these anomalies on the upper tether control mechanism. After the second meeting, the board requested the working group to complete and validate a detailed integrated mission sequence to focus the fault tree analysis on a stuck U2 umbilical, level wind mechanical interference, and slack tether in upper tether

STS-95: Post Landing and Crew Walkaround of the Orbiter at the Shuttle Landing Facility

Science.gov (United States)

1998-01-01

After landing, the STS-95 crew (Commander Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, Pedro Duque, Payload Specialists Chiaki Mukai and the legendary John H. Glenn) descend from the Space Shuttle. Commander Brown congratulates the crew and team photos are taken. The crew does a walkaround inspection of the spacecraft, then boards the bus for departure from the facility.

The impact of the board's strategy-setting role on board-management relations and hospital performance.

Science.gov (United States)

Büchner, Vera Antonia; Schreyögg, Jonas; Schultz, Carsten

2014-01-01

The appropriate governance of hospitals largely depends on effective cooperation between governing boards and hospital management. Governing boards play an important role in strategy-setting as part of their support for hospital management. However, in certain situations, this active strategic role may also generate discord within this relationship. The objective of this study is to investigate the impact of the roles, attributes, and processes of governing boards on hospital performance. We examine the impact of the governing board's strategy-setting role on board-management collaboration quality and on financial performance while also analyzing the interaction effects of board diversity and board activity level. The data are derived from a survey that was sent simultaneously to German hospitals and their associated governing board, combined with objective performance information from annual financial statements and quality reports. We use a structural equation modeling approach to test the model. The results indicate that different board characteristics have a significant impact on hospital performance (R = .37). The strategy-setting role and board-management collaboration quality have a positive effect on hospital performance, whereas the impact of strategy-setting on collaboration quality is negative. We find that the positive effect of strategy-setting on performance increases with decreasing board diversity. When board members have more homogeneous backgrounds and exhibit higher board activity levels, the negative effect of the strategy-setting on collaboration quality also increases. Active strategy-setting by a governing board may generally improve hospital performance. Diverse members of governing boards should be involved in strategy-setting for hospitals. However, high board-management collaboration quality may be compromised if managerial autonomy is too highly restricted. Consequently, hospitals should support board-management collaboration about

Cyclic AMP-receptor proteins in heart muscle of rats flown on Cosmos 1887

Science.gov (United States)

Mednieks, Maija I.; Popova, Irina A.; Grindeland, Richard E.

1991-01-01

The cellular compartmentalization of the cyclic AMP-receptor proteins in heart ventricular tissue obtained from rats flown on the Cosmos 1887 is determined. Photoaffinity labeling of soluble and particular cell fractions with a (32P)-8-azido analog of cyclic AMP is followed by electrophoretic separation of the proteins and by autoradiographic identification of the labeled isoforms of cAPK R subunits. It is shown that RII in the particulate subcellular fraction was significantly decreased in heart cells from rats in the flight group when compared to controls. Protein banding patterns in both the cytoplasmic fraction and in a fraction enriched in chromatin-bound proteins exhibited some variability in tissues of individual animals, but showed no changes that could be directly attributed to flight conditions. No significant change was apparent in the distribution of RI or RII cyclic AMP binding in the soluble fractions. It is inferred that the cardiac cell integrity or its protein content is not compromised under flight conditions.

The STS-95 crew participates in a media briefing before returning to JSC

Science.gov (United States)

1998-01-01

The day after their return to Earth on board the orbiter Discovery, members of the STS-95 crew participate in a media briefing at the Kennedy Space Center Press Site Auditorium before returning to the Johnson Space Center in Houston, Texas. From left to right are Lisa Malone, moderator and chief of NASA Public Affairs' Media Services at Kennedy Space Center; Mission Commander Curtis L. Brown Jr.; Pilot Steven W. Lindsey; Mission Specialist and Payload Commander Stephen K. Robinson; Mission Specialist Scott E. Parazynski; Mission Specialist Pedro Duque, with the European Space Agency (ESA); Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA); and Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts. The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. The mission included research payloads such as the Spartan-201 solar- observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

Governing Board of the Pension Fund

CERN Multimedia

2006-01-01

The Governing Board held its 146th and 147th meetings on 19 September and 1 November 2006 respectively. At the first of these two meetings, a technical amendment to the Rules of the Fund was discussed regarding the annual adjustment of pensions. The Governing Board made a proposal, which was approved by the CERN Council at its meeting on 19 October 2006, to make an amendment to Article II 1.15 of the Pension Fund's Rules (see below). As a result, in future years, as long as the funding ratio of the Pension Fund is below 100 %, only a fraction of the observed inflation will be granted, so that the funding ratio reaches 100 % by the end of 2033. The cumulated loss in purchasing power incurred by any beneficiary shall be limited to 8 % maximum (including, for those concerned, the 1.7 % loss as at 1 January 2005). The parameters of this mechanism shall be reviewed after each actuarial review, to take into account the updated financial position of the Fund. The factor to be applied to the consumer price index f...

Dominant lethal mutations in Drosophila melanogaster natural populations flown on board ISS.

Science.gov (United States)

Larina, Olga; Bekker, Anna

The resistance to mutagenic impacts represents an important issue of manned space missions. However the reasons of its individual variability as well as the factors which could induce mutations in space flight are not fully understood. Drosophila studies accomplished by several research teams at real space flights, revealed pronounced increase of mutations in somatic and reproductive cells, nonetheless, quite an opposite spaceflight effects also occurred, i.e., mei-41 laboratory strain showed postflight mutation rates lower than that in ground control. In order to monitor the influence of space flight on the mutational process, 4 series of space experiment with D. melanogaster wild type populations were performed at International Space Station (ISS). The appliance “Drosophila-2” used for breeding of drosophila in spaceflight conditions, enabled to conduct synchronous studies with two samples of fly populations. First instar drosophila larvae were placed into the experimental appliance 12 hours before the start of transport spacecraft. The duration of experiments was 7.9 through 19.7 days. In 19.7-day experiment, two generations of the flies were raised during the space flight, and then delivered to the earth. The frequency of dominant lethal mutations (DLM) was evaluated as the percentage of embryonic death in the progeny of experimental drosophila samples. DLM tests in VV-09 and Chas-09 natural populations, performed after the exposure to 10.9-day flight, showed the increase of DLM rate in Chas-09 (0.077 in flight series vs. 0.43 in earth-based control) while post-flight DLM value in VV-09 did not diverge from on-earth sample (0.025 and 0.027 correspondingly). The same results for VV-09 were obtained after the 14.7-day and 7.9-day flights with the only exception: 7.9-day flight experiment employed DLM measurements in two VV-09 spaceflight samples, differing by the age of the flies, and the above DLM rates were detected in “younger” VV-09 sample only. DLM

Experiments on the Synthesis of Element 115 in the Reaction ^{243}Am (^{48}Ca, xn)^{291-x}115

CERN Document Server

Oganessian, Yu T; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Lougheed, R W

2003-01-01

The results of experiments designed to synthesize element 115 isotopes in the ^{243}Am(^{48}Ca,xn)^{291-x}115 reaction are presented. With a beam dose of 4.3\\cdot 10^{18} 248-Mev ^{48}Ca projectiles, we observed three similar decay chains consisting of five consecutive alpha-decays, all detected in time intervals of about 20 s and terminated at a later time by a spontaneous fission with a high energy release (TKE \\sim 220 MeV). At a higher bombarding energy of 253 MeV, with an equal ^{48}Ca beam dose, we registered a different decay chain of four consecutive alpha-decays detected in a time interval of about 0.5 s, also terminated by spontaneous fission. The alpha-decay energies and half-lives for nine new alpha-decaying nuclei were determined. The decay properties of these synthesized nuclei are consistent with consecutive alpha-decays originating from the parent isotopes of the new element 115, ^{288}115 and ^{287}115, produced in the 3n- and 4n-evaporation channels with cross sections of about 3 and 1 pb, r...

Nondestructive Estimation of Muscle Contributions to STS Training with Different Loadings Based on Wearable Sensor System.

Science.gov (United States)

Liu, Kun; Liu, Yong; Yan, Jianchao; Sun, Zhenyuan

2018-03-25

Partial body weight support or loading sit-to-stand (STS) rehabilitation can be useful for persons with lower limb dysfunction to achieve movement again based on the internal residual muscle force and external assistance. To explicate how the muscles contribute to the kinetics and kinematics of STS performance by non-invasive in vitro detection and to nondestructively estimate the muscle contributions to STS training with different loadings, a wearable sensor system was developed with ground reaction force (GRF) platforms, motion capture inertial sensors and electromyography (EMG) sensors. To estimate the internal moments of hip, knee and ankle joints and quantify the contributions of individual muscle and gravity to STS movement, the inverse dynamics analysis on a simplified STS biomechanical model with external loading is proposed. The functional roles of the lower limb individual muscles (rectus femoris (RF), gluteus maximus (GM), vastus lateralis (VL), tibialis anterior (TA) and gastrocnemius (GAST)) during STS motion and the mechanism of the muscles' synergies to perform STS-specific subtasks were analyzed. The muscle contributions to the biomechanical STS subtasks of vertical propulsion, anteroposterior (AP) braking and propulsion for body balance in the sagittal plane were quantified by experimental studies with EMG, kinematic and kinetic data.

Teachers' learning on the workshop of STS approach as a way of enhancing inventive thinking skills

Science.gov (United States)

Ngaewkoodrua, Nophakun; Yuenyong, Chokchai

2018-01-01

To improve science teachers to develop the STS lesson plans for enhancing the students' inventive thinking skills, the workshop of improving science teachers to develop the STS lesson plans for enhancing the Inventive thinking skills were organized. The paper aimed to clarify what teachers learn from the workshop. The goal of the activity of the workshop aimed to: 1) improve participants a better understanding of the relationship between the Inquiry based learning with STS approach, 2) understand the meaning and importance of the STS approach and identify the various stages of Yuenyong (2006) STS learning process, 3) discuss what they learned from the examples of Yuenyong (2006) lesson plan, 4) develop some activities for each stage of Yuenyong (2006) STS approach, and 5) ideas of providing STS approach activities for enhancing inventive thinking skills. Participants included 3 science teachers who work in Khon Kaen, Thailand. Methodology regarded interpretive paradigm. Teachers' learning about pedagogy of enhancing the students' inventive thinking skills will be interpreted through participant observation, teachers' tasks, and interview. The finding revealed that all participants could demonstrate their ideas how to generate the STS lesson plans as a way of enhancing inventive thinking skills. Teachers could mention some element of inventive thinking skills which could be generated on their STS learning activities.

STS-114: Discovery Crew Arrival

Science.gov (United States)

2005-01-01

George Diller of NASA Public Affairs narrates the STS-114 Crew arrival at Kennedy Space Center aboard a Gulf Stream aircraft. They were greeted by Center Director Jim Kennedy. Commander Eileen Collins introduced each of her crew members and gave a brief description of their roles in the mission. Mission Specialist 3, Andrew Thomas will be the lead crew member on the inspection on flight day 2; he is the intravehicular (IV) crew member that will help and guide Mission Specialists Souichi Noguchi and Stephen Robinson during their spacewalks. Pilot James Kelly will be operating the shuttle systems in flying the Shuttle; he will be flying the space station robotic arm during the second extravehicular activity and he will be assisting Mission Specialist Wendy Lawrence during the other two extravehicular activities; he will be assisting on the rendezvous on flight day three, and landing of the shuttle. Commander Collins also mentioned Pilot Kelly's recent promotion to Colonel by the United States Air Force. Mission Specialist 1, Souichi Noguchi from JAXA (The Japanese Space Agency) will be flying on the flight deck for ascent; he will be doing three spacewalks on day 5, 7, and 9; He will be the photo/TV lead for the different types of cameras on board to document the flight and to send back the information to the ground for both technical and public affairs reasons. Mission Specialist 5, Charles Camada will be doing the inspection on flight day 2 with Mission Specialist Thomas and Pilot Kelly; he will be transferring the logistics off the shuttle and onto the space station and from the space station back to the shuttle; He will help set up eleven lap tops on board. Mission Specialist 4, Wendy Lawrence will lead the transfer of logistics to the space station; she is the space station arm operator during extravehicular activities 1 and 3; she will be carrying the 6,000 pounds of external storage platform from the shuttle payload bay over to the space station; she is also

Nuclear structure notes on element 115 decay chains

International Nuclear Information System (INIS)

Rudolph, D.; Sarmiento, L. G.; Forsberg, U.

2015-01-01

Hitherto collected data on more than hundred α-decay chains stemming from element 115 are combined to probe some aspects of the underlying nuclear structure of the heaviest atomic nuclei yet created in the laboratory

Nuclear structure notes on element 115 decay chains

Energy Technology Data Exchange (ETDEWEB)

Rudolph, D., E-mail: Dirk.Rudolph@nuclear.lu.se; Sarmiento, L. G.; Forsberg, U. [Department of Physics, Lund University, 22100 Lund (Sweden)

2015-10-15

Hitherto collected data on more than hundred α-decay chains stemming from element 115 are combined to probe some aspects of the underlying nuclear structure of the heaviest atomic nuclei yet created in the laboratory.

Liftoff of Space Shuttle Columbia on mission STS-93

Science.gov (United States)

1999-01-01

The fiery launch of Space Shuttle Columbia lights up the night sky on its successful liftoff from Launch Pad 39-B on mission STS-93. Liftoff occurred at 12:31 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a Shuttle mission. The target landing date is July 27, 1999, at 11:20 p.m. EDT.

STS-26 crew on fixed based (FB) shuttle mission simulator (SMS) flight deck

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck (left) and Pilot Richard O. Covey review checklists in their respective stations on the foward flight deck. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

Women on professional society and journal editorial boards.

Science.gov (United States)

Morton, Melinda J; Sonnad, Seema S

2007-07-01

Membership on a professional medical society or journal editorial board is a marker of influence and prestige for those in academic medicine. This study presents the first comprehensive quantification of women on these boards and the implications for women in medicine. The numbers of women and men on professional society and journal editorial boards across 28 specialties (March 2004) were counted. The number of women holding multiple roles on these boards and the number of women holding top leadership positions on these boards were counted, and these proportions were compared. Three-thousand-four-hundred-seventy-three individuals on 39 professional medical society boards and 54 journal editorial boards were included. Eighty-three percent (2,884) of board members were male. Men occupied > 80% of top leadership positions on these boards. Thirty-five of the 589 women in the study held multiple roles. Anesthesiology (p women on boards in comparison to the total women in the specialty. Internal medicine, plastic surgery, cardiology and general surgery had nearly equivalent proportions; in otolaryngology and family medicine, female board members slightly exceeded the proportion of women in the field. Women's representation on society and editorial boards does not always reflect their presence in medical specialties, and it is critically lacking in certain specialties. Efforts should be made to attain parity of women leaders on these boards. Further efforts should be made to eliminate barriers to women's leadership in medicine.

STS-110 M.S. Ross and Smith in M-113 personnel carrier during TCDT

Science.gov (United States)

2002-01-01

KENNEDY SPACE CENTER, FLA. -- With STS-110 Mission Specialists Jerry Ross (far left) and Steven Smith (third from left) on board, Commander Michael Bloomfield scatters dust as he practices driving the M-113 armored personnel carrier. The driving is part of Terminal Countdown Demonstration Test activities, which include emergency egress training and a simulated launch countdown. The TCDT is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.

Turning to Ontology in STS? Turning to STS through ‘Ontology’

NARCIS (Netherlands)

van Heur, B.; Leydesdorff, L.; Wyatt, S.

2012-01-01

We examine the evidence for the claim of an ‘ontological turn’ in science and technology studies (STS). Despite an increase in references to ‘ontology’ in STS since 1989, we show that there has not so much been an ontological turn as multiple discussions deploying the language of ontology,

New Rationales for Women on Boards

OpenAIRE

Choudhury, B.

2014-01-01

Should measures promoting women to corporate boards be solely justified in terms of economic arguments? Traditionally, such measures have tended to rely on utilitarian arguments, despite the fact that the most prominent of these arguments—the relationship between women’s presence on boards and firm financial performance—is equivocal. Conversely, this article argues that rationales for increasing women on boards should be based on both equality and economics grounds. An equality rationale is n...

STS-91 Launch of Discovery from Launch Pad 39-A

Science.gov (United States)

1998-01-01

Searing the early evening sky with its near sun-like rocket exhaust, the Space Shuttle Discovery lifts off from Launch Pad 39A at 6:06:24 p.m. EDT June 2 on its way to the Mir space station. On board Discovery are Mission Commander Charles J. Precourt; Pilot Dominic L. Gorie; and Mission Specialists Wendy B. Lawrence, Franklin R. Chang-Diaz, Janet Lynn Kavandi and Valery Victorovitch Ryumin. The nearly 10-day mission will feature the ninth and final Shuttle docking with the Russian space station Mir, the first Mir docking for the Space Shuttle orbiter Discovery, the first on-orbit test of the Alpha Magnetic Spectrometer (AMS), and the first flight of the new Space Shuttle super lightweight external tank. Astronaut Andrew S. W. Thomas will be returning to Earth as a STS-91 crew member after living more than four months aboard Mir.

STS-44 Atlantis, OV-104, MS Musgrave on FB-SMS middeck during JSC training

Science.gov (United States)

1991-01-01

STS-44 Atlantis, Orbiter Vehicle (OV) 104, Mission Specialist (MS) F. Story Musgrave, wearing lightweight headset (HDST), adjusts controls on communications module mounted on a middeck overhead panel. Musgrave is on the middeck of the Fixed Base (FB) Shuttle Mission Simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. The STS-44 crewmembers are participating in a flight simulation.

A Feminist Framework for Nurses on Boards.

Science.gov (United States)

Sundean, Lisa J; Polifroni, E Carol

Nurses' knowledge, skills, and expertise uniquely situate them to contribute to health care transformation as equal partners in organizational board governance. The Institute of Medicine, the 10,000 Nurses on Boards Coalition, and a growing number of nurse and health care scholars advocate nurse board leadership; however, nurses are rarely appointed as voting board members. When no room is made for nurses to take a seat at the table, the opportunity is lost to harness the power of nursing knowledge for health care transformation and social justice. No philosophical framework underpins the emerging focus on nurse board leadership. The purpose of this article is to add to the extant nursing literature by suggesting feminism as a philosophical framework for nurses on boards. Feminism contributes to the knowledge base of nursing as it relates to the expanding roles of nurses in health care transformation, policy, and social justice. Furthermore, a feminist philosophical framework for nurses on boards sets the foundation for new theory development and validates ongoing advancement of the nursing profession. Copyright © 2016 Elsevier Inc. All rights reserved.

Improving Indicators in a Brazilian Hospital Through Quality-Improvement Programs Based on STS Database Reports

Directory of Open Access Journals (Sweden)

Pedro Gabriel Melo de Barros e Silva

2015-12-01

Full Text Available ABSTRACT OBJECTIVE: To report the initial changes after quality-improvement programs based on STS-database in a Brazilian hospital. METHODS: Since 2011 a Brazilian hospital has joined STS-Database and in 2012 multifaceted actions based on STS reports were implemented aiming reductions in the time of mechanical ventilation and in the intensive care stay and also improvements in evidence-based perioperative therapies among patients who underwent coronary artery bypass graft surgeries. RESULTS: All the 947 patients submitted to coronary artery bypass graft surgeries from July 2011 to June 2014 were analyzed and there was an improvement in all the three target endpoints after the implementation of the quality-improvement program but the reduction in time on mechanical ventilation was not statistically significant after adjusting for prognostic characteristics. CONCLUSION: The initial experience with STS registry in a Brazilian hospital was associated with improvement in most of targeted quality-indicators.

Advisory Board on Alcoholism and Drug Abuse

Science.gov (United States)

State Employees Advisory Board on Alcoholism and Drug Abuse DHSS State of Alaska Home Divisions and ; Advisory Board on Alcoholism and Drug Abuse Page Content Alison Kulas Executive Director If you, a family Kulas Begins Tenure as Executive Director The Advisory Board on Alcoholism and Drug Abuse, The Alaska

Vacuum ultraviolet backgrounds from space - Ten years after

International Nuclear Information System (INIS)

Huffman, R.E.; Larrabee, J.C.; Leblanc, F.J.

1989-01-01

The airglow, scattering, and auroral emission sources of the VUV background of the earth's atmosphere set limits on the usefulness of UV space observations, but facilitate such passive remote sensing types as electron density profiling and auroral location and strength determinations, which are presently discussed. UV auroral imaging has to date been conducted by four different experiments: (1) the VUV Backgrounds observations (flown on the S3-4 satellite in 1978); (2) the Horizon UV Program experiment (flown on STS-4 in 1982); the HILAT satellite's Atmospheric/Ionospheric Monitor (1986); and the Atmospheric/Ionospheric Remote Sensor (flown on the Polar BEAR satellite, 1988-1989). 18 refs

19 CFR 115.2 - Application.

Science.gov (United States)

2010-04-01

... Customs Convention on Containers, 1972, may be accomplished by the competent authority of the country in... 19 Customs Duties 1 2010-04-01 2010-04-01 false Application. 115.2 Section 115.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO...

An Examination of Radiation Induced Tensile Failure of Stressed and Unstressed Polymer Films Flown on MISSE-6

Science.gov (United States)

Miller, Sharon K.; Sechkar, Edward A.

2012-01-01

Thin film polymers are used in many spacecraft applications for thermal control (multilayer insulation and sunshields), as lightweight structural members (solar array blankets, inflatable/deployable structures) and have been proposed for propulsion (solar sails). Polymers in these applications are often under a tensile load and are directly exposed to the space environment, therefore it is important to understand the effect of stress in combination with the environment on the durability of these polymer films. The purpose of the Polymer Film Tensile Experiment, flown as part of Materials International Space Station Experiment 6 (MISSE 6), was to expose a variety of polymer films to the low Earth orbital environment under both relaxed and tension conditions. This paper describes the results of post flight tensile testing of these samples.

Board Size and Board Independence: A Quantitative Study on Banking Industry in Pakistan

Directory of Open Access Journals (Sweden)

Kashif Rashid

2014-12-01

Full Text Available This paper aims to investigate the relationship of board independence and board size with productivity and efficiency of the listed banks on the Karachi Stock Exchange, Pakistan. There is a lack of consensus regarding impact of corporate governance practices in correspondence to number of board members and board independence in banking sector. The derived results of the study show that there is a positive relationship between board independence and bank profitability and efficiency. Independent directors play a crucial role in providing genuine advice during executive decision making process which is an important source for improving overall corporate governance. Moreover, results regarding the role of control variables suggest a positive relationship of the total assets and deposits of the firm with the firm’s performance supporting stewardship theory in the market.

77 FR 1956 - National Science Board; Notice of Opportunity for Public Comment on the National Science Board...

Science.gov (United States)

2012-01-12

... NATIONAL SCIENCE FOUNDATION National Science Board; Notice of Opportunity for Public Comment on the National Science Board Data Policies Report AGENCY: National Science Board (NSB), NSF. ACTION: Request for public comments. SUMMARY: The National Science Board seeks comments from the public on the...

Employee on Boarding Process Automation

OpenAIRE

Khushboo Nalband; Priyanka Jadhav; Geetanjali Salunke

2017-01-01

On boarding, also known as organizational socialization, plays a vital role in building the initial relationship between an organization and an employee. It also contributes to an employees’ satisfaction, better performance and greater organizational commitment thus increasing an employees’ effectiveness and productivity in his/her role. Therefore, it is essential that on boarding process of an organization is efficient and effective to improve new employees’ retention. Generally this on boar...

Gender Quotas on Board of Directors

DEFF Research Database (Denmark)

Smith, Nina

2013-01-01

Beside arguments of fairness and equal opportunities, it is often argued that gender diversity on boards of directors may improve firm performance, but the empirical results are mixed and often negative. Based on the available research, gender quotas on boards of directors cannot be justified...

Development of 115Cd/115mln generator for industrial and environmental applications

International Nuclear Information System (INIS)

Camargo, Fernanda Cristina Fonseca

2012-01-01

Indium isotopes, 111 In, '1 13 ln and 115 In are widely used as radiotracers in industrial and environmental applications. 113m ln generators can be found in the international market. However they are manufactured by only a few companies worldwide, are rated at rather high prices and not always are available for sale (they are frequently manufactured only upon request). Hence it is of interest to produce the equipment in the country in which it will be used, especially if the parent nuclide can be also produced there. In Brazil, the ideal situation would be to produce a 115 Cd/ 115m In generator, whose target precursor is the '1 14 Cd. Preliminary tests using non-enriched and inactive CdO were developed. The parent and daughter nuclides were separated flowing the eluate containing the chemical species Cd (II) and In (III) through ion exchange resins, Ag11A8, Chelex100 and Oowex 1 x8. 0.1 M, 1 M and 2M HCI and 2M HCI + 0.1 M NH 4 CI solutions were tested as the eluant. The amount of Cd (l I) and In (III) eluted were determined by ICP-AES. The irradiation conditions of the target 114 CdO were defined according to the neutron flux provided TRIGA MARK-I-R IPR reactor and the nuclear properties the of target. After to preliminary tests with the 115 Cd/ 115m In pair, column experiments were developed. Analyses were accomplished by gamma spectrometry to determine the presence of the 115 Cd and 115m ln nuclides in the fractions eluted. Tests using the resin AG IIA8 and HCI I M eluent solution resulted in 100% adsorption of the Cd (11) and nearly 50% elution of In (III), corresponding to the best conditions for elution. Exposure to radiation can damage the resins, as the decrease in ion exchange capacity and change in volume of the polymer grains. Thus, columns packed with the chosen resin were exposed to radiation doses from 15 to 200 Gy, and eluted with the most effective eluent. The results showed that radiation does not change the adsorption capacity of Cd (II) by the

25 CFR 115.709 - Will an annual audit be conducted on trust funds?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Will an annual audit be conducted on trust funds? 115.709... FUNDS FOR TRIBES AND INDIVIDUAL INDIANS Trust Fund Accounts: General Information § 115.709 Will an... will be conducted on trust funds. Each tribe and IIM account holder will be notified when the Secretary...

7 CFR 1150.115 - Research.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Research. 1150.115 Section 1150.115 Agriculture... and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Dairy Promotion and Research Order Definitions § 1150.115 Research. Research means studies testing the effectiveness of market...

23 CFR 645.115 - Construction.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 645.115 Section 645.115 Highways FEDERAL... Relocations, Adjustments, and Reimbursement § 645.115 Construction. (a) Part 635, subpart B, of this title, Force Account Construction (justification required for force account work), states that it is cost...

STS-51B Crew Portrait

Science.gov (United States)

1985-01-01

The crew assigned to the STS-51B mission included (seated left to right) Robert F. Overmyer, commander; and Frederick D. Gregory, pilot. Standing, left to right, are Don L. Lind, mission specialist; Taylor G. Wang, payload specialist; Norman E. Thagard, mission specialist; William E. Thornton, mission specialist; and Lodewijk van den Berg, payload specialist. Launched aboard the Space Shuttle Challenger on April 29, 1985 at 12:02:18 pm (EDT), the STS-51A mission's primary payload was the Spacelab-3.

115th Congressional Districts

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This layer depicts the 115th Congressional Districts for the United States, with attributes listing the elected officials for the 115th Congress. Elected to a...

10 CFR 11.5 - Policy.

Science.gov (United States)

2010-01-01

... 10 Energy 1 2010-01-01 2010-01-01 false Policy. 11.5 Section 11.5 Energy NUCLEAR REGULATORY COMMISSION CRITERIA AND PROCEDURES FOR DETERMINING ELIGIBILITY FOR ACCESS TO OR CONTROL OVER SPECIAL NUCLEAR MATERIAL General Provisions § 11.5 Policy. It is the policy of the Nuclear Regulatory Commission to carry...

STS-82 Pilot Scott Horowitz at SLF

Science.gov (United States)

1997-01-01

STS-82 Pilot Scott J. 'Doc' Horowitz flashes a wide grin for photographers after he lands his T-38 jet at KSCs Shuttle Landing Facility. Horowitz and the other six members of the STS-82 crew came from their home base at Johnson Space Center in Houston, TX, to spend the last few days before launch at KSC. STS-82 is scheduled for liftoff on Feb. 11 during a 65-minute launch window which opens at 3:56 a.m. EST. The 10-day flight aboard the Space Shuttle Discovery will be the second Hubble Space Telescope servicing mission.

On-Board Mining in the Sensor Web

Science.gov (United States)

Tanner, S.; Conover, H.; Graves, S.; Ramachandran, R.; Rushing, J.

2004-12-01

On-board data mining can contribute to many research and engineering applications, including natural hazard detection and prediction, intelligent sensor control, and the generation of customized data products for direct distribution to users. The ability to mine sensor data in real time can also be a critical component of autonomous operations, supporting deep space missions, unmanned aerial and ground-based vehicles (UAVs, UGVs), and a wide range of sensor meshes, webs and grids. On-board processing is expected to play a significant role in the next generation of NASA, Homeland Security, Department of Defense and civilian programs, providing for greater flexibility and versatility in measurements of physical systems. In addition, the use of UAV and UGV systems is increasing in military, emergency response and industrial applications. As research into the autonomy of these vehicles progresses, especially in fleet or web configurations, the applicability of on-board data mining is expected to increase significantly. Data mining in real time on board sensor platforms presents unique challenges. Most notably, the data to be mined is a continuous stream, rather than a fixed store such as a database. This means that the data mining algorithms must be modified to make only a single pass through the data. In addition, the on-board environment requires real time processing with limited computing resources, thus the algorithms must use fixed and relatively small amounts of processing time and memory. The University of Alabama in Huntsville is developing an innovative processing framework for the on-board data and information environment. The Environment for On-Board Processing (EVE) and the Adaptive On-board Data Processing (AODP) projects serve as proofs-of-concept of advanced information systems for remote sensing platforms. The EVE real-time processing infrastructure will upload, schedule and control the execution of processing plans on board remote sensors. These plans

Biofilm initiation and growth of Pseudomonas aeruginosa on 316L stainless steel in low gravity in orbital space flight

Science.gov (United States)

Todd, Paul; Pierson, Duane L.; Allen, Britt; Silverstein, JoAnn

The formation of biofilms by water microorganisms such as Pseudomonas aeruginosa in spacecraft water systems has been a matter of concern for long-duration space flight. Crewed spacecraft plumbing includes internal surfaces made of 316L stainless steel. Experiments were therefore undertaken to compare the ability of P. aeruginosa to grow in suspension, attach to stainless steel and to grow on stainless steel in low gravity on the space shuttle. Four categories of cultures were studied during two space shuttle flights (STS-69 and STS-77). Cultures on the ground were held in static horizontal or vertical cylindrical containers or were tumbled on a clinostat and activated under conditions identical to those for the flown cultures. The containers used on the ground and in flight were BioServe Space Technologies’ Fluid Processing Apparatus (FPA), an open-ended test tube with rubber septa that allows robotic addition of bacteria to culture media to initiate experiments and the addition of fixative to conclude experiments. Planktonic growth was monitored by spectrophotometry, and biofilms were characterized quantitatively by epifluorescence and scanning electron microscopy. In these experiments it was found that: (1) Planktonic growth in flown cultures was more extensive than in static cultures, as seen repeatedly in the history of space microbiology, and closely resembled the growth of tumbled cultures. (2) Conversely, the attachment of cells in flown cultures was as much as 8 times that in tumbled cultures but not significantly different from that in static horizontal and vertical cultures, consistent with the notion that flowing fluid reduces microbial attachment. (3) The final surface coverage in 8 days was the same for flown and static cultures but less by a factor of 15 in tumbled cultures, where coverage declined during the preceding 4 days. It is concluded that cell attachment to 316L stainless steel in the low gravity of orbital space flight is similar to that

Hearing loss in the Royal Norwegian Navy: A longitudinal study.

Science.gov (United States)

Irgens-Hansen, Kaja; Baste, Valborg; Bråtveit, Magne; Lind, Ola; Koefoed, Vilhelm F; Moen, Bente E

2016-01-01

The aims of this longitudinal study were to investigate a significant threshold shift (STS) among personnel working on board the Royal Norwegian Navy's (RNoN) vessels between 2012 and 2014 and to identify possible determinants of STS. Hearing thresholds were measured by pure tone audiometry in two consecutive examinations (n = 226). STS was defined as an average change in hearing thresholds ≥ + 10 dB at 2,000 Hz, 3,000 Hz, and 4,000 Hz in either ear. Determinants of STS were assessed through a questionnaire. The incidence of STS was 23.0%. Significant determinants of STS were the number of episodes of temporary threshold shifts (TTS) in the Navy, exposure to continuous loud noise during work on board, and the number of gun shots (in the Navy, hunting, and sports). This study indicated a significant association between noise exposure on board Navy vessels and development of STS.

Investigating students' view on STEM in learning about electrical current through STS approach

Science.gov (United States)

Tupsai, Jiraporn; Yuenyong, Chokchai

2018-01-01

This study aims to investigate Grade 11 students' views on Science Technology Engineering Mathematics (STEM) with the integration of learning about electrical current based on Science Technology Society (STS) approach [8]. The participants were 60 Grade 11 students in Demonstration Secondary School, Khon Kaen University, Khon Kaen Province, Thailand. The methodology is in the respect of interpretive paradigm. The teaching and learning about Electrical Current through STS approach carried out over 6 weeks. The Electrical Current unit through STS approach was developed based on framework[8] that consists of five stages including (1) identification of social issues, (2) identification of potential solutions, (3) need for knowledge, (4) decision making, and (5) socialization stage. To start with, the question "what if this world is lack of electricity" was challenged in the class in order to move students to find the problem of how to design Electricity Generation from Clean Energy. Students were expected to apply scientific and other knowledge to design of Electricity Generation. Students' views on STEM were collected during their learning by participant' observation and students' tasks. Their views on STEM were categorized when they applied their knowledge for designing the Electricity Generation. The findings indicated that students cooperatively work to solve the problem when applying knowledge about the content of Science and Mathematics and processing skill of Technology and Engineering. It showed that students held the integration of science, technology, engineering and mathematics to design their possible solutions in learning about Electrical Current. The paper also discusses implications for science teaching and learning through STS in Thailand.

Why so few Women on Boards of Directors?

DEFF Research Database (Denmark)

Smith, Nina; Parrotta, Pierpaolo

2015-01-01

This paper analyzes the determinants of women’s representation on boards of directors based on a panel of all privately owned or listed Danish firms with at least 50 employees observed during the period 1998–2010. We focus on the directors who are not elected by the employees and test three...... nonemployee-elected female board members. We also find clear evidence of a tokenism behavior in Danish companies. The likelihood of enlarging the share of non-employee-elected female board members is significantly smaller if one, two, or more women have sat on the board of directors. Finally, the pipeline...... suggests that an important way to increase the female proportion of non-employee-elected board members is that more women reach top executive positions....

Impact of STS Issue Oriented Instruction on Pre-Service Elementary Teachers' Views and Perceptions of Science, Technology, and Society

Science.gov (United States)

Amirshokoohi, Aidin

2016-01-01

The purpose of the study was to investigate the impact of Science, Technology, Society (STS) issue oriented science methods course on pre-service teachers' views and perceptions toward STS issues and instruction as well as their levels of environmental literacy. The STS issue oriented curriculum was designed to help pre-service teachers improve…

24 CFR 115.306 - Training funds.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Training funds. 115.306 Section 115.306 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF... receive training funds. Training funds are fixed amounts based on the number of agency employees to be...

42 CFR 488.115 - Care guidelines.

Science.gov (United States)

2010-10-01

... 42 Public Health 5 2010-10-01 2010-10-01 false Care guidelines. 488.115 Section 488.115 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... § 488.115 Care guidelines. EC01JA91.110 EC01JA91.111 EC01JA91.112 EC01JA91.113 EC01JA91.114 EC01JA91.115...

STS and Researcher Intervention Strategies

Directory of Open Access Journals (Sweden)

Brian Martin

2016-06-01

Full Text Available When I learned about a concerted campaign against Australian vaccination critics, I decided to intervene in the debate. As a result, some proponents of vaccination turned on me, making abusive comments and complaining to university officials. At several points in this experience, I had to make choices about how to intervene or respond. STS perspectives offered valuable insights for understanding the dynamics of the controversy but provided little guidance for making decisions. Some reasons are offered for why STS lacks tools for guiding practical action in such situations.

BACTERIAL BIOFILM FORMATION UNDER MICROGRAVITY CONDITIONS. (R825503)

Science.gov (United States)

Although biofilm formation is widely documented on Earth, it has not been demonstrated in the absence of gravity. To explore this possibility, Pseudomonas aeruginosa, suspended in sterile buffer, was flown in a commercial payload on space shuttle flight STS-95. During earth or...

Cross-section measurement for the reaction 115In(n,n')/sup 115m/In

International Nuclear Information System (INIS)

Liskien, H.; Arnotte, F.; Widera, R.; Paulsen, A.

1978-01-01

The excitation function for the reaction 115 In(n,n')/sup 115m/In was measured by the activation technique from threshold up to 4.1 MeV in 0.1-MeV steps. The absolute normalization of this excitation junction was performed at 2.1 MeV and is based on n-p scattering. The total uncertainty of the results is typically +- 6% above 1 MeV. The results are in good agreement with recently published data. 2 figures, 3 tables

Hearing loss in the Royal Norwegian Navy: A longitudinal study

Directory of Open Access Journals (Sweden)

Kaja Irgens-Hansen

2016-01-01

Full Text Available The aims of this longitudinal study were to investigate a significant threshold shift (STS among personnel working on board the Royal Norwegian Navy′s (RNoN vessels between 2012 and 2014 and to identify possible determinants of STS. Hearing thresholds were measured by pure tone audiometry in two consecutive examinations (n = 226. STS was defined as an average change in hearing thresholds ≥ + 10 dB at 2,000 Hz, 3,000 Hz, and 4,000 Hz in either ear. Determinants of STS were assessed through a questionnaire. The incidence of STS was 23.0%. Significant determinants of STS were the number of episodes of temporary threshold shifts (TTS in the Navy, exposure to continuous loud noise during work on board, and the number of gun shots (in the Navy, hunting, and sports. This study indicated a significant association between noise exposure on board Navy vessels and development of STS.

STS-84 oxygen generator for Mir on display at SPACEHAB

Science.gov (United States)

1997-01-01

Representatives of RSC Energia in Russia and other onlookers in the SPACEHAB Payload Processing Facility examine an oxygen generator which the Space Shuttle Atlantis will carry to the Russian Mir Space Station on Mission STS-84. Sergei Romanov, second from right in the white shirt, is the spokesperson for generator manufacturer RSC Energia. The nearly 300-pound generator will be strapped down on the inside surface of a SPACEHAB Double Module for the trip to Mir. It will replace one of two Mir units that have been malfunctioning recently. The generator functions by electrolysis, which separates water into its oxygen and hydrogen components. The hydrogen is vented and the oxygen is used for breathing by the Mir crew. The generator is 4.2 feet in length and 1.4 feet in diameter. STS-84, which is planned to include a Mir crew exchange of astronaut C. Michael Foale for Jerry M. Linenger, is targeted for a May 15 liftoff. It will be the sixth Shuttle-Mir docking.

Board on chemical sciences and technology

International Nuclear Information System (INIS)

1991-01-01

The Board on Chemical Sciences and Technology organizes and provides direction for standing and ad-hoc committees charged with addressing specific issues relevant to the continued health of the chemical sciences and technology community. Studies currently under the oversight of the BCST include a major survey of the chemical sciences, a complementary survey of chemical engineering, an examination of the problems of biohazards in the laboratory, and an analysis of the roots and magnitude of the problem of obsolescent facilities for research and teaching in departments in the chemical sciences and engineering. The Board continues to respond to specific agency requests for program assessments and advice. BCST members are designated to serve as liaison with major federal agencies or departments that support research in order to help identify ways for the Board to assist these organizations. The BCST maintains close contact with professional societies and non-governmental organizations that share the Board's concern for the health of chemical sciences and technology. Individual Board members are assigned responsibility for liaison with the American Chemical Society, the American Institute of Chemical Engineers, the American Society of Biological Chemists, the Council for Chemical Research, the NAS Chemistry and Biochemistry Sections, and the National Academy of Engineering. In the past few years, the Board has served as a focus and a forum for a variety of issues that relate specifically to the health of chemistry

Development of {sup 115}Cd/{sup 115m}ln generator for industrial and environmental applications; Desenvolvimento de um gerador de {sup 115}Cd/{sup 115m}In para aplicacoes industriais e ambientais

Energy Technology Data Exchange (ETDEWEB)

Camargo, Fernanda Cristina Fonseca

2012-07-01

Indium isotopes, {sup 111}In, '1{sup 13}ln and {sup 115}In are widely used as radiotracers in industrial and environmental applications. {sup 113m}ln generators can be found in the international market. However they are manufactured by only a few companies worldwide, are rated at rather high prices and not always are available for sale (they are frequently manufactured only upon request). Hence it is of interest to produce the equipment in the country in which it will be used, especially if the parent nuclide can be also produced there. In Brazil, the ideal situation would be to produce a {sup 115}Cd/{sup 115m}In generator, whose target precursor is the '1{sup 14}Cd. Preliminary tests using non-enriched and inactive CdO were developed. The parent and daughter nuclides were separated flowing the eluate containing the chemical species Cd (II) and In (III) through ion exchange resins, Ag11A8, Chelex100 and Oowex 1 x8. 0.1 M, 1 M and 2M HCI and 2M HCI + 0.1 M NH{sub 4}CI solutions were tested as the eluant. The amount of Cd (l I) and In (III) eluted were determined by ICP-AES. The irradiation conditions of the target {sup 114}CdO were defined according to the neutron flux provided TRIGA MARK-I-R IPR reactor and the nuclear properties the of target. After to preliminary tests with the {sup 115}Cd/{sup 115m}In pair, column experiments were developed. Analyses were accomplished by gamma spectrometry to determine the presence of the {sup 115}Cd and {sup 115m}ln nuclides in the fractions eluted. Tests using the resin AG IIA8 and HCI I M eluent solution resulted in 100% adsorption of the Cd (11) and nearly 50% elution of In (III), corresponding to the best conditions for elution. Exposure to radiation can damage the resins, as the decrease in ion exchange capacity and change in volume of the polymer grains. Thus, columns packed with the chosen resin were exposed to radiation doses from 15 to 200 Gy, and eluted with the most effective eluent. The results showed that

44 CFR 19.115 - Assurance required.

Science.gov (United States)

2010-10-01

... RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.115 Assurance required. (a) General. Either at the... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Assurance required. 19.115 Section 19.115 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF...

A densitometric analysis of IIaO film flown aboard the space shuttle transportation system STS-3, STS-8, and STS-7

Science.gov (United States)

Hammond, E. C., Jr.; Peters, K. A.; Atkinson, P. F.

1986-01-01

Three canisters of IIaO film were prepared along with packets of color film from the National Geographic Society, which were then placed on the Space Shuttle #3. The ultimate goal was to obtain reasonably accurate data concerning the background fogging effects on IIaO film as it relates to the film's total environmental experience. This includes: the ground based packing, and loading of the film from Goddard Space Flight Center to Cape Kennedy; the effects of the solar wind, humidity, and cosmic rays; the Van Allen Belt radiation exposure; various thermal effect; reentry and off-loading of the film during take off, and 8 day, 3 hour 15 minutes orbits. The total densitometric change caused by all of the above factors were examined. The results of these studies have implications for the utilization of IIaO spectroscopic film on the future shuttle and space lab missions. These responses to standard photonic energy sources will have immediate application for the uneven responses of the film photographing a star field in a terrestrial or extraterrestrial environment with associated digital imaging equipment.

Assessing interactions between HLA-DRB1*15 and infectious mononucleosis on the risk of multiple sclerosis.

Science.gov (United States)

Disanto, Giulio; Hall, Carolina; Lucas, Robyn; Ponsonby, Anne-Louise; Berlanga-Taylor, Antonio J; Giovannoni, Gavin; Ramagopalan, Sreeram V

2013-09-01

Gene-environment interactions may shed light on the mechanisms underlying multiple sclerosis (MS). We pooled data from two case-control studies on incident demyelination and used different methods to assess interaction between HLA-DRB1*15 (DRB1-15) and history of infectious mononucleosis (IM). Individuals exposed to both factors were at substantially increased risk of disease (OR=7.32, 95% CI=4.92-10.90). In logistic regression models, DRB1-15 and IM status were independent predictors of disease while their interaction term was not (DRB1-15*IM: OR=1.35, 95% CI=0.79-2.23). However, interaction on an additive scale was evident (Synergy index=2.09, 95% CI=1.59-2.59; excess risk due to interaction=3.30, 95%CI=0.47-6.12; attributable proportion due to interaction=45%, 95% CI=22-68%). This suggests, if the additive model is appropriate, the DRB1-15 and IM may be involved in the same causal process leading to MS and highlights the benefit of reporting gene-environment interactions on both a multiplicative and additive scale.

Post-Flight Analysis of Selected Fluorocarbon and Other Thin Film Polymer Specimens Flown on MISSE-5

Science.gov (United States)

DeGroh, Kim; Finckenor, Miria; Minton, Tim; Brunsvold, Amy; Pippin, Gary

2007-01-01

Twenty thin film specimens were flown on M1SSE-5 as a cooperative effort between several organizations. This presentation will report results of initial inspections and post-flight measurements of the optical properties and recession of these materials due to the approx.13 month exposure period on the exterior of the International Space Station. These specimens were located on the "anti-solar" side of the MISSE-5 container and received a low number of Equivalent Sun Hours of solar UV exposure. Profilometry and/or ATF measurements will be conducted to determine thickness changes and atomic oxygen-induced recession rates Six of the specimens were covered with thin Kapton films, 0.1 and 0.3 mil in thickness. The 0.1 mil Kapton was almost completely eroded, suggesting that the atomic oxygen fluence is <8 x 10(exp 19) atoms/sq cm, similar to levels experienced during Space Shuttle materials experiments in the 1980's and 1990's. A comparison of results from MISSE-5 and Space Shuttle experiments will be included for those materials common to both the short and long-term exposures.

46 CFR 403.115 - Accounting period.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Accounting period. 403.115 Section 403.115 Shipping COAST GUARD (GREAT LAKES PILOTAGE), DEPARTMENT OF HOMELAND SECURITY GREAT LAKES PILOTAGE UNIFORM ACCOUNTING SYSTEM General § 403.115 Accounting period. Each Association subject to this part shall maintain...

41 CFR 115-1.110 - Deviations.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviations. 115-1.110 Section 115-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.110 Deviations...

7 CFR 3015.115 - Budget revisions.

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false Budget revisions. 3015.115 Section 3015.115..., DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Programmatic Changes and Budget Revisions § 3015.115 Budget revisions. (a) Nonconstruction projects. (1) Except as provided in paragraph (a)(2) of...

The read-out chain of the CBM STS detector

Energy Technology Data Exchange (ETDEWEB)

Lehnert, Joerg; Emschermann, David [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH (Germany); Collaboration: CBM-Collaboration

2016-07-01

The Compressed Baryonic Matter (CBM) experiment at FAIR will explore the QCD phase diagram at high baryon densities during nucleus-nucleus collisions in a fixed target setup. Its physics goals require interaction rates up to 10 MHz, which can be exploited with fast and radiation hard detectors equipped with free-streaming front-end and readout electronics, connected to a common Data Aquisition (DAQ) system to forward data to the First Level Event Selector (FLES). The core component of the CBM DAQ system is the Data Processing Board (DPB) implementing three important functionalities: - The incoming data via multiple lower-speed, short distance links is preprocessed, concentrated and forwarded to the FLES via higher-speed, long distance links. - The DPBs provide an interface for the Detector Control System (DCS) to configure readout and front-end electronics (FEE). - As part of the Timing and Fast Control (TFC) system the DPBs ensure transmission of the reference clock and synchronous commands necessary to synchronize the FEE. This contribution presents the readout and DAQ chain on the example of the core subdetector, the Silicon Tracking System (STS).

Historical Trends in Graduate Research and Training of Diplomates of the American Board of Forensic Anthropology.

Science.gov (United States)

Bethard, Jonathan D

2017-01-01

The history of forensic anthropology has been documented by numerous scholars. These contributions have described the work of early pioneers in the field and have described important milestones, such as the founding of the Physical Anthropology Section of the American Academy of Forensic Sciences (AAFS) in 1972 and the American Board of Forensic Anthropology (ABFA) in 1977. This paper contributes to the growing literature on the history of forensic anthropology by documenting the academic training of all individuals who have been granted diplomate status by the ABFA (n = 115). Doctoral dissertation titles were queried to discern broad patterns of research foci. A total of 39 doctoral granting institutions have trained diplomates and 77.3% of board-certified forensic anthropologists wrote dissertations involving skeletal biology, bioarchaeology, or forensic anthropology. Board-certified forensic anthropologists are a broadly trained group of professionals with far-reaching anthropological interests and expertise. © 2016 American Academy of Forensic Sciences.

47 CFR 78.115 - Modulation limits.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 4 2010-10-01 2010-10-01 false Modulation limits. 78.115 Section 78.115... SERVICE Technical Regulations § 78.115 Modulation limits. (a) If amplitude modulation is employed, negative modulation peaks shall not exceed 100 percent modulation. [37 FR 3292, Feb. 12, 1972, as amended...

25 CFR 115.101 - Individual accounts.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Individual accounts. 115.101 Section 115.101 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES TRUST FUNDS FOR TRIBES AND INDIVIDUAL INDIANS IIM Accounts § 115.101 Individual accounts. Except as otherwise provided in this part...

13 CFR 115.62 - Prohibition on participation in Prior Approval program.

Science.gov (United States)

2010-01-01

... Prior Approval program. 115.62 Section 115.62 Business Credit and Assistance SMALL BUSINESS... in Prior Approval program. A PSB Surety is not eligible to submit applications under subpart B of this part. This prohibition does not extend to an Affiliate, as defined in 13 CFR § 121.103, of a PSB...

21 CFR 131.115 - Concentrated milk.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Concentrated milk. 131.115 Section 131.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.115...

14 CFR 415.115 - Flight safety.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight safety. 415.115 Section 415.115... TRANSPORTATION LICENSING LAUNCH LICENSE Safety Review and Approval for Launch of an Expendable Launch Vehicle From a Non-Federal Launch Site § 415.115 Flight safety. (a) Flight safety analysis. An applicant's...

49 CFR 199.115 - Contractor employees.

Science.gov (United States)

2010-10-01

... 49 Transportation 3 2010-10-01 2010-10-01 false Contractor employees. 199.115 Section 199.115... § 199.115 Contractor employees. With respect to those employees who are contractors or employed by a contractor, an operator may provide by contract that the drug testing, education, and training required by...

40 CFR 40.115-1 - Construction.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Construction. 40.115-1 Section 40.115-1... DEMONSTRATION GRANTS § 40.115-1 Construction. May include the preliminary planning to determine the economic and... action necessary to the construction of a facility, the erection, acquisition, alteration, remodeling...

On the Internationalization of Corporate Boards

DEFF Research Database (Denmark)

Oxelheim, Lars; Gregoric, Aleksandra; Randøy, Ttrond

Despite the global reach of their commercial activities, many multinational firms have proved slow in internationalizing their boards of directors. Based on a panel study of the internationalization of the boards of 347 non-financial firms from the Nordic countries, we find a higher fraction...... of international board membership in firms with more foreign sales, in firms with more foreign ownership and in firms whose shares are traded on foreign (mostly European) stock exchanges. Moreover, we find international directors and national directors with international experience complementary. The first......-mentioned group is found to serve a monitoring role, related to financial internationalization of the firm, whereas the latter category fills an advisory role related to commercial internationalization. Hence, different types of firm internationalization – commercial versus financial – might call for different...

STS-87 Mission Specialist Winston E. Scott suits up

Science.gov (United States)

1997-01-01

STS-87 Mission Specialist Winston Scott dons his launch and entry suit with the assistance of a suit technician in the Operations and Checkout Building. This is Scotts second space flight. He and the five other crew members will depart shortly for Launch Pad 39B, where the Space Shuttle Columbia awaits liftoff on a 16-day mission to perform microgravity and solar research. Scott is scheduled to perform an extravehicular activity spacewalk with Mission Specialist Takao Doi, Ph.D., of the National Space Development Agency of Japan, during STS-87. He also performed a spacewalk on STS-72.

STS-110/Atlantic/ISS 8A Pre-Launch On Orbit-Landing-Crew Egress

Science.gov (United States)

2002-01-01

The crew of STS-110, which consists of Commander Michael Bloomfield, Pilot Stephen Frick, and Mission Specialists Rex Walheim, Ellen Ochoa, Lee Morin, Jerry Ross, and Steven Smith is introduced at the customary pre-flight meal. The narrator provides background information on the astronauts during suit-up. Each crew member is shown in the White Room before boarding Space Shuttle Atlantis, and some display signs to loved ones. Launch footage includes the following replays: Beach Tracker, VAB, Pad B, Tower 1, DLTR-3, Grandstand, Cocoa Beach DOAMS, Playalinda DOAMS, UCS-23, SLF Convoy, OTV-154, OTV-163, OTV-170 (mislabeled), and OTV-171 (mislabeled). After the launch, NASA administrator Sean O'Keefe gives a speech to the Launch Control Center, with political dignitaries present. While on-orbit, Atlantis docks with the International Space Station (ISS), and Canadarm 2 on the ISS lifts the S0 Truss out of the orbiter's payload bay. The video includes highlights of three extravehicular activities (EVAs). In the first, the S0 Truss is fastened to the Destiny Laboratory Module on the ISS. During the third EVA, Walheim and Smith assist in the checkout of the handcart on the S0 Truss. The Atlantis crew is shown gathered together with the Expedition 4 crew of the ISS, and again by itself after undocking. Replays of the landing include: VAB, Tower 1, Mid-field, Runway South End, Runway North End, Tower 2, Playalinda DOAMS, Cocoa Beach DOAMS, and Pilot Point of View (PPOV). After landing, Commander Bloomfield lets each of his crew members give a short speech.

38 CFR 75.115 - Risk analysis.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Risk analysis. 75.115 Section 75.115 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.115 Risk analysis. If a data breach involving sensitive personal information that is processed or...

21 CFR 169.115 - French dressing.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false French dressing. 169.115 Section 169.115 Food and... § 169.115 French dressing. (a) Description. French dressing is the separable liquid food or the..., lecithin, or polyglycerol esters of fatty acids. (d) Nomenclature. The name of the food is “French dressing...

21 CFR 160.115 - Liquid eggs.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Liquid eggs. 160.115 Section 160.115 Food and... CONSUMPTION EGGS AND EGG PRODUCTS Requirements for Specific Standardized Eggs and Egg Products § 160.115 Liquid eggs. (a) Liquid eggs, mixed eggs, liquid whole eggs, mixed whole eggs are eggs of the domestic...

40 CFR 40.115-6 - State.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 1 2010-07-01 2010-07-01 false State. 40.115-6 Section 40.115-6... DEMONSTRATION GRANTS § 40.115-6 State. (a) Under the Federal Water Pollution Control Act, a State, the District... Territory of the Pacific Islands. (b) Under the Resource Conservation and Recovery Act, a State, the...

The Perceptions of Georgia School Board Members' Need for Training on School Board Governance

Science.gov (United States)

Nutt, Pamela Studdard

2010-01-01

This study explored the perceptions of training needs of school board members in Georgia. The study examined perceptions of school board chairs, board members with 1 to 5 years experience, members with 6 to 10 years experience, members with 11 to 15 years experience and board members with 16 plus years experience in the areas of school board…

STS-104 Atlantis on pad after RSS rollback

Science.gov (United States)

2001-01-01

KENNEDY SPACE CENTER, Fla. -- Workers clean the mobile launcher platform on which sits Space Shuttle Atlantis. They are standing in front of one of two tail service masts on either side of the Shuttle, in front of each wing. The masts support the fluid, gas and electrical requirements of the orbiters liquid oxygen and liquid hydrogen aft T-0 umbilicals. Launch on mission STS-104 is scheduled for 5:04 a.m. July 12. The launch is the 10th assembly flight to the International Space Station. Along with a crew of five, Atlantis will carry the joint airlock module as primary payload.

STS-84 Insignia

Science.gov (United States)

1996-01-01

The STS-84 emblem depicts the Space Shuttle Atlantis launching into Earth orbit to join the Russian Space Station Mir as part of Phase One of the International Space Station program. The names of the eight astronauts who flew onboard Atlantis, including the two who changed their positions onboard Mir for a long duration flight, are shown along the border of the patch. The STS-84/Mir-23 team will transfer 7,000 pounds of experiments, Station hardware, food and clothing to and from Mir during the five-day period of docking. The Phase One program is represented by the rising Sun and by the Greek letter Phi followed by one star. This sixth Shuttle-Mir docking mission is symbolized by the six stars surrounding the word Mir in Cyrillic characters. Combined, the seven stars symbolize the current configuration of Mir, composed of six modules launched by the Russians and one module brought up by Atlantis on a previous docking flight.

STS, symmetry and post-truth.

Science.gov (United States)

Lynch, Michael

2017-08-01

This essay takes up a series of questions about the connection between 'symmetry' in Science and Technology Studies (STS) and 'post-truth' in contemporary politics. A recent editorial in this journal by Sergio Sismondo argues that current discussions of 'post-truth' have little to do with conceptions of 'symmetry' or with concerns about 'epistemic democracy' in STS, while others, such as Steve Fuller and Harry Collins, insist that there are such connections. The present essay discusses a series of questions about the meaning of 'post-truth' and 'symmetry', and the connections of those concepts to each other and to 'epistemic democracy'. The essay ends with a series of other questions about STS and contemporary politics, and an invitation to further discussions.

STS-26 MS Hilmers on fixed based (FB) shuttle mission simulator (SMS) middeck

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) David C. Hilmers prepares to ascend a ladder representing the interdeck access hatch from the shuttle middeck to the flight deck. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

Board effectiveness: Investigating payment asymmetry between board members and shareholders

Directory of Open Access Journals (Sweden)

Wuchun Chi

2008-01-01

Full Text Available Board members may well be responsible for dissension between themselves and shareholders since they are simultaneously the setters and receivers of both board remuneration and dividends. They may act out of their own personal interests at the expense of external shareholders. We investigate the impact of ownership structure, board structure and control deviation on payment asymmetry, where excessively high remuneration is paid to board members but considerably lower dividends are distributed to shareholders. We find strong evidence confirming that the smaller the shareholdings of board members and outside blockholders are, the more asymmetric the payments are. With controlling family members on the board and a higher percentage of seats held by independent board members, there is a slight reduction in the likelihood and severity of payment asymmetry. In addition, it is abundantly clear that the larger the board seat-control deviation is, the greater is the likelihood and severity of payment asymmetry. While prior research has primarily focused on board-manager agency issues, the board-shareholder perspective could be even more important in that it is the board that is the most directly delegated agent of shareholders, not the managers

On-board processing of video image sequences

DEFF Research Database (Denmark)

Andersen, Jakob Dahl; Chanrion, Olivier Arnaud; Forchhammer, Søren

2008-01-01

and evaluated. On-board there are six video cameras each capturing images of 1024times1024 pixels of 12 bpp at a frame rate of 15 fps, thus totalling 1080 Mbits/s. In comparison the average downlink data rate for these images is projected to be 50 kbit/s. This calls for efficient on-board processing to select...

Effect of grade point average and enrollment in a dental hygiene National Board review course on student performance on the National Board Examination.

Science.gov (United States)

DeWald, Janice P; Gutmann, Marylou E; Solomon, Eric S

2004-01-01

Passing the National Board Dental Hygiene Examination is a requirement for licensure in all but one state. There are a number of preparation courses for the examination sponsored by corporations and dental hygiene programs. The purpose of this study was to determine if taking a board review course significantly affected student performance on the board examination. Students from the last six dental hygiene classes at Baylor College of Dentistry (n = 168) were divided into two groups depending on whether they took a particular review course. Mean entering college grade point averages (GPA), exiting dental hygiene program GPAs, and National Board scores were compared for the two groups using a t-test for independent samples (p < 0.05). No significant differences were found between the two groups for entering GPA and National Board scores. Exiting GPAs, however, were slightly higher for those not taking the course compared to those taking the course. In addition, a strong correlation (0.71, Pearson Correlation) was found between exiting GPA and National Board score. Exiting GPA was found to be a strong predictor of National Board performance. These results do not appear to support this program's participation in an external preparation course as a means of increasing students' performance on the National Board Dental Hygiene Examination.

Simulator testing system (STS)

International Nuclear Information System (INIS)

Miller, V.N.

1990-01-01

In recent years there has been a greater demand placed on the capabilities and time usage of real-time nuclear plant simulators due to NRC, INPO and utilities requirements. The requirements applied to certification, new simulators, upgrades, modifications, and maintenance of the simulators vary; however, they all require the capabilities of the simulator to be tested whether it is for NRC 10CFR55.45b requirements, ATP testing of new simulators, ATP testing of upgrades with or without panels, adding software/hardware due to plant modifications, or analyzing software/hardware problems on the simulator. This paper describes the Simulator Testing System (STS) which addresses each one of these requirements placed on simulators. Special attention will be given to ATP testing of upgrades without the use of control room panels. The capabilities and applications of the four parts of STS which are the Display Control Software (DCS), Procedure Control Software (PCS), Display Generator Software (DGS) and the Procedure Generator Software (PGS) will be reviewed

The impact of a STS/Constructivist learning approach on the beliefs and attitudes of preservice science teachers

Science.gov (United States)

Akcay, Hakan

The purpose of this study was to determine the impact of an Science-Technology-Society (STS) course for preservice science teachers. The course was designed to change not only preservice science teachers' attitudes toward science, scientists and science courses, but also the awareness and use of STS/Constructivist approaches in teaching. It also focuses on changes in preservice science teachers regarding the effectiveness of an STS/Constructivist learning environment. Both qualitative and quantitative research methods were used with and a one-group pretest-posttest design. The instruments were administered to the preservice science teachers at the beginning of the semester as pre-tests and again at the end of the semester as post-tests. Data gathered from pre- and post-administration were analyzed for each of the instruments that provide answers to the research questions. The sample consists of forty-one pre-service science teachers who were enrolled in the Societal & Educational Applications of Biological Concepts course during the spring semester of the 2004 and 2005 academic years at the University of Iowa. The major findings for the study include the following: (1) Preservice science teachers showed significantly growth over the semester in their perceptions concerning STS/Constructivism, beliefs about science teaching and learning, and attitudes toward science and technology, and their implications for society. These significant changes were not affected by gender nor grade (elementary vs secondary) level. (2) Preservice science teachers gain in understanding of how students learn with STS/Constructivist approaches. They also increased their use of STS/Constructivist approaches which were developed and applied to teaching science for all students. (3) Preservice science teachers showed statistically significant growth toward an STS/Constructivist philosophy of science teaching and learning in terms of student actions in the classroom, as well as their

STS-84 M.S. Kondakova with husband Ryumin at SLF

Science.gov (United States)

1997-01-01

STS-84 Mission Specialist Elena V. Kondakova, a cosmonaut with the Russian Space Agency, and her husband, Valery Ryumin, greet press represenatives and other well wishers after her arrival at KSCs Shuttle Landing Facility. Ryumin is director of the Mir- Shuttle program for RSC Energia in Russia. This will be Kondakovas first flight on a U.S. Space Shuttle, but her second trip into space. She spent 169 days in space as flight engineer of the 17th main mission on Mir from October 1994 to March 1995. STS-84 will be the sixth docking of the Space Shuttle with the Russian Space Station Mir. During the docking, STS-84 Mission Specialist C. Michael Foale will transfer to the Russian space station to become a member of the Mir 23 crew, replacing U.S. astronaut Jerry M. Linenger, who will return to Earth on Atlantis. Foale is scheduled to remain on Mir about four months until his replacement arrives on STS-86 in September.

Influence of annealing on the interface-correlated mechanical properties of a Ti/STS clad sheet

Energy Technology Data Exchange (ETDEWEB)

Jo, Yu Mi; Lee, Kwang Seok; Lee, Young-Seon [Korea Institute of Materials Science, Changwon (Korea, Republic of); Kang, Namhyun [Pusan National University, Busan (Korea, Republic of)

2014-01-15

We investigated effects of annealing conditions on the interface-correlated microstructural evolution and subsequent mechanical properties of a Ti/STS439 clad sheet. The evolution of the interface microstructure was first analyzed with optical microscopy, scanning electron microscopy, transmission electron microscopy, and energy dispersive spectroscopy. The generation and growth of a diffusive layer consisted of μm-scale β- Ti adjacent to the parent Ti, and the nm-scale intermetallic compounds Fe{sub 2}Ti and FeTi adjacent to STS phases were indexed. The thicknesses of β-Ti, Fe{sub 2}Ti, and FeTi increased with annealing time and temperature. Mechanical properties were evaluated by peel, micro indentation and uniaxial tensile tests. Improvement of bonding strength between Ti and STS by feasible annealing below 650 ℃ seemed to be strongly related to the generation of considerable metallurgical bonding.

ON-BOARD COMPUTER SYSTEM FOR KITSAT-1 AND 2

Directory of Open Access Journals (Sweden)

H. S. Kim

1996-06-01

Full Text Available KITSAT-1 and 2 are microsatellites weighting 50kg and all the on-board data are processed by the on-board computer system. Hence, these on-board computers require to be highly reliable and be designed with tight power consumption, mass and size constraints. On-board computer(OBC systems for KITSAT-1 and 2 are also designed with a simple flexible hardware for reliability and software takes more responsibility than hardware. KITSAT-1 and 2 on-board computer system consist of OBC 186 as the primary OBC and OBC80 as its backup. OBC186 runs spacecraft operating system (SCOS which has real-time multi-tasking capability. Since their launch, OBC186 and OBC80 have been operating successfully until today. In this paper, we describe the development of OBC186 hardware and software and analyze its in-orbit operation performance.

Effective photoexcitation cross section of 115In(γ,γ′115mIn from photoactivation data

Directory of Open Access Journals (Sweden)

Versteegen M.

2016-01-01

Full Text Available Photoexcitation yields of the 115mIn metastable state were measured with Bremsstrahlung γ beams over a range of endpoint energies between 4.5 and 18 MeV. An effective cross section of the 115In(γ,γ′115mIn photoexcitation cross section was determinedto reproduce the data. This cross section is built from a cross section calculated with the TALYS code, to which an enhancement is added at about 8.5 MeV.

Explorations of Tenth-Grade STS[E] Curricula across Three Provincial Political Landscapes

Science.gov (United States)

Phillips, Christina Ann

This thesis focuses on explorations of science, technology, society and the environment (i.e., STS[E]) outcomes/expectations in tenth-grade level science curricula across three Canadian provinces (i.e., Alberta, Manitoba & Ontario) with distinctive provincial political environments at the time of curriculum construction and/or implementation. Document analysis, discourse analysis and a range of theoretical frameworks (i.e., Levinson, 2010; Pedretti & Nazir, 2011 & Krathwohl, 2002) were used to aid in explorations of STS[E] curriculum segments and discourses in each provincial region. More detailed analysis and thematic exploration is presented for each unit associated with climate change as some interesting patterns emerged following initial analysis. My findings are presented as three comparative case studies and represent a small and original contribution to the large body of scholarly research devoted to studies of STS[E] education, where each province represents a unique case that has been explored regarding some aspects the STS[E] curriculum outcomes/expectations and general political culture as well as some other theoretical factors. Findings from this study indicate that Alberta's STS[E] outcomes may be related to Levinson's (2010) 'deliberative' citizenship focus. The following currents from Pedretti and Nazir (2011) appear to be emphasized: logical reasoning, historical, application & design and socio-cultural aligned outcomes when STS[E] is considered as an entity separate from the Alberta curriculum combination of STS and Knowledge. Ontario's STS[E] expectations may align with Levinson's (2010) 'deliberative' or in some select cases a 'deliberative'/'praxis' framework category with some emphasis related to logical reasoning and socio-cultural awareness (Pedretti & Nazir, 2011) in their STS[E] curriculum. The Manitoba STS[E] outcomes may be aligned with a more 'deliberative' approach with some associations that could intersect with the framework

Board Task Performance

DEFF Research Database (Denmark)

Minichilli, Alessandro; Zattoni, Alessandro; Nielsen, Sabina

2012-01-01

identify three board processes as micro-level determinants of board effectiveness. Specifically, we focus on effort norms, cognitive conflicts and the use of knowledge and skills as determinants of board control and advisory task performance. Further, we consider how two different institutional settings....... The findings show that: (i) Board processes have a larger potential than demographic variables to explain board task performance; (ii) board task performance differs significantly between boards operating in different contexts; and (iii) national context moderates the relationships between board processes...... and board task performance....

STS-38 crewmembers eat meal on OV-104's middeck

Science.gov (United States)

1990-01-01

STS-38 Pilot Frank L. Culbertson, holding spoon to his mouth, prepares to take a bite of food. Mission Specialist (MS) Charles D. Gemar licks his upper lip in anticipation of his next bite. The two crewmembers are on the middeck of Atlantis, Orbiter Vehicle (OV) 104, while enjoying their meal. Behind them are the starboard wall-mounted sleep restraints.

A study on the improvement on the surface characteristics of STS403 stainless steel by chromizing and boronizing

International Nuclear Information System (INIS)

Kim, Kwang Seok; Lee, Sang Yul; Lee, Eui Yeoul

1999-01-01

STS403 stainless steel substrate was treated by duplex treatment of chromizing and boronizing. Metallographic cross sections of the treated specimens were consisted of duplex layer, layer, Cr diffusion layer, and matrix. Microstructures of duplex layer and others layers formed on STS403 were examined by OM, SEM, EDS, XRD and surface properties of duplex layer were evaluated by micro-Vickers hardness tester, wear tester and corrosion tester. From the XRD analysis of the duplex layer, various phases such as FeB, Fe 2 B, CrB were identified. The results from EDS analysis showed that intermedium layer contained much more Cr than any other layers. The activation energy for the diffusion of boron in the chromium diffusion layer in the duplex treated STS403 steel was calculated to be approximately 220kJ/mole, which was higher than the diffusional activation energy of boron in the STS403 steel, 160kJ/mole. Microhardness of duplex layer was measured to be approximately Hv1800∼2000 (50 gf). On high temperature wear testing at 600 .deg. C, duplex treated specimen exhibited an excellent wear resistance, showing that the wear volume of the duplex treated specimen was approximately five times smaller than that of untreated specimen. From the result of anodic polarization curves in 1M, H 2 SO 4 solution, duplex treated specimen showed an excellent corrosion resistance than the specimen treated by boronizing only

Effectiveness of Science-Technology-Society (STS) Instruction on Student Understanding of the Nature of Science and Attitudes toward Science

Science.gov (United States)

Akcay, Behiye; Akcay, Hakan

2015-01-01

The study reports on an investigation about the impact of science-technology-society (STS) instruction on middle school student understanding of the nature of science (NOS) and attitudes toward science compared to students taught by the same teacher using traditional textbook-oriented instruction. Eight lead teachers used STS instruction an…

The AGILE on-board Kalman filter

International Nuclear Information System (INIS)

Giuliani, A.; Cocco, V.; Mereghetti, S.; Pittori, C.; Tavani, M.

2006-01-01

On-board reduction of particle background is one of the main challenges of space instruments dedicated to gamma-ray astrophysics. We present in this paper a discussion of the method and main simulation results of the on-board background filter of the Gamma-Ray Imaging Detector (GRID) of the AGILE mission. The GRID is capable of detecting and imaging with optimal point spread function gamma-ray photons in the range 30MeV-30GeV. The AGILE planned orbit is equatorial, with an altitude of 550km. This is an optimal orbit from the point of view of the expected particle background. For this orbit, electrons and positrons of kinetic energies between 20MeV and hundreds of MeV dominate the particle background, with significant contributions from high-energy (primary) and low-energy protons, and gamma-ray albedo-photons. We present here the main results obtained by extensive simulations of the on-board AGILE-GRID particle/photon background rejection algorithms based on a special application of Kalman filter techniques. This filter is applied (Level-2) sequentially after other data processing techniques characterizing the Level-1 processing. We show that, in conjunction with the Level-1 processing, the adopted Kalman filtering is expected to reduce the total particle/albedo-photon background rate to a value (=<10-30Hz) that is compatible with the AGILE telemetry. The AGILE on-board Kalman filter is also effective in reducing the Earth-albedo-photon background rate, and therefore contributes to substantially increase the AGILE exposure for celestial gamma-ray sources

Board on chemical sciences and technology

International Nuclear Information System (INIS)

1991-01-01

The Board on Chemical Sciences and Technology organizes and provides direction for standing and ad hoc committees charged with addressing specific issues relevant to the continued health of the chemical sciences and technology community. Studies currently under the oversight of the BCST include a major survey of chemical engineering, an examination of the problems of biohazards in the laboratory, and an analysis of the roots and magnitude of the problem of obsolescent facilities for research and teaching in departments in the chemical sciences and engineering. The Board continues to respond to specific agency requests for program assessments and advice. BCST members are designated to serve as liaison with major federal agencies or departments that support research in order to help identify ways for the board to assist the these organizations. The BCST also maintains close contact with professional societies and nongovernmental organizations that share the Board's concern for the health of chemical sciences and technology. Individual Board members are assigned responsibility for liaison with the American Chemical Society, the American Institute of Chemical Engineers, the American Society of Biological Chemists, the Council for Chemical Research, the Chemistry and Biochemistry Sections of the National Academy of Sciences (NAS), and the National Academy of Engineering (NAE). In the past few years, the Board has served as a focus and a forum for a variety of issues that relate specifically to the health of chemistry. A sampling of these concerns include: industry-university cooperation; basic research funding in DOD, DOE, NIH, and NSF; basic research in the chemistry of life processes; basic research in biochemical engineering; basic research in the science and technology of new materials; and undergraduate education in chemistry and chemical engineering

STS-114: Crew Interviews: 1. Jim Kelly 2. Charlie Camarda

Science.gov (United States)

2005-01-01

1) STS-114 Pilot James Kelly mentions his primary job as the Pilot is to back up Commander Eileen Collins all through the flight. James discusses in detail his robotics operations for all of the extravehicular activities and spacewalk work, as well as moving the logistics module back and forth, onto the station and back in the payload bay. He shares his thoughts on the Columbia, the STS-114 mission as a new chapter in space exploration, and the International Space Station. 2) STS-114 Mission Specialist Charlie Camarda discusses his major role in the mission, his feelings for this being his first Space Shuttle flight; shares his thoughts on the Columbia; mentioned that STS-114 is a baby step to what is needed to do for the next step in space exploration, and gave some examples on how the International Space Station can help pave the path to future space exploration.

Advanced Liquid Feed Experiment

Science.gov (United States)

Distefano, E.; Noll, C.

1993-06-01

The Advanced Liquid Feed Experiment (ALFE) is a Hitchhiker experiment flown on board the Shuttle of STS-39 as part of the Space Test Payload-1 (STP-1). The purpose of ALFE is to evaluate new propellant management components and operations under the low gravity flight environment of the Space Shuttle for eventual use in an advanced spacecraft feed system. These components and operations include an electronic pressure regulator, an ultrasonic flowmeter, an ultrasonic point sensor gage, and on-orbit refill of an auxiliary propellant tank. The tests are performed with two transparent tanks with dyed Freon 113, observed by a camera and controlled by ground commands and an on-board computer. Results show that the electronic pressure regulator provides smooth pressure ramp-up, sustained pressure control, and the flexibility to change pressure settings in flight. The ultrasonic flowmeter accurately measures flow and detects gas ingestion. The ultrasonic point sensors function well in space, but not as a gage during sustained low-gravity conditions, as they, like other point gages, are subject to the uncertainties of propellant geometry in a given tank. Propellant transfer operations can be performed with liquid-free ullage equalization at a 20 percent fill level, gas-free liquid transfer from 20-65 percent fill level, minimal slosh, and can be automated.

41 CFR 101-4.115 - Assurance required.

Science.gov (United States)

2010-07-01

... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 101-4.115 Assurance... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Assurance required. 101-4.115 Section 101-4.115 Public Contracts and Property Management Federal Property Management Regulations...

7 CFR 1160.115 - Milk marketing area.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Milk marketing area. 1160.115 Section 1160.115 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Order Definitions § 1160.115 Milk marketing area. Milk marketing area means each area within which milk...

Board members’ contribution to strategy: The mediating role of board internal processes

Directory of Open Access Journals (Sweden)

Carmen Barroso-Castro

2017-05-01

Full Text Available This study aims to explore what directors do on the board, to what extent the processes occurring in the board allow the sharing and integrating of the existing knowledge, thus facilitating the board members’ contributions to strategy. We adopt the view that the internal board processes increase the impact of the cognitive resources on board performance. Using survey data from 200 large Spanish companies we demonstrate that directors’ level of knowledge of the firm and board job-related diversity positively influence the degree of the board's strategic involvement. Additionally, the internal processes that take place within the board – particularly Cognitive Conflict, the Critical and Independent Approach and the Comprehensive Discussion Process – influence the board's strategic involvement and play a partial mediating role on the aforementioned relationships. However, our results show no evidence for a positive relationship between Board Meeting Dynamics and the board's strategic involvement.

A Study on the Characteristics of Corrosion in Cold Worked Flexible STS 304 Stainless Steel Pipes

International Nuclear Information System (INIS)

Kim, In Soo; Kim, Sung Jin

1993-01-01

Effects of cold working on the corrosion resistance of austenitic STS 304 stainless steel pipes were investigated using anodic polarization method, EDX analysis and SEM technique. Corrosion products had a lots of S and Cl - ion. Generally, corrosion patterns as a result of STS 304 stainless steel to concrete environment were proceeded in the order of the pitting to intergranular corrosion. In the case of the flexible pipes were covered tightly with other polymer materials, crevice corrosion occurred to a much greater extent on austenitic than on martensitic region

STS-93 Commander Eileen Collins waves to her family

Science.gov (United States)

1999-01-01

STS-93 Commander Eileen M. Collins waves to her family nearby, a last meeting before launch of mission STS-93 on July 20. Liftoff is scheduled for 12:36 a.m. EDT. The primary mission of STS-93 is the release of the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected to unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Steven A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

49 CFR 209.115 - Hearing.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Hearing. 209.115 Section 209.115 Transportation... Hearing. (a) When a hearing is requested and scheduled under § 209.113, a hearing officer designated by the Chief Counsel convenes and presides over the hearing. If requested by respondent and if...

Specialty Board on Fluency Disorders

Science.gov (United States)

... or large groups of speech-language pathologists. Speech-language pathologists who are Board Certified Specialists in Fluency may be found on this website by searching name, city(location) or zip code. ...

Low earth orbit radiation dose distribution in a phantom head

International Nuclear Information System (INIS)

Konradi, A.; Badhwar, G.D.; Cash, B.L.; Hardy, K.A.

1992-01-01

In order to compare analytical methods with data obtained during exposure to space radiation, a phantom head instrumented with a large number of radiation detectors was flown on the Space Shuttle on three occasions: 8 August 1989 (STS-28), 28 February 1990 (STS-36), and 24 April 1990 (STS-31). The objective of this experiment was to obtain a measurement of the inhomogeneity in the dose distribution within a phantom head volume. The orbits of these missions were complementary-STS-28 and STS-36 had high inclination and low altitude, while STS-31 had a low inclination and high altitude. In the cases of STS-28 and STS-36, the main contribution to the radiation dose comes from galactic cosmic rays (GCR) with a minor to negligible part supplied by the inner belt through the South Atlantic Anomaly (SAA), and for STS-28 an even smaller one from a proton enhancement during a solar flare-associated proton event. For STS-31, the inner belt protons dominate and the GCR contribution is almost negligible. The internal dose distribution is consistent with the mass distribution of the orbiter and the self-shielding and physical location of the phantom head. (author)

13 CFR 115.20 - Insolvency of Surety.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Insolvency of Surety. 115.20 Section 115.20 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND GUARANTEE Provisions for All Surety Bond Guarantees § 115.20 Insolvency of Surety. (a) Successor in interest. If a...

7 CFR 900.115 - Hearing.

Science.gov (United States)

2010-01-01

... 7 Agriculture 8 2010-01-01 2010-01-01 false Hearing. 900.115 Section 900.115 Agriculture... Hearing. (a) The arbitrator shall have full discretion to conduct the hearing in such manner as will, in..., and other experts. (h) When more than two arbitrators are designated to hear a dispute, and they...

46 CFR 115.655 - Hull examination reports.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Hull examination reports. 115.655 Section 115.655... CERTIFICATION Hull and Tailshaft Examinations § 115.655 Hull examination reports. (a) If you use only divers for the underwater survey portion of the Alternative Hull Examination (AHE), you must provide the Officer...

49 CFR 230.115 - Feed water tanks.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Feed water tanks. 230.115 Section 230.115... Tenders Steam Locomotive Tanks § 230.115 Feed water tanks. (a) General provisions. Tanks shall be maintained free from leaks, and in safe and suitable condition for service. Suitable screens must be provided...

FASB (Financial Accounting Standards Board) issues new accounting rules for debt and equity securities.

Science.gov (United States)

Reinstein, A; Bayou, M E

1994-10-01

The Financial Accounting Standards Board (FASB) recently issued a new statement that requires all companies to change their methods of accounting for debt and equity securities. Rather than allowing organizations to use a historical cost approach in accounting for such financial instruments, FASB Statement No. 115 requires organizations to adopt a market value approach. The provisions of this statement will affect significantly organizations in the healthcare industry that have large investment portfolios.

13 CFR 115.15 - Underwriting and servicing standards.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Underwriting and servicing standards. 115.15 Section 115.15 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND... underwriting and the Surety's principles and practices on unguaranteed bonds. The Principal must satisfy the...

US DOE Perspectives on Advisory Board Effectiveness - 13539

International Nuclear Information System (INIS)

Adler, David

2013-01-01

Federal missions on the Oak Ridge Reservation began with the Manhattan Project, and continues today with major facilities supporting the Nation's Science and National Security missions. While most of the land area on the Oak Ridge Reservation is free of environmental impacts from these activities, significant legacy contamination is associated with specific facilities and past waste management areas. In 1989, the Oak Ridge Reservation (ORR) was placed on National Priorities List, and DOE established its Office of Environmental Management that same year. Three years later, in 1992, the Federal Facility Agreement for the reservation was signed. Three years afterward, the Oak Ridge Site Specific Advisory Board was established to augment ongoing public involvement activities related to Oak Ridge Reservation cleanup activities. One of the early and most impactful decisions the board made was to organize the End Use Working Group. This broad-based group of board members, DOE representatives, and members of the public was formed in 1997 to study future uses for contaminated areas of the reservation. The group was instrumental in building consensus in the Oak Ridge community regarding the long-term end state of reservation lands. The group's recommendations were a fundamental input into Record's of Decision subsequently developed to establish cleanup requirements across the ORR, and they continue to influence decisions being made today. In developing its recommendations on end states, the End Use Working Group came to the realization that long-term stewardship of contaminated areas of the reservation would be necessary, in some cases in perpetuity. It was from this concept that the Oak Ridge SSAB's 15-year involvement in stewardship would begin. A stewardship committee formed by the End Use Working Group wrote Volume 1 of the Stakeholder Report on Stewardship. This document-and its companion Volume 2, which was written a year later-form a crucial foundation for stewardship

US DOE Perspectives on Advisory Board Effectiveness - 13539

Energy Technology Data Exchange (ETDEWEB)

Adler, David [US DOE (United States)

2013-07-01

Federal missions on the Oak Ridge Reservation began with the Manhattan Project, and continues today with major facilities supporting the Nation's Science and National Security missions. While most of the land area on the Oak Ridge Reservation is free of environmental impacts from these activities, significant legacy contamination is associated with specific facilities and past waste management areas. In 1989, the Oak Ridge Reservation (ORR) was placed on National Priorities List, and DOE established its Office of Environmental Management that same year. Three years later, in 1992, the Federal Facility Agreement for the reservation was signed. Three years afterward, the Oak Ridge Site Specific Advisory Board was established to augment ongoing public involvement activities related to Oak Ridge Reservation cleanup activities. One of the early and most impactful decisions the board made was to organize the End Use Working Group. This broad-based group of board members, DOE representatives, and members of the public was formed in 1997 to study future uses for contaminated areas of the reservation. The group was instrumental in building consensus in the Oak Ridge community regarding the long-term end state of reservation lands. The group's recommendations were a fundamental input into Record's of Decision subsequently developed to establish cleanup requirements across the ORR, and they continue to influence decisions being made today. In developing its recommendations on end states, the End Use Working Group came to the realization that long-term stewardship of contaminated areas of the reservation would be necessary, in some cases in perpetuity. It was from this concept that the Oak Ridge SSAB's 15-year involvement in stewardship would begin. A stewardship committee formed by the End Use Working Group wrote Volume 1 of the Stakeholder Report on Stewardship. This document-and its companion Volume 2, which was written a year later-form a crucial

AGB Statement on Board Responsibility for the Oversight of Educational Quality

Science.gov (United States)

Association of Governing Boards of Universities and Colleges, 2011

2011-01-01

This "Statement on Board Responsibility for the Oversight of Educational Quality," approved by the Board of Directors of the Association of Governing Boards (AGB) in March 2011, urges institutional administrators and governing boards to engage fully in this area of board responsibility. The seven principles in this statement offer suggestions to…

STS-26 MS Nelson on fixed based (FB) shuttle mission simulator (SMS) middeck

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) George D. Nelson trains on the middeck of the fixed based (FB) shuttle mission simulator (SMS). Nelson, wearing communications assembly headset, adjusts camera mounting bracket.

46 CFR 115.802 - Hull.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Hull. 115.802 Section 115.802 Shipping COAST GUARD....802 Hull. (a) At each initial and subsequent inspection for certification of a vessel, the owner or managing operator shall be prepared to conduct tests and have the vessel ready for inspections of the hull...

Light-weight Self-correcting Inflatable/rigidizable Space Antennas, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — The NASA/L'Garde Inflatable Antenna Experiment (IAE)flown in STS-77 has showed the potential of this class of structures in significantly reducing the costs for...

Network on chip master control board for neutron acquisition

International Nuclear Information System (INIS)

Ruiz-Martinez, E.; Mary, T.; Mutti, P.; Ratel, J.; Rey, F.

2012-01-01

The acquisition master control board is designed to assemble the various acquisition modes in use at the Institut Laue-Langevin (ILL). The main goal is to make the card common for all the ILL's instruments in a simple, modular and open way, giving the possibility to add new functionalities in order to follow the evolving demand. It has been necessary to define a central element to provide synchronization to the rest of the units. The backbone of the proposed acquisition control system is the denominated master acquisition board. The master board consists on a VME64X configurable high density I/O connection carrier board based on the latest Xilinx Virtex-6T FPGA. The internal architecture of the FPGA is designed as a Network on Chip (NoC) approach. The complete system also includes a display board and n histogram modules for live display of the data from the detectors. (authors)

78 FR 44954 - Advisory Board on Radiation and Worker Health (ABRWH or Advisory Board), National Institute for...

Science.gov (United States)

2013-07-25

... provided to the contact person below in advance of the meeting. Background: The Advisory Board was... President on a variety of policy and technical functions required to implement and effectively manage the new compensation program. Key functions of the Advisory Board include providing advice on the...

MedAustron board visits CERN

CERN Multimedia

CERN Bulletin

On 14 October, the board of EBG MedAustron, which is overseeing the construction of Austria’s hadron therapy centre, visited CERN. The visit recognized the relationship of shared knowledge, technology and training between CERN and MedAustron.   Normal.dotm 0 0 1 17 98 cern 1 1 120 12.0 0 false 18 pt 18 pt 0 0 false false false /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:12.0pt; font-family:"Times New Roman"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} ...

46 CFR 115.910 - Passenger Ship Safety Certificate.

Science.gov (United States)

2010-10-01

...) The route specified on the Certificate of Inspection and the SOLAS Passenger Ship Safety Certificate... 46 Shipping 4 2010-10-01 2010-10-01 false Passenger Ship Safety Certificate. 115.910 Section 115... MORE THAN 150 PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS INSPECTION AND...

19 CFR 207.115 - Petition for review.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Petition for review. 207.115 Section 207.115... and Committee Proceedings § 207.115 Petition for review. (a) The petition and responses. (1) Any party... Secretary a petition for review, except that a party who has defaulted may not petition for review of any...

13 CFR 115.65 - General PSB procedures.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false General PSB procedures. 115.65 Section 115.65 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND GUARANTEE Preferred Surety Bond (PSB) Guarantees § 115.65 General PSB procedures. (a) Retention of information. A PSB Surety must comply with all applicable SBA...

49 CFR 215.115 - Defective roller bearing.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective roller bearing. 215.115 Section 215.115... § 215.115 Defective roller bearing. (a) A railroad may not place or continue in service a car, if the car has— (1) A roller bearing that shows signs of having been overheated as evidenced by— (i...

Magnetic field on board

International Nuclear Information System (INIS)

Estevez Radio, H.; Fernandez Arenal, C.A.

1995-01-01

Here, the calculation of the magnetic field on board ships is performed, using matrix calculus, in a similar way as when the magnetic field in matter is studied. Thus the final formulas are written in a more compact form and they are obtained through a simpler way, more suitable for the university education. (Author)

Effects of administration of the standardized Panax ginseng extract G115 on hepatic antioxidant function after exhaustive exercise.

Science.gov (United States)

Voces, J; Alvarez, A I; Vila, L; Ferrando, A; Cabral de Oliveira, C; Prieto, J G

1999-06-01

The effect of prolonged treatment with the standardized Panax ginseng extract G115 on the antioxidant capacity of the liver was investigated. For this purpose, rats that had received G115 orally at different doses for 3 months and untreated control rats were subjected to exhaustive exercise on a treadmill. A bell-shaped dose response on running time was obtained. The results showed that the administration of G115 significantly increases the hepatic glutathione peroxidase activity (GPX) and the reduced glutathione (GSH) levels in the liver, with a dose-dependent reduction of the thiobarbituric acid reactant substances (TBARS). After the exercise, there is reduced hepatic lipid peroxidation, as evidenced by the TBARS levels in both the controls and the treated animals. The GPX (glutathione peroxidase) and SOD (superoxide dismutase) activity are also significantly increased in the groups receiving G115, compared with the controls. The hepatic transaminase levels, ALT (Alanine-amino-transferase) and AST (Aspartate-amino-transferase), in the recuperation phase 48 h after the exercise, indicate a clear hepatoprotective effect related to the administration of the standardized Panax ginseng extract G115. At hepatic level, G115 increases the antioxidant capacity, with a marked reduction of the effects of the oxidative stress induced by the exhaustive exercise.

STS-82 Pilot Scott Horowitz arrives for TCDT

Science.gov (United States)

1997-01-01

STS-82 Pilot Scott J. 'Doc' Horowitz arrives at KSCs Shuttle Landing Facility in a T-38 jet from Houston, TX. Horowitz and the other six crew members are at KSC to participate in the Terminal Countdown Demonstration Test (TCDT), a dress rehearsal for launch. The crew aboard the Space Shuttle Discovery on STS-82 will conduct the second Hubble Space Telescope servicing mission. The 10-day flight is targeted for a Feb. 11 liftoff.

Hospital ownership, decisions on supervisory board characteristics, and financial performance.

Science.gov (United States)

Kuntz, Ludwig; Pulm, Jannis; Wittland, Michael

2016-01-01

Dynamic and complex transformations in the hospital market increase the relevance of good corporate governance. However, hospital performance and the characteristics of supervisory boards differ depending on ownership. The question therefore arises whether hospital owners can influence performance by addressing supervisory board characteristics. The objective of this study is to explain differences in the financial performance of hospitals with regard to ownership by studying the size and composition of supervisory boards. The AMADEUS database was used to collect information on hospital financial performance in 2009 and 2010. Business and quality reports, hospital websites, and data from health insurer were used to obtain information on hospital and board characteristics. The resulting sample consisted of 175 German hospital corporations. We utilized ANOVA and regression analysis to test a mediation hypothesis that investigated whether decisions regarding board size and composition were associated with financial performance and could explain performance differences. Financial performance and board size and composition depend on ownership. An increase in board size and greater politician participation were negatively associated with all five tested measures of financial performance. Furthermore, an increase in physician participation was positively associated with one dimension of financial performance, whereas one negative relationship was identified for nurse and economist participation. For clerics, no associations were found. Decisions concerning board size and composition are important as they relate to hospital financial performance. We contribute to existing research by showing that, in addition to board size and physician participation, the participation of other professionals can also influence financial performance.

Governing board of the pension fund

CERN Multimedia

2003-01-01

The Governing Board held its 115th meeting on 8 April 2003, which, as usual at this time of year, was devoted to examination of the Annual Report and the annual accounts, in the present case for 2002, which it approved. On the financial results side, 2002 was a particularly difficult year for all pension funds. The average returns of provident institutions in Europe and the United States frequently recorded losses in asset values in excess of 10%. The Pension Fund's result was -5.5%, which, to set it in perspective, places it amongst the category of the least bad results internationally. In this regard, it should be borne in mind that as in 2001 the Investment Committee, which is responsible for asset allocation that determines 80% of the performance, avoided further exposure to equities markets in 2002, deliberately reducing its allocation in this sector. As a result, plus the fact that the bond portfolio has also been reduced, short-term liquid assets far exceeded their basic strategic allocation of 4%, end...

Women on boards and corporate social responsibility

Directory of Open Access Journals (Sweden)

Francesca Gennari

2016-02-01

Full Text Available Data by EU Commission show a low representation of women on boards. The scope of this article is to read contemporary and according to a managerial approach the possible causes of this situation: the availability of skills possessed by women to cover top positions, the presence of binding or self-regulatory rules and the corporate culture towards CSR approach. Our research is focused on EU countries, where the gender equality on board is currently matter of attention and regulatory interventions. We conclude that the scarce presence of women in the boardrooms is not ascribable to a scarcity of expertise, but it is associated with a social background and a corporate culture not inspired by corporate global responsibility values. Regulatory interventions may accelerate the consciousness of gender balance on boards, but without companies’ commitment in CSR matters and without a clear vision of corporate global responsibility (including economic, social and environmental aspects, they tend to become additional tasks in the management of corporate compliance risk.

STS-103 Pilot Scott Kelly and MS John Grunsfeld try on oxygen masks

Science.gov (United States)

1999-01-01

In the bunker at Launch Pad 39B, STS-103 Pilot Scott J. Kelly (left) and Mission Specialist John M. Grunsfeld (Ph.D.) (right) try on oxygen masks during Terminal Countdown Demonstration Test (TCDT) activities. The TCDT provides the crew with emergency egress training, opportunities to inspect their mission payloads in the orbiter's payload bay, and simulated countdown exercises. Other crew members taking part are Commander Curtis L. Brown Jr. and Mission Specialists Steven L. Smith, C. Michael Foale (Ph.D.), and Jean-Frangois Clervoy of France and Claude Nicollier of Switzerland, who are with the European Space Agency. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope, including the gyroscopes that allow the telescope to point at stars, galaxies and planets. The STS-103 crew will be replacing a Fine Guidance Sensor, an older computer with a new enhanced model, an older data tape recorder with a solid-state digital recorder, a failed spare transmitter with a new one, and degraded insulation on the telescope with new thermal insulation. The crew will also install a Battery Voltage/Temperature Improvement Kit to protect the spacecraft batteries from overcharging and overheating when the telescope goes into a safe mode. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

Results on artemia cysts, lettuce and tobacco seeds in the Biobloc 4 experiment flown aboard the Soviet biosatellite Cosmos 1129

International Nuclear Information System (INIS)

Gaubin, Y.; Planel, H.; Gasset, G.; Pianezzi, B.

1983-01-01

The effects of space flight factors, in particular the heavy ion component of cosmic rays, on dormant stages of life forms were investigated as part of the Biobloc 4 experiment flown aboard the Cosmos 1129 biosatellite. Artemia cysts and seeds of tobacco and lettuce plants were placed in tubes and in monolayers sandwiched between layers of visual particle track detectors. Although Artemia cysts exposed in the dry state did not differ from ground controls, hydrated cysts exhibited a slight decrease in hatchability and reduced (C-14)O2 incorporation and protein and nucleic acid synthesis. For cysts held in the monolayers, hits by HZE particles were observed to stimulate emergence, hatching and survival. Higher proportions of chromosomal aberrations were found in lettuce seeds hit by HZE particles, while space flight produced a stimulatory effect on both germination rate and abnormality frequency in both hit and nonhit tobacco seeds. 9 references

Impact of post-intubation interventions on mortality in patients boarding in the emergency department.

Science.gov (United States)

Bhat, Rahul; Goyal, Munish; Graf, Shannon; Bhooshan, Anu; Teferra, Eshetu; Dubin, Jeffrey; Frohna, Bill

2014-09-01

Emergency physicians frequently perform endotracheal intubation and mechanical ventilation. The impact of instituting early post-intubation interventions on patients boarding in the emergency department (ED) is not well studied. We sought to determine the impact of post-intubation interventions (arterial blood gas sampling, obtaining a chest x-ray (CXR), gastric decompression, early sedation, appropriate initial tidal volume, and quantitative capnography) on outcomes of mortality, ventilator-associated pneumonia (VAP), ventilator days, and intensive care unit (ICU) length-of-stay (LOS). This was an observational, retrospective study of patients intubated in the ED at a large tertiary-care teaching hospital and included patients in the ED for greater than two hours post-intubation. We excluded them if they had incomplete data, were designated "do not resuscitate," were managed primarily by the trauma team, or had surgery within six hours after intubation. Of 169 patients meeting criteria, 15 died and 10 developed VAP. The mortality odds ratio (OR) in patients receiving CXR was 0.10 (95% CI 0.01 to 0.98), and 0.11 (95% CI 0.03 to 0.46) in patients receiving early sedation. The mortality OR for patients with 3 or fewer interventions was 4.25 (95% CI 1.15 to 15.75) when compared to patients with 5 or more interventions. There was no significant relationship between VAP rate, ventilator days, or ICU LOS and any of the intervention groups. The performance of a CXR and early sedation as well as performing five or more vs. three or fewer post-intubation interventions in boarding adult ED patients was associated with decreased mortality.

STS-32 Commander Brandenstein adjusts IMAX camera during training session

Science.gov (United States)

1989-01-01

STS-32 Commander Daniel C. Brandenstein adjusts IMAX camera setting during briefing and training session as technician looks on. The session was conducted in the JSC Mockup and Integration Laboratory (MAIL) Bldg 9B. The IMAX camera will be used onboard Columbia, Orbiter Vehicle (OV) 102, during the STS-32 mission.

STS-9 crewmembers in training session in bldg 9A

Science.gov (United States)

1983-01-01

Members of the STS-9 crew discuss flight procedures with a trainer in bldg 9A before the STS-9 mission. From left to right are Brewster Shaw, pilot; John Young, crew commander; Robert Parker, mission specialist; and unidentified trainer. They are reviewing procedures manuals on the shuttle mock-up hatch.

Merging polygons on two-layer printed circuit board

Directory of Open Access Journals (Sweden)

Murov S. Yu.

2011-12-01

Full Text Available A method is proposed for solving the problem of connection of maximum number of isolated islands of metallized areas of the same chain, located on different layers of the printed circuit board. The method can be used in the automatic tracing of the boards.

Gene Expression Profiling in Slow-Type Calf Soleus Muscle of 30 Days Space-Flown Mice.

Directory of Open Access Journals (Sweden)

Guido Gambara

Full Text Available Microgravity exposure as well as chronic disuse are two main causes of skeletal muscle atrophy in animals and humans. The antigravity calf soleus is a reference postural muscle to investigate the mechanism of disuse-induced maladaptation and plasticity of human and rodent (rats or mice skeletal musculature. Here, we report microgravity-induced global gene expression changes in space-flown mouse skeletal muscle and the identification of yet unknown disuse susceptible transcripts found in soleus (a mainly slow phenotype but not in extensor digitorum longus (a mainly fast phenotype dorsiflexor as functional counterpart to soleus. Adult C57Bl/N6 male mice (n = 5 flew aboard a biosatellite for 30 days on orbit (BION-M1 mission, 2013, a sex and age-matched cohort were housed in standard vivarium cages (n = 5, or in a replicate flight habitat as ground control (n = 5. Next to disuse atrophy signs (reduced size and myofiber phenotype I to II type shift as much as 680 differentially expressed genes were found in the space-flown soleus, and only 72 in extensor digitorum longus (only 24 genes in common compared to ground controls. Altered expression of gene transcripts matched key biological processes (contractile machinery, calcium homeostasis, muscle development, cell metabolism, inflammatory and oxidative stress response. Some transcripts (Fzd9, Casq2, Kcnma1, Ppara, Myf6 were further validated by quantitative real-time PCR (qRT-PCR. Besides previous reports on other leg muscle types we put forth for the first time a complete set of microgravity susceptible gene transcripts in soleus of mice as promising new biomarkers or targets for optimization of physical countermeasures and rehabilitation protocols to overcome disuse atrophy conditions in different clinical settings, rehabilitation and spaceflight.

77 FR 3240 - Board on Coastal Engineering Research

Science.gov (United States)

2012-01-23

... broad policy guidance and review of plans and fund requirements for the conduct of research and... objectives of the Chief of Engineers. Proposed Agenda: On Tuesday, February 7, the Executive Session is... Board, discussion of the Board functions and responsibilities, and ways to enhance the value of the...

L-Area STS MTR/NRU/NRX Grapple Assembly Closure Mechanics Review

International Nuclear Information System (INIS)

Huizenga, D. J.

2016-01-01

A review of the closure mechanics associated with the Shielded Transfer System (STS) MTR/NRU/NRX grapple assembly utilized at the Savannah River Site (SRS) was performed. This review was prompted by an operational event which occurred at the Canadian Nuclear Laboratories (CNL) utilizing a DTS-XL grapple assembly which is essentially identical to the STS MTR/NRU/NRX grapple assembly used at the SRS. The CNL operational event occurred when a NRU/NRX fuel basket containing spent nuclear fuel assemblies was inadvertently released by the DTS-XL grapple assembly during a transfer. The SM review of the STS MTR/NRU/NRX grapple assembly will examine the operational aspects of the STS and the engineered features of the STS which prevent such an event at the SRS. The design requirements for the STS NRU/NRX modifications and the overall layout of the STS are provided in other documents.

Optimization of Planck-LFI on-board data handling

Energy Technology Data Exchange (ETDEWEB)

Maris, M; Galeotta, S; Frailis, M; Zacchei, A; Fogliani, S; Gasparo, F [INAF-OATs, Via G.B. Tiepolo 11, 34131 Trieste (Italy); Tomasi, M; Bersanelli, M [Universita di Milano, Dipartimento di Fisica, Via G. Celoria 16, 20133 Milano (Italy); Miccolis, M [Thales Alenia Space Italia S.p.A., S.S. Padana Superiore 290, 20090 Vimodrone (Italy); Hildebrandt, S; Chulani, H; Gomez, F [Instituto de Astrofisica de Canarias (IAC), C/o Via Lactea, s/n E38205 - La Laguna, Tenerife (Spain); Rohlfs, R; Morisset, N; Binko, P [ISDC Data Centre for Astrophysics, University of Geneva, ch. d' Ecogia 16, 1290 Versoix (Switzerland); Burigana, C; Butler, R C; Cuttaia, F; Franceschi, E [INAF-IASF Bologna, Via P. Gobetti, 101, 40129 Bologna (Italy); D' Arcangelo, O, E-mail: maris@oats.inaf.i [IFP-CNR, via Cozzi 53, 20125 Milano (Italy)

2009-12-15

To asses stability against 1/f noise, the Low Frequency Instrument (LFI) on-board the Planck mission will acquire data at a rate much higher than the data rate allowed by the science telemetry bandwith of 35.5 Kbps. The data are processed by an on-board pipeline, followed on-ground by a decoding and reconstruction step, to reduce the volume of data to a level compatible with the bandwidth while minimizing the loss of information. This paper illustrates the on-board processing of the scientific data used by Planck/LFI to fit the allowed data-rate, an intrinsecally lossy process which distorts the signal in a manner which depends on a set of five free parameters (N{sub aver}, r{sub 1}, r{sub 2}, q, O) for each of the 44 LFI detectors. The paper quantifies the level of distortion introduced by the on-board processing as a function of these parameters. It describes the method of tuning the on-board processing chain to cope with the limited bandwidth while keeping to a minimum the signal distortion. Tuning is sensitive to the statistics of the signal and has to be constantly adapted during flight. The tuning procedure is based on a optimization algorithm applied to unprocessed and uncompressed raw data provided either by simulations, pre-launch tests or data taken in flight from LFI operating in a special diagnostic acquisition mode. All the needed optimization steps are performed by an automated tool, OCA2, which simulates the on-board processing, explores the space of possible combinations of parameters, and produces a set of statistical indicators, among them: the compression rate C{sub r} and the processing noise epsilon{sub Q}. For Planck/LFI it is required that C{sub r} = 2.4 while, as for other systematics, epsilon{sub Q} would have to be less than 10% of rms of the instrumental white noise. An analytical model is developed that is able to extract most of the relevant information on the processing errors and the compression rate as a function of the signal

Plant 115-kDa actin-filament bundling protein, P-115-ABP, is a homologue of plant villin and is widely distributed in cells.

Science.gov (United States)

Yokota, Etsuo; Vidali, Luis; Tominaga, Motoki; Tahara, Hiroshi; Orii, Hidefumi; Morizane, Yosuke; Hepler, Peter K; Shimmen, Teruo

2003-10-01

In many cases, actin filaments are arranged into bundles and serve as tracks for cytoplasmic streaming in plant cells. We have isolated an actin-filament bundling protein, which is composed of 115-kDa polypeptide (P-115-ABP), from the germinating pollen of lily, Lilium longiflorum [Nakayasu et al. (1998) BIOCHEM: Biophys. Res. Commun. 249: 61]. P-115-ABP shared similar antigenicity with a plant 135-kDa actin-filament bundling protein (P-135-ABP), a plant homologue of villin. A full-length cDNA clone (ABP115; accession no. AB097407) was isolated from an expression cDNA library of lily pollen by immuno-screening using antisera against P-115-ABP and P-135-ABP. The amino acid sequence of P-115-ABP deduced from this clone showed high homology with those of P-135-ABP and four villin isoforms of Arabidopsis thaliana (AtVLN1, AtVLN2, AtVLN3 and AtVLN4), especially AtVLN4, indicating that P-115-ABP can also be classified as a plant villin. The P-115-ABP isolated biochemically from the germinating lily pollen was able to arrange F-actin filaments with uniform polarity into bundles and this bundling activity was suppressed by Ca2+-calmodulin (CaM), similar to the actin-filament bundling properties of P-135-ABP. The P-115-ABP type of plant villin was widely distributed in plant cells, from algae to land plants. In root hair cells of Hydrocharis dubia, this type of plant villin was co-localized with actin-filament bundles in the transvacuolar strands and the sub-cortical regions. Microinjection of the antiserum against P-115-ABP into living root hair cells caused the disappearance of transvaculor strands and alteration of the route of cytoplasmic streaming. In internodal cells of Chara corallina in which the P-135-ABP type of plant villin is lacking, the P-115-ABP type showed co-localization with actin-filament cables anchored on the intracellular surface of chloroplasts. These results indicated that plant villins are widely distributed and involved in the organization of actin

The development of STS payload environmental engineering standards

Science.gov (United States)

Bangs, W. F.

1982-01-01

The presently reported effort to provide a single set of standards for the design, analysis and testing of Space Transportation System (STS) payloads throughout the NASA organization must be viewed as essentially experimental, since the concept of incorporating the diverse opinions and experiences of several separate field research centers may in retrospect be judged too ambitious or perhaps even naive. While each STS payload may have unique characteristics, and the project should formulate its own criteria for environmental design, testing and evaluation, a reference source document providing coordinated standards is expected to minimize the duplication of effort and limit random divergence of practices among the various NASA payload programs. These standards would provide useful information to all potential STS users, and offer a degree of standardization to STS users outside the NASA organization.

Germination, growth rates, and electron microscope analysis of tomato seeds flown on the LDEF

Science.gov (United States)

Hammond, Ernest C., Jr.; Bridgers, Kevin; Brown, Cecelia Wright

1995-01-01

The tomato seeds were flown in orbit aboard the Long Duration Exposure Facility (LDEF) for nearly six years. During this time, the tomato seeds received an abundant exposure to cosmic radiation and solar wind. Upon the return of the LDEF to earth, the seeds were distributed throughout the United States and 30 foreign countries for analysis. The purpose of the experiment was to determine the long term effect of cosmic rays on living tissue. Our university analysis included germination and growth rates as well as Scanning Electron Microscopy and X-ray analysis of the control as well as Space-exposed tomato seeds. In analyzing the seeds under the Electron Microscope, usual observations were performed on the nutritional and epidermis layer of the seed. These layers appeared to be more porous in the Space-exposed seeds than on the Earth-based control seeds. This unusual characteristic may explain the increases in the space seeds growth pattern. (Several test results show that the Space-exposed seeds germinate sooner than the Earth-Based seeds. Also, the Space-exposed seeds grew at a faster rate). The porous nutritional region may allow the seeds to receive necessary nutrients and liquids more readily, thus enabling the plant to grow at a faster rate. Roots, leaves and stems were cut into small sections and mounted. After sputter coating the specimens with Argon/Gold Palladium Plasma, they were ready to be viewed under the Electron Microscope. Many micrographs were taken. The X-ray analysis displayed possible identifications of calcium, potassium, chlorine, copper, aluminum, silicon, phosphate, carbon, and sometimes sulfur and iron. The highest concentrations were shown in potassium and calcium. The Space-exposed specimens displayed a high concentration of copper and calcium in the two specimens. There was a significantly high concentration of copper in the Earth-based specimens, whereas there was no copper in the Space-exposed specimens.

13 CFR 115.34 - Minimization of Surety's Loss.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Minimization of Surety's Loss. 115.34 Section 115.34 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND GUARANTEE... strategy in maximizing recovery. See also § 115.17(b). ...

24 CFR 115.206 - Performance assessments; Performance standards.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Performance assessments; Performance standards. 115.206 Section 115.206 Housing and Urban Development Regulations Relating to Housing... AGENCIES Certification of Substantially Equivalent Agencies § 115.206 Performance assessments; Performance...

Teacher beliefs about teaching science through Science-Technology-Society (STS)

Science.gov (United States)

Massenzio, Lynn

2001-07-01

Statement of the problem. As future citizens, students will have the enormous responsibility of making decisions that will require an understanding of the interaction of science and technology and its interface with society. Since many societal issues today are grounded in science and technology, learning science in its social context is vital to science education reform. Science-Technology-Society (STS) has been strongly identified with meeting this goal, but despite its benefits, putting theory into practice has been difficult. Research design and methodology. The purpose of this study was to explore teacher beliefs about teaching science through STS. The following broad research questions guided the study: (1) What are the participants' initial beliefs about teaching science through STS? (2) What beliefs emerge as participants reflect upon and share their STS instructional experiences with their peers? A social constructivist theoretical framework was developed to plan interactions and collect data. Within this framework, a qualitative methodology was used to interpret the data and answer the research questions. Three provisionally certified science teachers engaged in a series of qualitative tasks including a written essay, verbal STS unit explanation, reflective journal writings, and focus group interviews. After implementing their STS unit, the participants engaged in meaningful dialogue with their peers as they reflected upon, shared, and constructed their beliefs. Conclusions. The participants strongly believed in STS as a means for achieving scientific and technological literacy, developing cognition, enhancing scientific habits of mind and affective qualities, and fostering citizen responsibility. Four major assertions were drawn: (a) Participants' initial belief in teaching for citizen responsibility did not fully align with practice, (b) Educators at the administrative level should be made aware of the benefits of teaching science through STS, (c

49 CFR 395.15 - Automatic on-board recording devices.

Science.gov (United States)

2010-10-01

... information concerning on-board system sensor failures and identification of edited data. Such support systems... driving today; (iv) Total hours on duty for the 7 consecutive day period, including today; (v) Total hours...-driver operation; (7) The on-board recording device/system identifies sensor failures and edited data...

High-Speed On-Board Data Processing for Science Instruments

Science.gov (United States)

Beyon, Jeffrey Y.; Ng, Tak-Kwong; Lin, Bing; Hu, Yongxiang; Harrison, Wallace

2014-01-01

A new development of on-board data processing platform has been in progress at NASA Langley Research Center since April, 2012, and the overall review of such work is presented in this paper. The project is called High-Speed On-Board Data Processing for Science Instruments (HOPS) and focuses on a high-speed scalable data processing platform for three particular National Research Council's Decadal Survey missions such as Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS), Aerosol-Cloud-Ecosystems (ACE), and Doppler Aerosol Wind Lidar (DAWN) 3-D Winds. HOPS utilizes advanced general purpose computing with Field Programmable Gate Array (FPGA) based algorithm implementation techniques. The significance of HOPS is to enable high speed on-board data processing for current and future science missions with its reconfigurable and scalable data processing platform. A single HOPS processing board is expected to provide approximately 66 times faster data processing speed for ASCENDS, more than 70% reduction in both power and weight, and about two orders of cost reduction compared to the state-of-the-art (SOA) on-board data processing system. Such benchmark predictions are based on the data when HOPS was originally proposed in August, 2011. The details of these improvement measures are also presented. The two facets of HOPS development are identifying the most computationally intensive algorithm segments of each mission and implementing them in a FPGA-based data processing board. A general introduction of such facets is also the purpose of this paper.

Board on chemical sciences and technology

International Nuclear Information System (INIS)

1991-01-01

The Board has completed five reports since June 1988. Biosafety in the Laboratory: Prudent Practices for Handling and Disposal of Infectious Materials is a comprehensive review of the principles and practices of biological safety in the laboratory. Currently in press, it promises to be a landmark publication in this field, comparable to the Board's two previous studies on handling and disposal of chemicals in laboratories. Chemical Processes and Products in Severe Nuclear Reactor Accidents: Report of a Workshop evaluates the quality and relevance of existing high-temperature thermodynamic and kinetic data to the analysis of light-water reactor accidents. A number of areas where important data was deemed to be lacking or inadequate were identified to provide a sound basis for predicting the behavior of fission products, fuel, and other materials in nuclear reactors during a severe accident leading to radioactivity release. Training Requirements for Chemists in Nuclear Medicine, Nuclear Industry, and Related Areas assesses the training requirements for chemists in nuclear medicine, nuclear industry, and related areas. Finally, the Board's Air Force Office of Scientific Research High Energy Density Materials Panel has completed two program evaluation reports on this Air Force program

49 CFR 214.115 - Foot protection.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Foot protection. 214.115 Section 214.115... protection. (a) The railroad or railroad contractor shall require railroad bridge workers to wear foot protection equipment when potential foot injury may result from impact, falling or flying objects, electrical...

41 CFR 115-1.106 - Applicability of FPMR.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability of FPMR. 115-1.106 Section 115-1.106 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

41 CFR 115-1.103 - Temporary-type FPMR.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Temporary-type FPMR. 115-1.103 Section 115-1.103 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

41 CFR 115-1.104 - Publication of FPMR.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Publication of FPMR. 115-1.104 Section 115-1.104 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

STS-49 Endeavour/Intelsat Briefing

Science.gov (United States)

1992-01-01

Lak Virdee of Intelsat, summarizes Intelsat's role in the STS-49 Endeavour mission. He discusses the reboost hardware, giving details on the capture arm and docker adapter assembly. He describes the rendezvous between Intelsat and the Endeavour Orbiter. Mr. Virdee then answers questions from the press.

Sheehan Suicidality Tracking Scale (S-STS): reliability, convergent and discriminative validity in young Italian adults.

Science.gov (United States)

Preti, Antonio; Sheehan, David V; Coric, Vladimir; Distinto, Marco; Pitanti, Mirko; Vacca, Irene; Siddi, Alessandra; Masala, Carmelo; Petretto, Donatella Rita

2013-10-01

The Sheehan Suicidality Tracking Scale (S-STS) is a patient self-report or clinician-administered rating scale that tracks spontaneous and treatment-emergent suicidal ideation and behaviors. This study set out to evaluate the reliability, convergent and divergent validity of the S-STS in a sample of college students, a population with a high risk of completed and attempted suicide. Cross-sectional, survey design. Participants (303 undergraduate students; males: 42%) completed several measures assessing psychological distress (General Health Questionnaire; GHQ); self-esteem (Rosenberg Self Esteem Scale; RSES); social support (Modified Social Support Survey; MOSSS); and suicidal behavior, including ideation and attempts (S-STS). Both internal consistency and test-retest stability were excellent for the S-STS-global score. The S-STS subscale on suicide ideation also showed good reliability, while the subscale on suicidal behavior showed some inconsistency at retest. Convergent and divergent validity of S-STS was confirmed. All S-STS items loaded on a single factor, which had an excellent fit for the unidimensional model, thus justifying the use of the S-STS as a screening tool. In a mediation model, self-esteem and social support explained 45% of the effects of psychological distress on suicide ideation and behavior as measured by the S-STS-global score. This study provided promising evidence on the convergent, divergent, internal consistency and test-retest stability of the Sheehan Suicidality Tracking Scale. The cross-sectional design and lack of measures of hopelessness and helplessness prevent any conclusion about the links of suicidal behavior with self-esteem and social support. Copyright © 2013 Elsevier Inc. All rights reserved.

24 CFR 700.115 - Program costs.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Program costs. 700.115 Section 700... PUBLIC AND INDIAN HOUSING PROGRAMS) CONGREGATE HOUSING SERVICES PROGRAM § 700.115 Program costs. (a) Allowable costs. (1) Allowable costs for direct provision of supportive services includes the provision of...

41 CFR 115-1.100 - Scope of subpart.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Scope of subpart. 115-1.100 Section 115-1.100 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.100 Scope...

STS-41 crew is briefed on camera equipment during training session at JSC

Science.gov (United States)

1990-01-01

STS-41 crewmembers are briefed on camera equipment during training session at JSC. Trainer Judy M. Alexander explains the use 16mm motion picture equipment to (left to right) Pilot Robert D. Cabana, Mission Specialist (MS) Bruce E. Melnick, and MS Thomas D. Akers.

STS-93 Pilot Ashby suits up for launch

Science.gov (United States)

1999-01-01

In the Operations and Checkout Building during final launch preparations for the third time, STS-93 Pilot Jeffrey S. Ashby pulls on his glove, part of his launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen Collins, Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

Working on nonprofit boards. Don't assume the shoe fits.

Science.gov (United States)

McFarlan, F W

1999-01-01

Contrary to popular perception, businesspeople can be benevolent. For instance, one recent study notes that four-fifths of all Harvard Business School graduates are involved with nonprofits, with more than half of those serving on boards. Most business professionals will spend some time on a nonprofit board. That's the good news, the author says. The bad news is that the involvement of businesspeople can easily backfire. That's because they often try to take what they have learned from business school and the corporate world and apply it to their duties in the nonprofit sector. On the surface, there are similarities between the for-profit and nonprofit sectors. Both have boards of directors, trustees and chairpeople, regular meetings, and so forth. But the governance of nonprofit organizations is very different from the governance of for-profit businesses in several critical areas, including missions, measurements, and board composition. For instance, the CEO in the nonprofit world must manage a relationship with a nonexecutive board chair. In the for-profit world, the CEO is the chair. Such significant differences make it difficult to transfer ideas and practices between the for-profit and nonprofit worlds. In this article, F. Warren McFarlan describes the main differences between serving on a for-profit board and serving on a nonprofit board. As he points out, understanding the differences will make it easier for businesspeople to move smoothly from one environment to the other and will therefore make their commitments more effective. Nonprofits need businesspeople, but only on the right terms.

21 CFR 135.115 - Goat's milk ice cream.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Goat's milk ice cream. 135.115 Section 135.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION FROZEN DESSERTS Requirements for Specific Standardized Frozen Desserts § 135.115...

Insights on Employee Representation on Danish Boards

DEFF Research Database (Denmark)

Neville, Mette; Gregoric, Aleksandra; Poulsen, Thomas

2015-01-01

Since 1973 the Danish Companies Act has contained rules on codetermination. Employees in public or private limited companies with at least 35 employees in average over a 3-year period have a right but not a duty to appoint representatives on board of directors. In 1973 the rules were seen...

Enhancing board oversight on quality of hospital care: an agency theory perspective.

Science.gov (United States)

Jiang, H Joanna; Lockee, Carlin; Fraser, Irene

2012-01-01

Community hospitals in the United States are almost all governed by a governing board that is legally accountable for the quality of care provided. Increasing pressures for better quality and safety are prompting boards to strengthen their oversight function on quality. In this study, we aimed to provide an update to prior research by exploring the role and practices of governing boards in quality oversight through the lens of agency theory and comparing hospital quality performance in relation to the adoption of those practices. Data on board practices from a survey conducted by The Governance Institute in 2007 were merged with data on hospital quality drawn from two federal sources that measured processes of care and mortality. The study sample includes 445 public and private not-for-profit hospitals. We used factor analysis to explore the underlying dimensions of board practices. We further compared hospital quality performance by the adoption of each individual board practice. Consistent with the agency theory, the 13 board practices included in the survey appear to center around enhancing accountability of the board, management, and the medical staff. Reviewing the hospital's quality performance on a regular basis was the most common practice. A number of board practices, not examined in prior research, showed significant association with better performance on process of care and/or risk-adjusted mortality: requiring major new clinical programs to meet quality-related criteria, setting some quality goals at the "theoretical ideal" level, requiring both the board and the medical staff to be as involved as management in setting the agenda for discussion on quality, and requiring the hospital to report its quality/safety performance to the general public. Hospital governing boards should examine their current practices and consider adopting those that would enhance the accountability of the board itself, management, and the medical staff.

7 CFR 28.115 - Fees and costs; payment.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Fees and costs; payment. 28.115 Section 28.115... Fees and Costs § 28.115 Fees and costs; payment. All charges for practical forms of cotton standards and all fees and expenses for services of inspection of bales and supervision of sampling...

IAEA Convenes Board Meeting on Iran

International Nuclear Information System (INIS)

2014-01-01

Full text: ''I welcome the recent announcement by the EU High Representative Catherine Ashton regarding the implementation of the Joint Plan of Action on the Iranian nuclear programme, which is to take effect as of 20 January. ''I have received a request from Iran and the E3/EU+3 that the Agency conducts monitoring and verification of nuclear-related measures in relation to the Joint Plan of Action. ''I have requested that a meeting of the Board of Governors be convened on 24 January, to consult with the Board regarding the request by Iran and the E3/EU+3 for the Agency to undertake monitoring and verification of nuclear-related measures in relation to the Joint Plan of Action.'' (IAEA)

Female Institutional Directors on Boards and Firm Value

OpenAIRE

Pucheta Martínez, María Consuelo; Bel Oms, Inmaculada; Olcina Sempere, Gustau

2016-01-01

The aim of this research is to examine what impact female institutional directors on boards have on corporate performance. Previous research shows that institutional female directors cannot be considered as a homogeneous group since they represent investors who may or may not maintain business relations with the companies on whose corporate boards they sit. Thus, it is not only the effect of female institutional directors as a whole on firm value that has been analysed, but also the impact of...

13 CFR 115.69 - Imminent Breach.

Science.gov (United States)

2010-01-01

... an Imminent Breach of the terms of a Contract covered by an SBA guaranteed bond. The PSB Surety does... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Imminent Breach. 115.69 Section... Surety Bond (PSB) Guarantees § 115.69 Imminent Breach. (a) No prior approval requirement. SBA will...

25 CFR 115.708 - How quickly will trust funds received by the Secretary on behalf of tribes or individual Indians...

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false How quickly will trust funds received by the Secretary on behalf of tribes or individual Indians be deposited into a trust account? 115.708 Section 115.708 Indians... INDIVIDUAL INDIANS Trust Fund Accounts: General Information § 115.708 How quickly will trust funds received...

46 CFR 115.812 - Pressure vessels and boilers.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Pressure vessels and boilers. 115.812 Section 115.812... CERTIFICATION Material Inspections § 115.812 Pressure vessels and boilers. (a) Pressure vessels must be tested... testing requirements for boilers are contained in § 61.05 in subchapter F of this chapter. [CGD 85-080, 61...

STS-31 crewmembers review checklist with instructor on JSC's FB-SMS middeck

Science.gov (United States)

1988-01-01

STS-31 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) Bruce McCandless II (left) and Pilot Charles F. Bolden (right) discuss procedures with a training instructor on the middeck of JSC's fixed-based (FB) Shuttle Mission Simulator (SMS). The three are pointing to a checklist during this training simulation in the Mission Simulation and Training Facility Bldg 5.

Outgassing of Flown and Unflown MIR Solar Cells

Science.gov (United States)

Harvey, Gale A.; Kinard, William H.; Wilson, Linda A.

2000-01-01

A solar panel array with more than ten years space exposure was removed from the Mir core module in November 1997, and an eight panel section was returned to Earth in January 1998. Several solar cells were removed from panel eight of the returned array and placed in a high vacuum system with a residual gas analyzer (200 amu mass spectrometer) and a cold finger. Similar unflown solar cells of the same vintage were later obtained from Energia. Several of the unflown cells were also placed in the vacuum system and outgassed residues were collected on the LN2 cold finger. Almost 3 mg of outgassed residue was collected -from a string of three unflown solar cells over a period of 94 hours under vacuum. The collected residue was weighed with a microbalance, and then the residue was analyzed by FTIR spectroscopy, and by gas chromatograph-mass spectroscopy. About 25 outgassed constituents were separated by the gas chromatograph, and a high-resolution mass spectrum was obtained of each constituent. Molecular identifications have been made for the constituents. The constituents are primarily cyclic siloxanes, and several of the constituents are isomers of the same molecule. Most of the outgassed constituents have a molecular mass of about 500 amu. Almost one mg of residue was extracted from one sq cm of coverglass/adhesive from a flown solar cell by soaking in isopropyl alcohol for 30 minutes. The gas chromatograph separated about 20 constituents. The constituents are mostly cyclic siloxanes with linear branches, hydrocarbons, and phthalates. The typical molecular mass is about 600 amu. These identifications of specific outgassing molecules have resulted in a more complete understanding of the SiO(x) contamination on the Mir solar cell coverglasses, and on the MEEP experiment trays and optical specimens during the Shuttle-Mir Phase One flight experiment program. Adjusted outgassing rates based on the data reported here, and/or measured outgassing rates and specific molecular

Core Support of the Board on Mathematical Sciences

Energy Technology Data Exchange (ETDEWEB)

None

1995-04-04

This proposal summarizes activities conducted by the Board on Mathematical Sciences (BMS) during the period August 1, 1994 to July 31, 1995 and describes future plans of the Board for the period August 1, 1995 to July 31, 1998. We are requesting core support in the amount of $105,000 ($35,000 each year) from the Department of Energy for the additional three-year period. The BMS activities supported exclusively by core funding are the annual Department Chairs Colloquia, the National Science and Technology Symposia, specific reports, the initiation of all projects, continuous oversight of all activities, and partial core support of the Committee on Applied and Theoretical Statistics (CATS). Other activities of the Board include giving recommendations on research directions to federal agencies, and reports on education in the mathematical sciences, interaction of mathematical sciences with other areas, health of the mathematical sciences, and emerging research directions.

23 CFR 635.115 - Agreement estimate.

Science.gov (United States)

2010-04-01

... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.115 Agreement estimate. (a) Following the award of contract, an agreement estimate based on the contract unit prices and estimated quantities shall be...

Pre-STS-3 press conference held at the JSC public affairs facility

Science.gov (United States)

1982-01-01

Astronauts Jack R. Lousma, center, and C. Gordon Fullerton, left, respond to a visual display of the Columbia and its remote manipulator system in space during a pre-STS-3 press conference. Dr. John Lawrence, public information specialist, is at the far right (25903); Astronaut Lousma, listens as a newsman directs a question his way. In the background is the STS-3 mission logo (25904); Astronaut Fullerton uses an electronic pointer to localize an area on a prjected visual of the OSS payload package to be carried in the cargo bay of the Columbia on STS-3. On far right is Dr. Lawrence (25905).

Does Board Diversity Really Matter?

DEFF Research Database (Denmark)

Rose, Caspar; Munch-Madsen, Peter; Funch, Maja

2013-01-01

We study the impact of female board representation as well as citizenship on corporate performance based on a sample of the largest listed firms in the Nordic countries as well as Germany. We also seek to determine the variation of board structures using factor analysis. We find no support for any...... performance impact relating to female board representation. However, we find an impact of board citizenship on performance showing that board members with a background from common law have a significant positive influence on corporate performance measured as ROA, ROE and ROCE. Consistent with other studies we...... also document that large boards impact corporate performance negatively. Moreover we also show that data set on boards can be explained by four underlying factors. This article adds insight to board determinants of corporate performance as well as the classification of board variation. Specifically...

24 CFR 598.115 - Poverty rate.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Poverty rate. 598.115 Section 598... Requirements § 598.115 Poverty rate. (a) General. In order to be eligible for designation, an area's poverty... poverty rate must be not less than 20 percent; and (2) For at least 90 percent of the census tracts within...

Possibilities of reduction of the on-board energy for an innovative subway

OpenAIRE

Allègre, A-L.; Barrade, P.; Delarue, P.; Bouscayrol, A.; Chattot, E.; El-Fassi, S.

2009-01-01

An innovative subway has been proposed using supercapacitors as energy source. In this paper, are presented different possibilities to reduce on-board stored energy in order to downsize the on-board energy storage subsystem. Special attention is paid to the influence of a feeding rail extension or a downward slope at the beginning of the interstation on the on-board stored energy. A map is built to facilitate the selection of the solution which leads to reduce the on-board energy.

STS-95 Mission Specialist Pedro Duque in white room

Science.gov (United States)

1998-01-01

In the environmental chamber known as the white room, STS-95 Mission Specialist Pedro Duque of Spain, with the European Space Agency, is prepared by white room crew members Danny Wyatt (left) and Travis Thompson (right) for entry into the Space Shuttle Discovery for his first flight into space. The STS-95 mission, targeted for launch at 2 p.m. EST on Oct. 29, is expected to last 8 days, 21 hours and 49 minutes, and return to KSC at 11:49 a.m. EST on Nov. 7.

STS-61B Astronaut Ross Works on Assembly Concept for Construction of Erectable Space Structure

Science.gov (United States)

1985-01-01

The crew assigned to the STS-61B mission included Bryan D. O'Conner, pilot; Brewster H. Shaw, commander; Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Australia); and SATCOM KU-2 (RCA Americom). Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, Virginia and the Marshall Space Flight Center (MSFC), EASE and ACCESS were developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). In this STS-61B onboard photo astronaut Ross, located on the Manipulator Foot Restraint (MFR) over the cargo bay, erects ACCESS. The primary objective of this experiment was to test the structural assembly concepts for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

STS-61B Astronauts Ross and Spring Work on Experimental Assembly of Structures in Extravehicular

Science.gov (United States)

1985-01-01

The crew assigned to the STS-61B mission included Bryan D. O'Conner, pilot; Brewster H. Shaw, commander; Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Australia); and SATCOM KU-2 (RCA Americom). Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, Virginia, and the Marshall Space Flight Center (MSFC), EASE and ACCESS were developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). This STS-61B onboard photo depicts astronauts Ross and Spring working on EASE. The primary objective of these experiments was to test the structural assembly concepts for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

The United States Board on Geographic Names: Standardization or regulation?

Science.gov (United States)

Payne, R.L.

2000-01-01

The United States Board on Geographic Names was created in 1890 to standardize the use of geographic names on federal maps and documents, and was established in its present form in 1947 by public law. The Board is responsible for geographic name usage and application throughout the federal government and its members must approve a name change or new name before it can be applied to federal maps and publications. To accomplish its mission, the Board has developed principles, policies, and procedures for use in the standardization process. The Board is also responsible legally for the promulgation of standardized names, whether or not these names have ever been controversial, and today this is accomplished by the universal availability of electronic databases for domestic and foreign names. This paper examines the development of Board policies and the implementation of these policies to achieve standardization with a view to relating these policies and activities to questions of standardization or regulation. ?? 2000 by The American Name Society.

STS-93 Commander Eileen Collins suits up for launch

Science.gov (United States)

1999-01-01

For the third time, in the Operations and Checkout Building, STS- 93 Commander Eileen M. Collins tries on her helmet with her launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

STS 63: Post flight presentation

Science.gov (United States)

1995-02-01

At a post flight conference, Captain Jim Wetherbee, of STS Flight 63, introduces each of the other members of the STS 63 crew (Eileen Collins, Pilot; Dr. Bernard Harris, Payload Commander; Dr. Michael Foale, Mission Specialist from England; Dr. Janice Voss, Mission Specialist; and Colonel Vladimir Titor, Mission Specialist from Russia), gave a short autobiography of each member and a brief description of their assignment during this mission. A film was shown that included the preflight suit-up, a view of the launch site, the actual night launch, a tour of the Space Shuttle and several of the experiment areas, several views of earth and the MIR Space Station and cosmonauts, the MlR-Space Shuttle rendezvous, the deployment of the Spartan Ultraviolet Telescope, Foale and Harris's EVA and space walk, the retrieval of Spartan, and the night entry home, including the landing. Several spaceborne experiments were introduced: the radiation monitoring experiment, environment monitoring experiment, solid surface combustion experiment, and protein crystal growth and plant growth experiments. This conference ended with still, color pictures, taken by the astronauts during the entire STS 63 flight, being shown.

Dicty_cDB: AHA115 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AH (Link to library) AHA115 (Link to dictyBase) - - - - - (Link to Original site) A...HA115F 669 - - - - - - Show AHA115 Library AH (Link to library) Clone ID AHA115 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AH/AHA...(bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1243 0.0 2 BD24838... 7e-04 1 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar

Women underrepresented on editorial boards of 60 major medical journals.

Science.gov (United States)

Amrein, Karin; Langmann, Andrea; Fahrleitner-Pammer, Astrid; Pieber, Thomas R; Zollner-Schwetz, Ines

2011-12-01

Although there has been a continuous increase in the number of women working in the field of medicine, women rarely reach the highest academic positions as full professors or editorial board members. We aimed to determine the proportion of women on the editorial boards of top-ranked medical journals in different medical specialties. We analyzed the gender of editorial board members of 60 top-ranked journals of 12 Thomson Reuters Web of Knowledge Journal Citation Reports categories. A total of 4175 editors were included in our analysis. Only 15.9% (10 of 63) editors-in-chief were female. In the 5 categories, critical care, anesthesiology, orthopedics, ophthalmology and radiology, nuclear medicine and medical imaging, currently not 1 woman holds the position of editor-in-chief. Less than one fifth (17.5%, 719 of 4112) of all editorial board members were women. There were significant differences among the evaluated categories, with the highest percentage of women in the category of medicine, general and internal and the lowest in the category critical care, followed by orthopedics. In every category, the proportion of women as editorial board members was substantially lower than that of men. Women are underrepresented on the editorial boards of major medical journals, although there is a great variability among the journals and categories analyzed. If more women are nominated to serve on editorial boards, they will be a visible sign of continuing progress and serve as important role models for young women contemplating a career in academic medicine. Copyright © 2011 Elsevier HS Journals, Inc. All rights reserved.

STS-95 crew members Duque and Mukai check out slidewire basket

Science.gov (United States)

1998-01-01

At Launch Pad 39-B, STS-95 Mission Specialist Pedro Duque of Spain (left) and Payload Specialist Chiaki Mukai look over the gate for the slidewire basket, part of the emergency egress system on the pad. Mukai represents the National Space Development Agency of Japan (NASDA), and Duque the European Space Agency (ESA). The STS-95 crew are at KSC to participate in a Terminal Countdown Demonstration Test (TCDT) which includes mission familiarization activities, emergency egress training, and a simulated main engine cut-off exercise. Other STS-95 crew members are Mission Specialist Stephen K. Robinson, Mission Commander Curtis L. Brown, Pilot Steven W. Lindsey, Payload Specialists John H. Glenn Jr., senator from Ohio, and Mission Specialist Scott E. Parazynski. The STS-95 mission, targeted for liftoff on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. Following the TCDT, the crew will be returning to Houston for final flight preparations.

GENDER ISSUES – WOMEN’S REPRESENTATION ON BOARDS

Directory of Open Access Journals (Sweden)

Elena CHIȚIMUȘ

2014-11-01

Full Text Available Corporate Governance is seen as a set of systems, rules, regulations that are in place in order to keep the company on a straight path and to give assurance to the shareholders that their investment is well protected. One of the instruments that are at the choice of the shareholders is the Board of Directors (BoD. Debates go around its role of monitoring and supervising, on obtaining an adding value board or a competitive advantage, on the changes that it has suffered along the years. This paper is a literature review on the diversity in gender, age and experience of the members of the board that have in their hands the power to bring value or destruction to companies. The study shows that are many contradictory results and opinions on the matter and that company’s performance is determined by many factors combined together, like a good mix of culture, experience, professionalism. Discrimination shouldn’t be made on gender, age, background, all persons should be given equal chances and stereotype should be fought more.

STS-37 Commander Nagel in commanders seat on OV-104's flight deck

Science.gov (United States)

1991-01-01

STS-37 Commander Steven R. Nagel, wearing launch and entry suit (LES), sits at commanders station on the forward flight deck of Atlantis, Orbiter Vehicle (OV) 104. Surrounding Nagel are the seat headrest, control panels, checklists, forward flight deck windows, and three drinking water containers with straws attached to forward panel F2.

Boards on the Move: Surfboards, Skateboards, Snowboards, and Kiteboards

Science.gov (United States)

Moye, Johnny J.; Ritz, John M.

2009-01-01

Technological advances through mathematics and science have made possible the modification of boarding sports. This article discusses the development of sport technologies that use boards and also touches on the social and cultural effects of the new technologies. It identifies many new forms of sports equipment that were spawned from modifying…

Dicty_cDB: CFG115 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFG115 (Link to dictyBase) - - - Contig-U03237-1 CFG115E (Link...) Clone ID CFG115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03237-1 Ori...k*NNMNGFLKSQLENKTNATTTTTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICT...TTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICTDNNDCTMDWCNQLTGECVYQ...ng significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 256

40 CFR 35.115 - Evaluation of performance.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Evaluation of performance. 35.115 Section 35.115 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL... Evaluation of performance. (a) Joint evaluation process. The applicant and the Regional Administrator will...

A study on the real-time reliability of on-board equipment of train control system

Science.gov (United States)

Zhang, Yong; Li, Shiwei

2018-05-01

Real-time reliability evaluation is conducive to establishing a condition based maintenance system for the purpose of guaranteeing continuous train operation. According to the inherent characteristics of the on-board equipment, the connotation of reliability evaluation of on-board equipment is defined and the evaluation index of real-time reliability is provided in this paper. From the perspective of methodology and practical application, the real-time reliability of the on-board equipment is discussed in detail, and the method of evaluating the realtime reliability of on-board equipment at component level based on Hidden Markov Model (HMM) is proposed. In this method the performance degradation data is used directly to realize the accurate perception of the hidden state transition process of on-board equipment, which can achieve a better description of the real-time reliability of the equipment.

The dBoard: a Digital Scrum Board for Distributed Software Development

DEFF Research Database (Denmark)

Esbensen, Morten; Tell, Paolo; Cholewa, Jacob Benjamin

2015-01-01

In this paper we present the dBoard - a digital Scrum Board for distributed Agile software development teams. The dBoard is designed as a 'virtual window' between two Scrum team spaces. It connects two locations with live video and audio, which is overlaid with a synchronized and interactive...... digital Scrum board, and it adapts the fidelity of the video/audio to the presence of people in front of it. The dBoard is designed to work (i) as a passive information radiator from which it is easy to get an overview of the status of work, (ii) as a media space providing awareness about the presence...... of remote co-workers, and (iii) as an active meeting support tool. The paper presents a case study of distributed Scrum in a large software company that motivates the design of the dBoard, and details the design and technical implementation of the dBoard. The paper also reports on an initial user study...

Refinement of boards' role required.

Science.gov (United States)

Umbdenstock, R J

1987-01-01

The governing board's role in health care is not changing, but new competitive forces necessitate a refinement of the board's approach to fulfilling its role. In a free-standing, community, not-for-profit hospital, the board functions as though it were the "owner." Although it does not truly own the facility in the legal sense, the board does have legal, fiduciary, and financial responsibilities conferred on it by the state. In a religious-sponsored facility, the board fulfills these same obligations on behalf of the sponsoring institute, subject to the institute's reserved powers. In multi-institutional systems, the hospital board's power and authority depend on the role granted it by the system. Boards in all types of facilities are currently faced with the following challenges: Fulfilling their basic responsibilities, such as legal requirements, financial duties, and obligations for the quality of care. Encouraging management and the board itself to "think strategically" in attacking new competitive market forces while protecting the organization's traditional mission and values. Assessing recommended strategies in light of consequences if constituencies think the organization is abandoning its commitments. Boards can take several steps to match their mode of operation with the challenges of the new environment. Boards must rededicate themselves to the hospital's mission. Trustees must expand their understanding of health care trends and issues and their effect on the organization. Boards must evaluate and help strengthen management's performance, rather than acting as a "watchdog" in an adversarial position. Boards must think strategically, rather than focusing solely on operational details. Boards must evaluate the methods they use for conducting business.

Pedro Duque arrives at KSC for the STS-95 launch

Science.gov (United States)

1998-01-01

STS-95 Mission Specialist Pedro Duque, with the European Space Agency (ESA), arrives at Kennedy Space Center's Shuttle Landing Facility aboard a T-38 jet as part of final preparations for launch. The STS-95 mission, targeted for liftoff at 2 p.m. on Oct. 29, includes research payloads such as the Spartan solar- observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. The mission is expected to last 8 days, 21 hours and 49 minutes, and return to KSC on Nov. 7. The other STS-95 crew members are Mission Commander Curtis L. Brown Jr., Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Mission Specialist Stephen K. Robinson, Payload Specialist John H. Glenn Jr., senator from Ohio, and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA).

41 CFR 115-1.109 - Numbering in FPMR system.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Numbering in FPMR system. 115-1.109 Section 115-1.109 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

HOST payload for STS-95 being moved into SSPF

Science.gov (United States)

1998-01-01

The Hubble Space Telescope Orbiting Systems Test (HOST) is checked out by technicians in the Space Shuttle Processing Facility. One of the payloads on the STS-95 mission, the HOST platform is carrying four experiments to validate components planned for installation during the third Hubble Space Telescope servicing mission and to evaluate new technologies in an earth orbiting environment. The STS-95 mission is scheduled to launch Oct. 29. It will carry three other payloads: the Spartan solar- observing deployable spacecraft, the International Extreme Ultraviolet Hitchhiker, and the SPACEHAB single module with experiments on space flight and the aging process.

45 CFR 400.115 - Establishing legal responsibility.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 2 2010-10-01 2010-10-01 false Establishing legal responsibility. 400.115 Section... Child Welfare Services § 400.115 Establishing legal responsibility. (a) A State must ensure that legal responsibility is established, including legal custody and/or guardianship, as appropriate, in accordance with...

Adsorption Properties of the Cu(115) Surface

DEFF Research Database (Denmark)

Godowski, P. J.; Groso, A.; Hoffmann, S. V.

2010-01-01

The interfaces: K/Cu(115) and CO/Cu(115) have been characterized using surface sensitive techniques, including low energy electron diffraction and photoelectron spectroscopy. K adatoms show tendency to occupy the sites close to the step edges. At low temperature (near 125 K), after completion of ...

Experimental study on the aging process of the LR 115 cellulose nitrate radon detector

International Nuclear Information System (INIS)

Siems, M.; Freyer, K.; Treutler, H.-C.; Joensson, G.; Enge, W.

2001-01-01

An experimental determination of the aging process of cellulose nitrate detector material was based on the examination of special properties of the LR 115 solid state nuclear track detectors (SSNTDs) of various ages up to 18 years. The examined relevant parameters are the bulk etching rate v b and the track etching rate v t . These parameters are responsible for the appearance, the size and the registration efficiency of tracks of α-particles from radon gas in the detector. To find a correlation between these material parameters and the detector sensitivity an experimental calibration of indoor room and outdoor soil detector devices based on LR 115 took place at the Umweltforschungszentrum Leipzig-Halle (Germany). To avoid routine calibration work in external radon exposure facilities a correction of the age dependent calibration factors with the material parameters measured in one's own laboratory was targeted. In this study a general age dependence, however, was not found. The following statements for practical applications can be made. (i) the bulk etching rate v b for detectors of the same batch has a depth dependence and this dependence is constant over 2 years (LR 115 September 1994). (ii) detectors of different batches older than 5 years and stored at room temperature show an odd v b behaviour when v b is used for describing track shapes. (iii) the calibration factor of detectors of different batches that were stored at about +4 deg. C is constant over 5 years (LR 115 September 1994 and February 1999, Table 2). The conclusion is that LR 115 detectors not older than 5 years and stored in a refrigerator at about +4 deg. C should be preferred for radon measurements. Furthermore these detectors should be recalibrated every year and the microscope work of this calibrations should be performed by the same person who performs the measurements. In addition, a phenomenon related to fundamental track formation mechanisms was found, that the time straggling of the

STS-101 Crew Interview / Scott Horowitz

Science.gov (United States)

2000-01-01

Live footage of a preflight interview with Pilot Scott J. Horowitz is seen. The interview addresses many different questions including why Horowitz became an astronaut, the events that led to his interest, any role models that he had, and his inspiration. Other interesting information that this one-on-one interview discusses is the reaction and reasons for the splitting-up of the objectives for STS-101 with STS-106. Horowitz also mentions the scheduled space-walk, docking with the International Space Station (ISS), the new glass cockpit of Atlantis, the repairs of equipment and change of the batteries. Horowitz also discusses his responsibilities during the space-walk, and docking of the spacecraft. He stresses that he will have an added challenge during the space-walk, his inability to see where he needs to place the Extravehicular Activities (EVA) crew.

19 CFR 115.55 - Termination of approval.

Science.gov (United States)

2010-04-01

... vehicle by a major repair or alteration of any of the essential features required in § 115.51. Repairs by... TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS CONVENTIONS Procedures for Approval of Individual Road Vehicles § 115.55 Termination of approval. Approval of a road...

15 CFR 930.115 - Termination of mediation.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Termination of mediation. 930.115... MANAGEMENT FEDERAL CONSISTENCY WITH APPROVED COASTAL MANAGEMENT PROGRAMS Secretarial Mediation § 930.115 Termination of mediation. Mediation shall terminate: (a) At any time the Federal and State agencies agree to a...

STS-100 MS Parazynski looks over Destiny in SSPF

Science.gov (United States)

2000-01-01

In the Space Station Processing Facility, STS-100 Mission Specialist Scott Parazynski looks over part of the U.S. Lab, Destiny. Mission STS-100 will be the ninth construction flight for the International Space Station. It is scheduled to launch April 19, 2001.

sY116, a human Y-linked polymorphic STS

Indian Academy of Sciences (India)

linked STS, showed different electrophoretic mobilities in three males, two infertile and one fertile. A study of this STS among 35 other normal males showed that this locus is polymorphic. sY116 has a poly A-rich stretch whose instability ...

Digital tomosynthesis with an on-board kilovoltage imaging device

International Nuclear Information System (INIS)

Godfrey, Devon J.; Yin, F.-F.; Oldham, Mark; Yoo, Sua; Willett, Christopher

2006-01-01

Purpose: To generate on-board digital tomosynthesis (DTS) and reference DTS images for three-dimensional image-guided radiation therapy (IGRT) as an alternative to conventional portal imaging or on-board cone-beam computed tomography (CBCT). Methods and Materials: Three clinical cases (prostate, head-and-neck, and liver) were selected to illustrate the capabilities of on-board DTS for IGRT. Corresponding reference DTS images were reconstructed from digitally reconstructed radiographs computed from planning CT image sets. The effect of scan angle on DTS slice thickness was examined by computing the mutual information between coincident CBCT and DTS images, as the DTS scan angle was varied from 0 o to 165 o . A breath-hold DTS acquisition strategy was implemented to remove respiratory motion artifacts. Results: Digital tomosynthesis slices appeared similar to coincident CBCT planes and yielded substantially more anatomic information than either kilovoltage or megavoltage radiographs. Breath-hold DTS acquisition improved soft-tissue visibility by suppressing respiratory motion. Conclusions: Improved bony and soft-tissue visibility in DTS images is likely to improve target localization compared with radiographic verification techniques and might allow for daily localization of a soft-tissue target. Breath-hold DTS is a potential alternative to on-board CBCT for sites prone to respiratory motion

Development of an Adjustable board and a Rotational Board for Scaffold

Science.gov (United States)

Jang, Myunghoun

2017-06-01

Scaffold is widely used in high work-places inside and outside of a building construction site. It is inexpensive and is installed and dismantled easily. Although standards and ledgers of a steel tube and coupler scaffold are installed in a regular distance, the distances of transoms are not equal in some places. Sometimes a working platform or a board is absent in the corner of scaffold. This may cause safety accidents because a foothold is not stable on the transoms. An adjustable safety board and a rotational safety board are suggested in this paper. The adjustable board consists of two footholds. The small one is inserted into the large one. The rotational board covers not only right angle but also acute or obtuse angles. These safety boards for scaffold help to decrease safety accidents in construction sites.

On-board system for physical and microphysical measurements

International Nuclear Information System (INIS)

Ravaut, M.; Allet, C.; Dole, B.; Gribkoff, A.; Schibler, P.; Charpentier, C.

1981-10-01

This report presents the system of physical and microphysical measurement instrumentation on board the HUREL-DUBOIS HD 34 aircraft, built in cooperation with the Institut National d'Astronomie et de Geophysique (I.N.A.G.) and the Institut Geographique National (I.G.N.). The feasibility study of the system was carried out in the first half of 1978 and took shape in an on-site proving campaign in November 1979. As a result, the on-board system was able to participate in the BUGEY experimental campaign of March 1980, a glimpse of which is given in this report [fr

STS-95 Mission Specialist Duque suits up during TCDT

Science.gov (United States)

1998-01-01

STS-95 Mission Specialist Pedro Duque of Spain, representing the European Space Agency, suits up in the Operations and Checkout Building prior to his trip to Launch Pad 39-B. Duque and the rest of the STS-95 crew are at KSC to participate in the Terminal Countdown Demonstration Test (TCDT) which includes mission familiarization activities, emergency egress training, and a simulated main engine cutoff. The other crew members are Payload Specialist Chiaki Mukai (M.D., Ph.D.), representing the National Space Development Agency of Japan (NASDA), Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Mission Specialist Stephen K. Robinson, Payload Specialist John H. Glenn Jr., senator from Ohio, and Mission Commander Curtis L. Brown. The STS-95 mission, targeted for liftoff on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. Following the TCDT, the crew will be returning to Houston for final flight preparations.

Notes on the Narratological Approach to Board Games

Directory of Open Access Journals (Sweden)

Mattia Thibault

2016-12-01

Full Text Available Nowadays game studies are in the foreground of cultural and communication debates. Even if video games are strongly studied in semiotics, play is a wide field of study with many areas still unexplored. The area that this paper aims to explore concerns board games and it focuses on the relationship between game and narration and the role of a game’s intertextual dimension from a semiotic point of view. Semiotic tools that have been used include the Greimasian narrative sequence (a structuralist point of view that fits very well with the rigid, explicit grammaticalization of board games and Génette's narratology, unavoidable for every reflection on intertextuality. Last, but not least, cultural semiotics, based on Jurij Lotman's works, offers a valuable asset for understanding the enveloping and organic structure that surrounds games. The research proceeds to focus on some case studies of three ancient board games - chess, backgammon, and mancalas - underlining their common traits and differences. The paper shows that the structure of board games is very similar to the structure of the Greimasian narrative sequence, but they rather form a hybrid narration in which the player has a primary importance. Moreover, we see that games constantly retrieve sense from different kinds of other texts depending on the culture and society in which the game is played. The aim of this research is not to propound a complete theory, but rather to indicate a possible path to follow, between many, that could be a valuable resource in the exploration and the understanding of play.

Interprofessional student experiences on the HAVEN free clinic leadership board.

Science.gov (United States)

Scott, Elizabeth Anne; Swartz, Martha K

2015-01-01

In this study, we examined the experiences of students serving on the leadership board of HAVEN - the student-run free clinic of the Yale University health professional schools. Open-ended responses were collected from 18 of the 28 members of the 2011-2012 leadership board through an online survey. Students reported an overall positive experience participating on the board and valued the opportunity to be part of a committed community creating change. The majority of students reported that their time as a board member had improved their attitude towards interprofessional collaboration (78%) and had also fostered their leadership skills (67%). Around two thirds (67%) reported that their experience had positively impacted their future career plans, either reinforcing their desire to work with underserved populations or encouraging them to pursue leadership roles. Based on these data, it is suggested that the HAVEN Free Clinic offers a useful opportunity for students to experience the demands of clinical care leadership while working together in an interprofessional context.

Women on Corporate Boards in Bosnia and Herzegovina, FYR Macedonia, and Serbia

OpenAIRE

Djulic, Katarina; Kuzman, Tanja

2013-01-01

In January 2013, International Finance Corporation (IFC) launched a research project entitled women on corporate boards in Bosnia and Herzegovina, FYR Macedonia, and Serbia. The purpose of the project was to gather information on the representation of women on corporate boards and to learn about the determinants of female board membership in these countries. Which skills and knowledge do w...

STS-99 workers carry new Master Events Controller to Endeavour

Science.gov (United States)

2000-01-01

Workers carry the replacement Enhanced Main Events Controller (E- MEC) to Shuttle Endeavour at Launch Pad 39A for installation in the aft compartment of the payload bay. The original E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.

Women on the corporate board of directors and corporate sustainability disclosure

Directory of Open Access Journals (Sweden)

Emeldah M. Modiba

2017-09-01

Full Text Available This research examined whether an improved participation of women in the board of directors has any relationship with sustainability disclosure. Accordingly, the objective of this research was to examine the relationship between the number of women on the board of directors and social investment disclosure and energy disclosure in the sample of companies. The paper used a quantitative approach and data were collected from the archives of sustainability reports of five companies that formed the sample. The panel-data regression analysis was used in data arrangement. Five sample of companies over five years produced a (5 x 5 panel resulting in 25 observations. Data was tested at an alpha of 0.05. Results from all the analysis showed a P value below the research alpha (P < 0,05 indicating a significant relationship. Therefore, findings from the panel-data regression analysis disclosed a positive relationship between the number of women on the board of directors and corporate disclosure on social investment and energy consumption. Further analysis also disclosed that women on the board of directors are related with the overall number of women employees in the company. The paper concludes that within the sample of companies, women on the board of directors may influence sustainability disclosure such as energy and social investment. Women on the board of directors might also assist the companies to achieve gender equity employment goals. The research recommends that given the unique social and environmental proclivity of women, the corporate should recruit more women in the boards to enhance accelerated corporate sustainability performance. Further research using expanded number of companies is recommended.

Women on board and firm performance

NARCIS (Netherlands)

Lückerath – Rovers, M.

2010-01-01

This study addresses the research question of whether companies with female directors on the board have a higher average performance than companies with no female directors. The debate about the low representation of women in the top management of companies involves both moral arguments (equality

STS-34 crewmembers eat meal on OV-104's middeck

Science.gov (United States)

1989-01-01

STS-34 crewmembers, on their first space flight, appear to enjoy mealtime in a zero-gravity environment. They are Pilot Michael J. McCulley and Mission Specialist (MS) Ellen S. Baker. The two, who were in the 1984 class of NASA astronauts, balance their meal trays and attempt to eat in an area of Atlantis', Orbiter Vehicle (OV) 104's, middeck that pays tribute to their astronaut roots. The 'maggot' decal or insignia has direct reference to the group. During the flight, the two made former Astronaut Paul J. Weitz, now JSC Deputy Director, an honorary member of the 1984 class. Weitz's flight suit portrait hangs on the galley facing.

STS-110 Extravehicular Activity (EVA)

Science.gov (United States)

2002-01-01

STS-110 mission specialist Lee M.E. Morin carries an affixed 35 mm camera to record work which is being performed on the International Space Station (ISS). Working with astronaut Jerry L. Ross (out of frame), the duo completed the structural attachment of the S0 (s-zero) truss, mating two large tripod legs of the 13 1/2 ton structure to the station's main laboratory during a 7-hour, 30-minute space walk. The STS-110 mission prepared the Station for future space walks by installing and outfitting the 43-foot-long S0 truss and preparing the Mobile Transporter. The S0 Truss was the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. This central truss segment also includes a flatcar called the Mobile Transporter and rails that will become the first 'space railroad,' which will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. Milestones of the S-110 mission included the first time the ISS robotic arm was used to maneuver space walkers around the Station and marked the first time all space walks were based out of the Station's Quest Airlock. It was also the first Shuttle to use three Block II Main Engines. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002.

The sustainability paradigm and the STS approach: mediations for science education

Directory of Open Access Journals (Sweden)

Elizandra Rêgo de Vasconcelos

2012-12-01

Full Text Available The society has been confronted with issues that involve interactions between science, technology and society (STS, which reveal social, economic, environmental, ethical implications, among others. The sustainability paradigm occupies a prominent position in this area. We understand that the STS guidelines are an important instrument for building the concept of sustainability in science education, whose perspectives consistent with the formation of citizens with environmental sensitivity-citizens who are able to analyze and evaluate critically issues related to the social, environmental and economic field, among other aspects. We propose, in this article, to discuss the possible links between the sustainability paradigm, the STS approach and the process of teaching and learning in science. This articulation certainly helps to think the implications of the current development model and the relationships STS, inserted, for example, on various issues, contexts, dimensions, knowledge and teaching strategies. Certainly, we must undertake the effort to approximate the natural and social fields, in the apprehension of the complex reality as it stands nowadays

Board affiliation and pay gap

Directory of Open Access Journals (Sweden)

Shenglan Chen

2014-06-01

Full Text Available This paper examines the effects of board affiliation on the corporate pay gap. Using a sample of Chinese listed firms from 2005 to 2011, we find that boards with a greater presence of directors appointed by block shareholders have lower pay gaps. Furthermore, the governance effects of board affiliation with and without pay are distinguished. The empirical results show that board affiliation without pay is negatively related to the pay gap, while board affiliation with pay is positively related to the pay gap. Overall, the results shed light on how block shareholders affect their companies’ pay gaps through board affiliation.

On-boarding the Middle Manager.

Science.gov (United States)

OʼConnor, Mary

The trend of promoting clinical experts into management roles continues. New middle managers need a transitional plan that includes support, mentoring, and direction from senior leaders, including the chief nursing officer (CNO). This case study demonstrates how the CNO of one organization collaborated with a faculty member colleague to develop and implement a yearlong personalized on-boarding program for a group of new nurse middle managers.

A Study on Changes in Thickness of STS304 Material in the Progressive Drawing Process

Directory of Open Access Journals (Sweden)

Lee C.K.

2017-06-01

Full Text Available In the drawing process, the roundness of corners in the punch and the die are very important factors in determining the thicknesses of the product. The results clearly revealed that the thickness of a flange was increased and the thickness of body parts reduced when the roundness of the die entrance was small. The material thickness of the top part was decreased when the corner roundness of the punch was large. The smooth inflow of materials was found to have a significant effect on the thickness during the post-process. The compressive strength of STS 304 material exhibited a higher value compared with other processing methods. Moreover, we clearly observed the corner roundness of the punch and the die to be a very important factor for STS 304 materials.

STS-26 MS Lounge in fixed based (FB) shuttle mission simulator (SMS)

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) John M. Lounge, wearing comunications kit assembly headset and crouched on the aft flight deck, performs checklist inspection during training session. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

Redesign of a Variable-Gain Output Feedback Longitudinal Controller Flown on the High-Alpha Research Vehicle (HARV)

Science.gov (United States)

Ostroff, Aaron J.

1998-01-01

This paper describes a redesigned longitudinal controller that flew on the High-Alpha Research Vehicle (HARV) during calendar years (CY) 1995 and 1996. Linear models are developed for both the modified controller and a baseline controller that was flown in CY 1994. The modified controller was developed with three gain sets for flight evaluation, and several linear analysis results are shown comparing the gain sets. A Neal-Smith flying qualities analysis shows that performance for the low- and medium-gain sets is near the level 1 boundary, depending upon the bandwidth assumed, whereas the high-gain set indicates a sensitivity problem. A newly developed high-alpha Bode envelope criterion indicates that the control system gains may be slightly high, even for the low-gain set. A large motion-base simulator in the United Kingdom was used to evaluate the various controllers. Desired performance, which appeared to be satisfactory for flight, was generally met with both the low- and medium-gain sets. Both the high-gain set and the baseline controller were very sensitive, and it was easy to generate pilot-induced oscillation (PIO) in some of the target-tracking maneuvers. Flight target-tracking results varied from level 1 to level 3 and from no sensitivity to PIO. These results were related to pilot technique and whether actuator rate saturation was encountered.

Particle Board and Oriented Strand Board Prepared with Nanocellulose-Reinforced Adhesive

Directory of Open Access Journals (Sweden)

Stefan Veigel

2012-01-01

Full Text Available Adhesives on the basis of urea-formaldehyde (UF and melamine-urea-formaldehyde (MUF are extensively used in the production of wood-based panels. In the present study, the attempt was made to improve the mechanical board properties by reinforcing these adhesives with cellulose nanofibers (CNFs. The latter were produced from dissolving grade beech pulp by a mechanical homogenization process. Adhesive mixtures with a CNF content of 0, 1, and 3 wt% based on solid resin were prepared by mixing an aqueous CNF suspension with UF and MUF adhesives. Laboratory-scale particle boards and oriented strand boards (OSBs were produced, and the mechanical and fracture mechanical properties were investigated. Particle boards prepared with UF containing 1 wt% CNF showed a reduced thickness swelling and better internal bond and bending strength than boards produced with pure UF. The reinforcing effect of CNF was even more obvious for OSB where a significant improvement of strength properties of 16% was found. For both, particle board and OSB, mode I fracture energy and fracture toughness were the parameters with the greatest improvement indicating that the adhesive bonds were markedly toughened by the CNF addition.

α -induced reactions on 115In: Cross section measurements and statistical model analysis

Science.gov (United States)

Kiss, G. G.; Szücs, T.; Mohr, P.; Török, Zs.; Huszánk, R.; Gyürky, Gy.; Fülöp, Zs.

2018-05-01

Background: α -nucleus optical potentials are basic ingredients of statistical model calculations used in nucleosynthesis simulations. While the nucleon+nucleus optical potential is fairly well known, for the α +nucleus optical potential several different parameter sets exist and large deviations, reaching sometimes even an order of magnitude, are found between the cross section predictions calculated using different parameter sets. Purpose: A measurement of the radiative α -capture and the α -induced reaction cross sections on the nucleus 115In at low energies allows a stringent test of statistical model predictions. Since experimental data are scarce in this mass region, this measurement can be an important input to test the global applicability of α +nucleus optical model potentials and further ingredients of the statistical model. Methods: The reaction cross sections were measured by means of the activation method. The produced activities were determined by off-line detection of the γ rays and characteristic x rays emitted during the electron capture decay of the produced Sb isotopes. The 115In(α ,γ )119Sb and 115In(α ,n )Sb118m reaction cross sections were measured between Ec .m .=8.83 and 15.58 MeV, and the 115In(α ,n )Sb118g reaction was studied between Ec .m .=11.10 and 15.58 MeV. The theoretical analysis was performed within the statistical model. Results: The simultaneous measurement of the (α ,γ ) and (α ,n ) cross sections allowed us to determine a best-fit combination of all parameters for the statistical model. The α +nucleus optical potential is identified as the most important input for the statistical model. The best fit is obtained for the new Atomki-V1 potential, and good reproduction of the experimental data is also achieved for the first version of the Demetriou potentials and the simple McFadden-Satchler potential. The nucleon optical potential, the γ -ray strength function, and the level density parametrization are also

Decamp Clock Board Firmware

Energy Technology Data Exchange (ETDEWEB)

Vicente, J. de; Castilla, J.; Martinez, G.

2007-09-27

Decamp (Dark Energy Survey Camera) is a new instrument designed to explore the universe aiming to reveal the nature of Dark Energy. The camera consists of 72 CCDs and 520 Mpixels. The readout electronics of DECam is based on the Monsoon system. Monsoon is a new image acquisition system developed by the NOAO (National Optical Astronomical Observatory) for the new generation of astronomical cameras. The Monsoon system uses three types of boards inserted in a Eurocard format based crate: master control board, acquisition board and clock board. The direct use of the Monsoon system for DECam readout electronics requires nine crates mainly due to the high number of clock boards needed. Unfortunately, the available space for DECam electronics is constrained to four crates at maximum. The major drawback to achieve such desired compaction degree resides in the clock board signal density. This document describes the changes performed at CIEMAT on the programmable logic of the Monsoon clock board aiming to meet such restricted space constraints. (Author) 5 refs.

Decamp Clock Board Firmware

International Nuclear Information System (INIS)

Vicente, J. de; Castilla, J.; Martinez, G.

2007-01-01

Decamp (Dark Energy Survey Camera) is a new instrument designed to explore the universe aiming to reveal the nature of Dark Energy. The camera consists of 72 CCDs and 520 Mpixels. The readout electronics of DECam is based on the Monsoon system. Monsoon is a new image acquisition system developed by the NOAO (National Optical Astronomical Observatory) for the new generation of astronomical cameras. The Monsoon system uses three types of boards inserted in a Eurocard format based crate: master control board, acquisition board and clock board. The direct use of the Monsoon system for DECam readout electronics requires nine crates mainly due to the high number of clock boards needed. Unfortunately, the available space for DECam electronics is constrained to four crates at maximum. The major drawback to achieve such desired compaction degree resides in the clock board signal density. This document describes the changes performed at CIEMAT on the programmable logic of the Monsoon clock board aiming to meet such restricted space constraints. (Author) 5 refs

STS-54 Physics of Toys

Science.gov (United States)

1993-01-01

Greg Vogt, NASA Headquarters Education Specialist, and Carolyn Sumners, Houston Museum of Natural Science, give an overview of the spaceborne experiments that will take place on the STS-54 Endeavour mission. Mr. Vogt discusses the objectives and procedures of the experiments, which are structured around using toys to show the effects of microgravity. Mr. Vogt and Ms. Sumners then answer questions from the press.

Board of Directors or Supervisory Board

DEFF Research Database (Denmark)

Werlauff, Erik

2009-01-01

The article analyses the legal consequences of the choice now available to Danish public limited companies, which can now opt for a two-tier management structure, in which the management board undertakes both the day-to-day and the overall management, while a supervisory board exercises control...... over the management board, including its appointment and dismissal. The article considers which companies a two-tier structure may be relevant for, and reviews the consequences for the composition, election and functioning of the company organs....

STS-26 Commander Hauck in fixed based (FB) shuttle mission simulator (SMS)

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck, wearing comunications kit assembly headset and seated in the commanders seat on forward flight deck, looks over his shoulder toward the aft flight deck. A flight data file (FDF) notebook rests on his lap. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

What makes great boards great.

Science.gov (United States)

Sonnenfeld, Jeffrey A

2002-09-01

In the wake of meltdowns at WorldCom, Tyco, and Enron, enormous attention has been focused on the companies' boards. It seems inconceivable that business disasters of such magnitude could happen without gross or even criminal negligence on the part of board members. And yet a close examination of those boards reveals no broad pattern of incompetence or corruption. In fact, they followed most of the accepted standards for board operations: Members showed up for meetings; they had money invested in the company; audit committees, compensation committees, and codes of ethics were in place; the boards weren't too small or too big, nor were they dominated by insiders. In other words, they passed the tests that would normally be applied to determine whether a board of directors was likely to do a good job. And that's precisely what's so scary, according to corporate governance expert Jeffrey Sonnenfeld, who suggests that it's time for some new thinking about how corporate boards operate and are evaluated. He proposes thinking not only about how to structure the board's work but also about how to manage it as a social system. Good boards are, very simply, high-functioning work groups. They're distinguished by a climate of respect, trust, and candor among board members and between the board and management. Information is shared openly and on time; emergent political factions are quickly eliminated. Members feel free to challenge one another's assumptions and conclusions, and management encourages lively discussion of strategic issues. Directors feel a responsibility to contribute meaningfully to the board's performance. In addition, good boards assess their own performance, both collectively and individually.

STS-30 crewmembers pose for informal portrait on JSC FB-SMS middeck

Science.gov (United States)

1988-01-01

STS-30 Atlantis, Orbiter Vehicle (OV) 104, crewmembers pause briefly from their training schedule to pose for informal portrait in JSC fixed base (FB) shuttle mission simulator (SMS). On FB-SMS middeck are (left to right) Commander David M. Walker, Mission Specialist (MS) Mark C. Lee, MS Mary L. Cleave, Pilot Ronald J. Grabe, and MS Norman E. Thagard. FB-SMS is located in JSC's Mission Simulation and Training Facility Bldg 5.

STS-55 crewmembers repair waste water tank on OV-102's middeck

Science.gov (United States)

1993-01-01

Three STS-55 crewmembers participate in an inflight maintenance (IFM) exercise to counter problems experienced with a waste water tank below Columbia's, Orbiter Vehicle (OV) 102's, middeck. Mission Specialist 3 (MS3) Bernard A. Harris, Jr, inside the airlock, holds middeck floor access panel MD54G and looks below at Pilot Terence T. Henricks who is in the bilge area. Commander Steven R. Nagel is lying on middeck floor at the left.

STS: Adding Value To Research and Practice.

Science.gov (United States)

Kumar, David D.; Chubin, Daryl E.

2000-01-01

Introduces the Kumar and Chubin-edited collection, "Science, Technology, and Society: A Sourcebook on Research and Practice". Presents an outline of the 12 chapters that examine STS trends, curriculum, teaching, learning, mentoring, advocacy, public policy, and issues for further research. (Author/WRM)

AMIE Camera System on board SMART-1

Science.gov (United States)

Josset, J. L.; Beauvivre, S.; Amie Team

The Advanced Moon micro-Imager Experiment AMIE on board ESA SMART-1 the first European mission to the Moon launched on 27th September 2003 is an imaging system with scientific technical and public outreach oriented objectives The science objectives are to image the Lunar Poles permanent shadow areas ice deposit eternal light crater rims ancient Lunar Non-mare volcanism local spectro-photometry and physical state of the lunar sur-face and to map high latitudes regions south mainly at far side South Pole Aitken basin The technical objectives are to perform a laserlink experiment detec-tion of laser beam emitted by ESA Tenerife ground station flight demonstration of new technologies and on-board autonomy navigation The public outreach and educational objectives are to promote planetary exploration We present the AMIE instrument and perfomances with respect to the first results

Stephen K. Robinson arrives at KSC for the STS-95 launch

Science.gov (United States)

1998-01-01

STS-95 Mission Specialist Stephen K. Robinson, arrives at Kennedy Space Center's Shuttle Landing Facility aboard a T-38 jet as part of final preparations for launch. The STS-95 mission, targeted for liftoff at 2 p.m. on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. The mission is expected to last 8 days, 21 hours and 49 minutes, and return to KSC on Nov. 7. The other STS-95 crew members are Mission Commander Curtis L. Brown Jr., Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Payload Specialist John H. Glenn Jr., senator from Ohio, Mission Specialist Pedro Duque, with the European Space Agency (ESA), and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA).

On-Orbit Prospective Echocardiography on International Space Station

Science.gov (United States)

Hamilton, Douglas R.; Sargsyan, Ashot E.; Martin, David; Garcia, Kathleen M.; Melton, Shannon; Feiverson, Alan; Dulchavsky, Scott A.

2010-01-01

A number of echocardiographic research projects and experiments have been flown on almost every space vehicle since 1970, but validation of standard methods and the determination of Space Normal cardiac function has not been reported to date. Advanced Diagnostics in Microgravity (ADUM) -remote guided echocardiographic technique provides a novel and effective approach to on-board assessment of cardiac physiology and structure using a just-in-time training algorithm and real-time remote guidance aboard the International Space Station (ISS). The validation of remotely guided echocardiographic techniques provides the procedures and protocols to perform scientific and clinical echocardiography on the ISS and the Moon. The objectives of this study were: 1.To confirm the ability of non-physician astronaut/cosmonaut crewmembers to perform clinically relevant remotely guided echocardiography using the Human Research Facility on board the ISS. 2.To compare the preflight, postflight and in-flight echocardiographic parameters commonly used in clinical medicine.

19 CFR 115.16 - Notification of Certifying Authority by manufacturer.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Notification of Certifying Authority by manufacturer. 115.16 Section 115.16 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... INTERNATIONAL CUSTOMS CONVENTIONS Administration § 115.16 Notification of Certifying Authority by manufacturer...

Effect of dynamic monotonic and cyclic loading on fracture behavior for Japanese carbon steel pipe STS410

Energy Technology Data Exchange (ETDEWEB)

Kinoshita, Kanji; Murayama, Kouichi; Ogata, Hiroyuki [and others

1997-04-01

The fracture behavior for Japanese carbon steel pipe STS410 was examined under dynamic monotonic and cyclic loading through a research program of International Piping Integrity Research Group (EPIRG-2), in order to evaluate the strength of pipe during the seismic event The tensile test and the fracture toughness test were conducted for base metal and TIG weld metal. Three base metal pipe specimens, 1,500mm in length and 6-inch diameter sch.120, were employed for a quasi-static monotonic, a dynamic monotonic and a dynamic cyclic loading pipe fracture tests. One weld joint pipe specimen was also employed for a dynamic cyclic loading test In the dynamic cyclic loading test, the displacement was controlled as applying the fully reversed load (R=-1). The pipe specimens with a circumferential through-wall crack were subjected four point bending load at 300C in air. Japanese STS410 carbon steel pipe material was found to have high toughness under dynamic loading condition through the CT fracture toughness test. As the results of pipe fracture tests, the maximum moment to pipe fracture under dynamic monotonic and cyclic loading condition, could be estimated by plastic collapse criterion and the effect of dynamic monotonic loading and cyclic loading was a little on the maximum moment to pipe fracture of the STS410 carbon steel pipe. The STS410 carbon steel pipe seemed to be less sensitive to dynamic and cyclic loading effects than the A106Gr.B carbon steel pipe evaluated in IPIRG-1 program.

Effect of dynamic monotonic and cyclic loading on fracture behavior for Japanese carbon steel pipe STS410

International Nuclear Information System (INIS)

Kinoshita, Kanji; Murayama, Kouichi; Ogata, Hiroyuki

1997-01-01

The fracture behavior for Japanese carbon steel pipe STS410 was examined under dynamic monotonic and cyclic loading through a research program of International Piping Integrity Research Group (EPIRG-2), in order to evaluate the strength of pipe during the seismic event The tensile test and the fracture toughness test were conducted for base metal and TIG weld metal. Three base metal pipe specimens, 1,500mm in length and 6-inch diameter sch.120, were employed for a quasi-static monotonic, a dynamic monotonic and a dynamic cyclic loading pipe fracture tests. One weld joint pipe specimen was also employed for a dynamic cyclic loading test In the dynamic cyclic loading test, the displacement was controlled as applying the fully reversed load (R=-1). The pipe specimens with a circumferential through-wall crack were subjected four point bending load at 300C in air. Japanese STS410 carbon steel pipe material was found to have high toughness under dynamic loading condition through the CT fracture toughness test. As the results of pipe fracture tests, the maximum moment to pipe fracture under dynamic monotonic and cyclic loading condition, could be estimated by plastic collapse criterion and the effect of dynamic monotonic loading and cyclic loading was a little on the maximum moment to pipe fracture of the STS410 carbon steel pipe. The STS410 carbon steel pipe seemed to be less sensitive to dynamic and cyclic loading effects than the A106Gr.B carbon steel pipe evaluated in IPIRG-1 program

Defense Business Board

Science.gov (United States)

Skip to main content (Press Enter). Toggle navigation Defense Business Board Search Search Defense Business Board: Search Search Defense Business Board: Search Defense Business Board Business Excellence in Defense of the Nation Defense Business Board Home Charter Members Meetings Studies Contact Us The Defense

Selected spectroscopic results on element 115 decay chains

International Nuclear Information System (INIS)

Rudolph, D.; Forsberg, U.; Golubev, P.; Sarmiento, L.G.; Yakushev, A.; Andersson, L.L.; Di Nitto, A.; Duellmann, Ch.E.; Gates, J.M.; Gregorich, K.E.

2015-01-01

Thirty correlated α-decay chains were observed in an experiment studying the fusion-evaporation reaction 48 Ca + 243 Am at the GSI Helmholtzzentrum fuer Schwerionenforschung. The decay characteristics of the majority of these 30 chains are consistent with previous observations and interpretations of such chains to originate from isotopes of element Z = 115. High-resolution α-photon coincidence spectroscopy in conjunction with comprehensive Monte-Carlo simulations allow to propose excitation schemes of atomic nuclei of the heaviest elements, thereby probing nuclear structure models near the 'Island of Stability' with unprecedented experimental precision. (author)

33 CFR 115.30 - Sufficiency of State authority for bridges.

Science.gov (United States)

2010-07-01

... for bridges. 115.30 Section 115.30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES BRIDGE LOCATIONS AND CLEARANCES; ADMINISTRATIVE PROCEDURES § 115.30 Sufficiency of State authority for bridges. An opinion of the attorney general of the State as to the sufficiency of State...

STS-95 Day 03 Highlights

Science.gov (United States)

1998-01-01

On this third day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, are seen checking out equipment that will be used for the deployment of the Spartan, a small, Shuttle-launched and retrieved satellite, whose mission is to study the Sun.

19 CFR 115.40 - Technical requirements for containers.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Technical requirements for containers. 115.40...; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS CONVENTIONS Procedures for Approval of Containers After Manufacture § 115.40 Technical requirements for...

Self-help on-line: an outcome evaluation of breast cancer bulletin boards.

Science.gov (United States)

Lieberman, Morton A; Goldstein, Benjamin A

2005-11-01

Many breast cancer patients find help from on-line self-help groups, consisting of self-directed, asynchronous, bulletin boards. These have yet to be empirically evaluated. Upon joining a group and 6 months later, new members (N=114) to breast cancer bulletin boards completed measures of depression (CES-D), growth (PTGI) and psychosocial wellbeing (FACT-B). Improvement was statistically significant on all three measures. This serves as a first validation of Internet bulletin boards as a source of support and help for breast cancer patients. These boards are of particular interest because they are free, accessible and support comes from peers and not from professional facilitators.

STS-35 crewmembers eat meal on the middeck of Columbia, OV-102

Science.gov (United States)

1990-01-01

Enjoying a meal on the middeck of Columbia, Orbiter Vehicle (OV) 102, are STS-35 Mission Specialist (MS) Robert A.R. Parker (foreground), Payload Specialist Ronald A. Parise (center), and Commander Vance D. Brand. Parker spoons up bite from his food container as Parise lets a spoonful freefloat into his open mouth and Brand balances his meal tray assembly. The forward lockers, the shuttle treadmill, and the starboard side sleep station are seen in the view.

STS-35 payload specialists perform balancing act on OV-102's middeck

Science.gov (United States)

1990-01-01

Aided by the microgravity environment aboard Columbia, Orbiter Vehicle (OV) 102, STS-35 Payload Specialist Ronald A. Parise balances Payload Specialist Samuel T. Durrance on his index finger in front of the middeck starboard wall. Durrance is wearing a blood pressure cuff and is holding a beverage container and food package during the microgravity performance. The waste management compartment (WMC), side hatch, and orbiter galley are seen behind the two crewmembers. Durrance's feet are at the forward lockers.

Tunneling Accelerometer Multichip Module

Science.gov (United States)

Boyadzhyan, V. V.; Choma, J., Jr.

1998-01-01

This paper summarizes and reports a radiation hardened Spacecraft Integrated Sensor/Circut Technology that has been delivered for flight applications to be flown on board STRV-2 (Space Technology Research Vehicle-2).

Patients overwhelmingly prefer inpatient boarding to emergency department boarding.

Science.gov (United States)

Viccellio, Peter; Zito, Joseph A; Sayage, Valerie; Chohan, Jasmine; Garra, Gregory; Santora, Carolyn; Singer, Adam J

2013-12-01

Boarding of admitted patients in the emergency department (ED) is a major cause of crowding. One alternative to boarding in the ED, a full-capacity protocol where boarded patients are redeployed to inpatient units, can reduce crowding and improve overall flow. Our aim was to compare patient satisfaction with boarding in the ED vs. inpatient hallways. We performed a structured telephone survey regarding patient experiences and preferences for boarding among admitted ED patients who experienced boarding in the ED hallway and then were subsequently transferred to inpatient hallways. Demographic and clinical characteristics, as well as patient preferences, including items related to patient comfort and safety using a 5-point scale, were recorded and descriptive statistics were used to summarize the data. Of 110 patients contacted, 105 consented to participate. Mean age was 57 ± 16 years and 52% were female. All patients were initially boarded in the ED in a hallway before their transfer to an inpatient hallway bed. The overall preferred location after admission was the inpatient hallway in 85% (95% confidence interval 75-90) of respondents. In comparing ED vs. inpatient hallway boarding, the following percentages of respondents preferred inpatient boarding with regard to the following 8 items: rest, 85%; safety, 83%; confidentiality, 82%; treatment, 78%; comfort, 79%; quiet, 84%; staff availability, 84%; and privacy, 84%. For no item was there a preference for boarding in the ED. Patients overwhelmingly preferred the inpatient hallway rather than the ED hallway when admitted to the hospital. Copyright © 2013 Elsevier Inc. All rights reserved.

34 CFR 97.115 - IRB records.

Science.gov (United States)

2010-07-01

... the Secretary, Department of Education PROTECTION OF HUMAN SUBJECTS Federal Policy for the Protection of Human Subjects (Basic ED Policy for Protection of Human Research Subjects) § 97.115 IRB records... in sufficient detail to show attendance at the meetings; actions taken by the IRB; the vote on these...

Impact of STS (Context-Based Type of Teaching) in Comparison With a Textbook Approach on Attitudes and Achievement in Community College Chemistry Classrooms

Science.gov (United States)

Perkins, Gita

The purpose of this study was to analyze the impact of a context-based teaching approach (STS) versus a more traditional textbook approach on the attitudes and achievement of community college chemistry students. In studying attitudes toward chemistry within this study, I used a 30-item Likert scale in order to study the importance of chemistry in students' lives, the importance of chemistry, the difficulty of chemistry, interest in chemistry, and the usefulness of chemistry for their future career. Though the STS approach students had higher attitude post scores, there was no significant difference between the STS and textbook students' attitude post scores. It was noted that females had higher postattitude scores in the STS group, while males had higher postattitude scores in the textbook group. With regard to postachievement, I noted that males had higher scores in both groups. A correlation existed between postattitude and postachievement in the STS classroom. In summary, while an association between attitude and achievement was found in the STS classroom, teaching approach or sex was not found to influence attitudes, while sex was also not found to influence achievement. These results, overall, suggest that attitudes are not expected to change on the basis of either teaching approach or gender, and that techniques other than changing the teaching approach would need to be used in order to improve the attitudes of students. Qualitative analysis of an online discussion activity on Energy revealed that STS students were able to apply aspects of chemistry in decision making related to socioscientific issues. Additional analysis of interview and written responses provided insight regarding attitudes toward chemistry, with respect to topics of applicability of chemistry to life, difficulties with chemistry, teaching approach for chemistry, and the intent for enrolling in additional chemistry courses. In addition, the surveys of female students brought out

On the “missing” deep-hole strength in 115Sn

NARCIS (Netherlands)

Siemssen, RH; Jones, WP; Jacobs, WW; Foster, CC; Miller, DW; Saber, M; Soga, F

1981-01-01

Evidence is found for a “new” deep hole component in 115Sn extending to about 18 MeV excitation and containing most likely strength in addition to 2p strength. With this new component, a better definition of the “background” is possible. All of the combined sum rule strength can be accounted for

STS-93 Commander Collins suits up for launch

Science.gov (United States)

1999-01-01

During the third launch preparations in the Operations and Checkout Building, STS-93 Commander Eileen M. Collins waves while having her launch and entry suit checked. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

STS-31 Pilot Bolden with beverages on the FB-SMS middeck during JSC training

Science.gov (United States)

1988-01-01

STS-31 Pilot Charles F. Bolden holds three beverage containers while in front of the galley on the middeck of the fixed based (FB) shuttle mission simulator (SMS) during a training simulation at JSC's Mission Simulation and Training Facility Bldg 5. From the middeck, Bolden, wearing lightweight headset, simulates a communications link with ground controllers and fellow crewmembers.

WeaselBoard :

Energy Technology Data Exchange (ETDEWEB)

Mulder, John C.; Schwartz, Moses Daniel; Berg, Michael J.; Van Houten, Jonathan Roger; Urrea, Jorge Mario; King, Michael Aaron; Clements, Abraham Anthony; Jacob, Joshua A.

2013-10-01

Critical infrastructures, such as electrical power plants and oil refineries, rely on programmable logic controllers (PLCs) to control essential processes. State of the art security cannot detect attacks on PLCs at the hardware or firmware level. This renders critical infrastructure control systems vulnerable to costly and dangerous attacks. WeaselBoard is a PLC backplane analysis system that connects directly to the PLC backplane to capture backplane communications between modules. WeaselBoard forwards inter-module traffic to an external analysis system that detects changes to process control settings, sensor values, module configuration information, firmware updates, and process control program (logic) updates. WeaselBoard provides zero-day exploit detection for PLCs by detecting changes in the PLC and the process. This approach to PLC monitoring is protected under U.S. Patent Application 13/947,887.

Accidents on board merchant ships. Suggestions based on Centro Internazionale Radio Medico (CIRM) experience.

Science.gov (United States)

Napoleone, Paolo

2016-01-01

This statistical study was performed to find out the occurrence of accidents on board ships assisted by Centro Internazionale Radio Medico (CIRM) during the years 2010-2015, with the aim of providing suggestions in accident prevention, based on such a wide experience. The case histories of CIRM in the years 2010-2015 were examined. The total number of accidents per year was calculated and compared as a percentage with the total number of cases assisted by CIRM per year. The incidence of accidents on board in these years ranged between 14.4% and 18.4% of total cases assisted per year, which is constantly increasing. The most common injuries on board among cases treated by CIRM were contusions and wounds. Also burns and eye injuries were significantly represented. Multiple injuries and head injuries were found to be the most frequent cause of death on board due to an accident. More information on the occurrence and type of accidents and on the body injured areas should represent the basis for developing strategies and campaigns for their prevention.

Results of the experiment on chemical identification of Db as a decay product of element 115

International Nuclear Information System (INIS)

Dmitriev, S.N.; Oganesyan, Yu.Ts.; Utenkov, V.K.

2004-01-01

For the first time the chemical identification of Db as the terminal isotope of the decay element 115 produced via the 243 Am( 48 Ca, 3n) 288 115 reaction was realized. The experiment was performed on the U400 cyclotron of FLNR, JINR. The 243 Am target was bombarded with a beam dose of 3.4 · 10 18 48 Ca projectiles at an energy of 247 MeV in the center of the target. The reaction products were collected in the surface of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO 3 . The group 5 elements were separated by sorption onto Dowex 50X8 cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group 5 elements. The eluant was evaporated onto 0.4 μm thick polyethylene foils which were placed between a pair of semiconductor detectors surrounded by 3 He neutron counters for measurement of α particles, fission fragments and neutrons. Over the course of the experiment, we observed 15 spontaneous fission events with T 1/2 = 32 -7 +11 h which we attribute to 268 Db. The production cross section for the 243 Am + 48 Ca reaction was 4.2 -1.2 + 1 .6 pb. These results agree with the original element 115 synthesis experiment where 268 Db was first observed as the terminal isotope following the five consecutive α decays from the 288 115 parent nucleus at the Dubna gas-filled separator. The data from the present experiment give independent evidence for the synthesis of element 115 as well as element 113 via the 243 Am + 48 Ca reaction

13 CFR 115.16 - Determination of Surety's Loss.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Determination of Surety's Loss. 115.16 Section 115.16 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND... generally accepted accounting principles; and (2) Amounts actually paid by the Surety for court costs and...

STS-99 workers move new Master Events Controller into aft compartment

Science.gov (United States)

2000-01-01

At Launch Pad 39A, workers move the replacement Enhanced Main Events Controller (E-MEC) into Shuttle Endeavour's aft compartment in the payload bay. The original E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.

The faulty Master Events Controller is removed from STS-99 Endeavour

Science.gov (United States)

2000-01-01

Technicians remove a faulty Enhanced Main Events Controller (E- MEC) from Shuttle Endeavour at Launch Pad 39A. The E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.

75 FR 40838 - Establishment of the Advisory Board on Elder Abuse, Neglect, and Exploitation

Science.gov (United States)

2010-07-14

... DEPARTMENT OF HEALTH AND HUMAN SERVICES Establishment of the Advisory Board on Elder Abuse...: Notice. Authority: The Advisory Board on Elder Abuse, Neglect, and Exploitation is authorized under... Services announces establishment of the Advisory Board on Elder Abuse, Neglect, and Exploitation, as...

Wiring Damage Analyses for STS OV-103

Science.gov (United States)

Thomas, Walter, III

2006-01-01

This study investigated the Shuttle Program s belief that Space Transportation System (STS) wiring damage occurrences are random, that is, a constant occurrence rate. Using Problem Reporting and Corrective Action (PRACA)-derived data for STS Space Shuttle OV-103, wiring damage was observed to increase over the vehicle s life. Causal factors could include wiring physical deterioration, maintenance and inspection induced damage, and inspection process changes resulting in more damage events being reported. Induced damage effects cannot be resolved with existent data. Growth analysis (using Crow-AMSAA, or CA) resolved maintenance/inspection effects (e.g., heightened awareness) on all wire damages and indicated an overall increase since Challenger Return-to-Flight (RTF). An increasing failure or occurrence rate per flight cycle was seen for each wire damage mode; these (individual) rates were not affected by inspection process effects, within statistical error.

24 CFR 206.115 - [Reserved

Science.gov (United States)

2010-04-01

... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums § 206.115 [Reserved] ...

21 CFR 201.115 - New drugs or new animal drugs.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 4 2010-04-01 2010-04-01 false New drugs or new animal drugs. 201.115 Section 201.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.115 New drugs or new animal...

49 CFR 1522.115 - Renewal of TSA approval.

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Renewal of TSA approval. 1522.115 Section 1522.115..., DEPARTMENT OF HOMELAND SECURITY SECURITY RULES FOR ALL MODES OF TRANSPORTATION TSA-APPROVED VALIDATION FIRMS AND VALIDATORS TSA-Approved Validation Firms and Validators for the Certified Cargo Screening Program...

New control method of on-board ATP system of Shinkansen trains

Energy Technology Data Exchange (ETDEWEB)

Fukuda, N.; Watanabe, T. [Railway Technical Research Inst. (Japan)

2000-07-01

We studied a new control method of the on-board automatic train protection (ATP) system for Shinkansen trains to shorten the operation time and not to degrade ride comfort at changes in deceleration of the train, while maintaining the safety and reliability of the present ATP signal system. We propose a new on-board pattern brake control system based on the present ATP data without changing the wayside equipment. By simulating the ATP braking of the proposed control method, we succeeded in shortening the operation time by 48 seconds per one station in comparison with the present ATP brake control system. This paper reports the concept of the system and simulation results of the on-board pattern. (orig.)

Spacecube: A Family of Reconfigurable Hybrid On-Board Science Data Processors

Science.gov (United States)

Flatley, Thomas P.

2015-01-01

SpaceCube is a family of Field Programmable Gate Array (FPGA) based on-board science data processing systems developed at the NASA Goddard Space Flight Center (GSFC). The goal of the SpaceCube program is to provide 10x to 100x improvements in on-board computing power while lowering relative power consumption and cost. SpaceCube is based on the Xilinx Virtex family of FPGAs, which include processor, FPGA logic and digital signal processing (DSP) resources. These processing elements are leveraged to produce a hybrid science data processing platform that accelerates the execution of algorithms by distributing computational functions to the most suitable elements. This approach enables the implementation of complex on-board functions that were previously limited to ground based systems, such as on-board product generation, data reduction, calibration, classification, eventfeature detection, data mining and real-time autonomous operations. The system is fully reconfigurable in flight, including data parameters, software and FPGA logic, through either ground commanding or autonomously in response to detected eventsfeatures in the instrument data stream.

STS-61B Crew Portrait

Science.gov (United States)

1985-01-01

The crew assigned to the STS-61B mission included (kneeling left to right) Bryan D. O'conner, pilot; and Brewster H. Shaw, commander. On the back row, left to right, are Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Autralia); and SATCOM KU-2 (RCA Americom. Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, VA and Marshall Space Flight Center (MSFC), the Assembly Concept for Construction of Erectable Space Structures (ACCESS) was developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). The primary objective of this experiment was to test the ACCESS structural assembly concept for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

What makes boards effective? An examination of the relationships between board inputs, structures, processes and effectiveness in non-profit organizations

OpenAIRE

Cornforth, Chris

2001-01-01

Based on a survey of charity boards in England and Wales this paper examines what influence board inputs, structures and processes have on board effectiveness. The findings provide mixed support for the normative literature on board effectiveness. Using stepwise logistic regression the research suggests that board inputs and three process variables are important in explaining board effectiveness, namely: board members have the time, skills and experience to do the job; clear board roles and r...

13 CFR 115.60 - Selection and admission of PSB Sureties.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Selection and admission of PSB Sureties. 115.60 Section 115.60 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND GUARANTEE Preferred Surety Bond (PSB) Guarantees § 115.60 Selection and admission of PSB Sureties. (a) Selection of PSB Sureties. SBA's selection o...

STS-86 crew addresses the press during TCDT activities at LC 39A

Science.gov (United States)

1997-01-01

STS-86 Commander James D. Wetherbee, with microphone, and other crew members of the Space Shuttle Atlantis speak to media representatives and other onlookers at Launch Pad 39A during the Terminal Countdown Demonstration Test (TCDT), a dress rehearsal for launch From right, after Wetherbee, are Pilot Michael J. Bloomfield, Mission Specialist Vladimir Georgievich Titov of the Russian Space Agency, Mission Specialist Scott E. Parazynski, Mission Specialist Jean-Loup J.M. Chretien of the French Space Agency, CNES, and Mission Specialists Wendy B. Lawrence and David A. Wolf. STS-86 will be the seventh docking of the Space Shuttle with the Russian Space Station Mir. During the docking, Wolf will transfer to the orbiting Russian station and become a member of the Mir 24 crew, replacing U.S. astronaut C. Michael Foale, who has been on the Mir since the last docking mission, STS-84, in May. Launch of Mission STS-86 aboard the Space Shuttle Atlantis is targeted for Sept. 25.

A study on the effect of board of directors on the rate of corporate transparency

Directory of Open Access Journals (Sweden)

Iman Rezaei

2012-10-01

Full Text Available The main target of this study is to consider the effect of the combination of board of directors on the corporate transparency in some companies among selected ones in Tehran Stock Exchange Market over the period of 2007- 2010. In this research, the combination of board of directors is selected among some factors of corporate transparency such as structure of ownership and the rights of owners, financial information and statistics and structure and combination of board of directors and managers as a sub-indicator for corporate governance. Linear regression statistical method is used to test hypotheses of study. The size of α is considered as 5% and hypotheses are accepted or rejected by means of Durbin-Watson and Clemogrov-Smirnov tests and by comparing p-value with α. At last, by means of forward regression method, the effect of control variables is considered over each hypothesis. The results show that the members of board of directors have no effect on partnership transparency, but effect on financial data and information and structure and combination of board of directors.

Non-compliance with Australian stock exchange recommendations on board independence

Directory of Open Access Journals (Sweden)

Patricia O’Keefe

2011-11-01

Full Text Available An agency theory perspective is adopted to explain the high levels of non-compliance with recommendations concerning board structure of the Australian Stock Exchange’s (ASX Corporate Governance Principles and Recommendations. The study compares groups of compliers and non-compliers drawn from members of the ASX All Ordinaries Index. The results indicate that, in the presence of mitigating factors such as less complexity, higher levels of managerial ownership of equity and higher ownership concentration, entities are less likely to comply with the recommendations on board independence. The results suggest that the compliance decision might be influenced by mitigating factors that reduce the need for board independence.

Education Unit Transformation for Maintain Its Existence in Islamic Boarding School (Multi-Case Study on Tebuireng Islamic Boarding School, Gading Islamic Boarding School Malang, and Sidogiri Islamic Boarding School Pasuruan)

Science.gov (United States)

Busyairi AS, M.

2017-01-01

Islamic Boarding School which serves as native Islamic education institution is a continuation of education tradition grown strongly in Islamization history in unitary nation Republic of Indonesia. The education of Islamic Boarding School is also a sub-system of National Education with the purpose to make intelligent national life, to make…

33 CFR 115.70 - Advance approval of bridges.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Advance approval of bridges. 115... BRIDGES BRIDGE LOCATIONS AND CLEARANCES; ADMINISTRATIVE PROCEDURES § 115.70 Advance approval of bridges. (a) The General Bridge Act of 1946 requires the approval of the location and plans of bridges prior...

10 CFR 63.115 - Requirements for multiple barriers.

Science.gov (United States)

2010-01-01

... Requirements for multiple barriers. Demonstration of compliance with § 63.113(a) must: (a) Identify those design features of the engineered barrier system, and natural features of the geologic setting, that are... 10 Energy 2 2010-01-01 2010-01-01 false Requirements for multiple barriers. 63.115 Section 63.115...

STS-103 Pilot Scott Kelly during TCDT activities

Science.gov (United States)

1999-01-01

STS-103 Pilot Scott J. Kelly is ready to take his turn at driving a small armored personnel carrier that is part of emergency egress training during Terminal Countdown Demonstration Test (TCDT) activities. Behind him (left) is Mission Specialist Jean-Frangois Clervoy of France, who is with the European Space Agency. At right is Mission Specialist Steven L. Smith. The tracked vehicle could be used by the crew in the event of an emergency at the pad during which the crew must make a quick exit from the area. The TCDT also provides simulated countdown exercises and opportunities to inspect the mission payloads in the orbiter's payload bay. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope. Although Hubble is operating normally and conducting its scientific observations, only three of its six gyroscopes are working properly. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The other STS-103 crew members are Commander Curtis L. Brown Jr. and Mission Specialists C. Michael Foale (Ph.D.), John M. Grunsfeld (Ph.D.), and Claude Nicollier of Switzerland, who also is with the European Space Agency. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

Governing Board of the Pension Fund

CERN Multimedia

2006-01-01

The Governing Board of the Pension Fund held its 142nd meeting on 14 March 2006. As an introduction to the meeting, the Administrator underlined that, at 12.4%, the performance achieved by the Fund on its assets had been excellent and had taken the Fund's assets at the end of the year to 4,209 MCHF, which was well above the 4 billion Swiss franc mark. The Chairman of the Governing Board, Professor Ferrini, reported on the Board's closed session on 7 March to examine the nominations received for the election of the Vice-Chairmen of the Governing Board of the Pension Fund. The Governing Board had unanimously agreed to recommend the CERN Council to appoint Mr A. J. Naudi and Dr J.-P. Matheys. At its session on 16 March 2006, the Council had followed the recommendation of the Governing Board by re-appointing J.-P. Matheys and A. J. Naudi Vice-Chairmen of the Board until the end of their respective terms of office as members of the Governing Board. Regarding the comparison with other European pension funds launc...

Data Products From Particle Detectors On-Board NOAA's Newest Space Weather Monitor

Science.gov (United States)

Kress, B. T.; Rodriguez, J. V.; Onsager, T. G.

2017-12-01

NOAA's newest Geostationary Operational Environmental Satellite, GOES-16, was launched on 19 November 2016. Instrumentation on-board GOES-16 includes the new Space Environment In-Situ Suite (SEISS), which has been collecting data since 8 January 2017. SEISS is composed of five magnetospheric particle sensor units: an electrostatic analyzer for measuring 30 eV - 30 keV ions and electrons (MPS-LO), a high energy particle sensor (MPS-HI) that measures keV to MeV electrons and protons, east and west facing Solar and Galactic Proton Sensor (SGPS) units with 13 differential channels between 1-500 MeV, and an Energetic Heavy Ion Sensor (EHIS) that measures 30 species of heavy ions (He-Ni) in five energy bands in the 10-200 MeV/nuc range. Measurement of low energy magnetospheric particles by MPS-LO and heavy ions by EHIS are new capabilities not previously flown on the GOES system. Real-time data from GOES-16 will support space weather monitoring and first-principles space weather modeling by NOAA's Space Weather Prediction Center (SWPC). Space weather level 2+ data products under development at NOAA's National Centers for Environmental Information (NCEI) include the Solar Energetic Particle (SEP) Event Detection algorithm. Legacy components of the SEP event detection algorithm (currently produced by SWPC) include the Solar Radiation Storm Scales. New components will include, e.g., event fluences. New level 2+ data products also include the SEP event Linear Energy Transfer (LET) Algorithm, for transforming energy spectra from EHIS into LET spectra, and the Density and Temperature Moments and Spacecraft Charging algorithm. The moments and charging algorithm identifies electron and ion signatures of spacecraft surface (frame) charging in the MPS-LO fluxes. Densities and temperatures from MPS-LO will also be used to support a magnetopause crossing detection algorithm. The new data products will provide real-time indicators of potential radiation hazards for the satellite

Measuring Input Thresholds on an Existing Board

Science.gov (United States)

Kuperman, Igor; Gutrich, Daniel G.; Berkun, Andrew C.

2011-01-01

A critical PECL (positive emitter-coupled logic) interface to Xilinx interface needed to be changed on an existing flight board. The new Xilinx input interface used a CMOS (complementary metal-oxide semiconductor) type of input, and the driver could meet its thresholds typically, but not in worst-case, according to the data sheet. The previous interface had been based on comparison with an external reference, but the CMOS input is based on comparison with an internal divider from the power supply. A way to measure what the exact input threshold was for this device for 64 inputs on a flight board was needed. The measurement technique allowed an accurate measurement of the voltage required to switch a Xilinx input from high to low for each of the 64 lines, while only probing two of them. Directly driving an external voltage was considered too risky, and tests done on any other unit could not be used to qualify the flight board. The two lines directly probed gave an absolute voltage threshold calibration, while data collected on the remaining 62 lines without probing gave relative measurements that could be used to identify any outliers. The PECL interface was forced to a long-period square wave by driving a saturated square wave into the ADC (analog to digital converter). The active pull-down circuit was turned off, causing each line to rise rapidly and fall slowly according to the input s weak pull-down circuitry. The fall time shows up as a change in the pulse width of the signal ready by the Xilinx. This change in pulse width is a function of capacitance, pulldown current, and input threshold. Capacitance was known from the different trace lengths, plus a gate input capacitance, which is the same for all inputs. The pull-down current is the same for all inputs including the two that are probed directly. The data was combined, and the Excel solver tool was used to find input thresholds for the 62 lines. This was repeated over different supply voltages and

STS-98 Crew Interview: Tom Jones

Science.gov (United States)

2001-01-01

The STS-98 Mission Specialist Tom Jones is seen being interviewed. He answers questions about his inspiration to become an astronaut, his career path, and his training. He gives details on the mission's goals and significance, and the payload and hardware it brings to the International Space Station (ISS). Mr. Jones discusses his role in the mission's spacewalks and activities.

Benchmarking pKa prediction methods for Lys115 in acetoacetate decarboxylase.

Science.gov (United States)

Liu, Yuli; Patel, Anand H G; Burger, Steven K; Ayers, Paul W

2017-05-01

Three different pK a prediction methods were used to calculate the pK a of Lys115 in acetoacetate decarboxylase (AADase): the empirical method PROPKA, the multiconformation continuum electrostatics (MCCE) method, and the molecular dynamics/thermodynamic integration (MD/TI) method with implicit solvent. As expected, accurate pK a prediction of Lys115 depends on the protonation patterns of other ionizable groups, especially the nearby Glu76. However, since the prediction methods do not explicitly sample the protonation patterns of nearby residues, this must be done manually. When Glu76 is deprotonated, all three methods give an incorrect pK a value for Lys115. If protonated, Glu76 is used in an MD/TI calculation, the pK a of Lys115 is predicted to be 5.3, which agrees well with the experimental value of 5.9. This result agrees with previous site-directed mutagenesis studies, where the mutation of Glu76 (negative charge when deprotonated) to Gln (neutral) causes no change in K m , suggesting that Glu76 has no effect on the pK a shift of Lys115. Thus, we postulate that the pK a of Glu76 is also shifted so that Glu76 is protonated (neutral) in AADase. Graphical abstract Simulated abundances of protonated species as pH is varied.

A new Master Events Controller is prepared for installation in STS-99 Endeavour

Science.gov (United States)

2000-01-01

A new Enhanced Main Events Controller (E-MEC) for Shuttle Endeavour sits on a table in a Quality trailer in the Launch Pad 39B area. The original E-MEC in Endeavour became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. The E-MECs are located in the orbiter's aft compartment and both are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. Before workers can begin E-MEC replacement efforts at the launch pad, cryogenic reactants must be offloaded from the orbiter and Space Shuttle ordnance disconnected. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.

14 CFR 120.115 - Employee Assistance Program (EAP).

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Employee Assistance Program (EAP). 120.115... ALCOHOL TESTING PROGRAM Drug Testing Program Requirements § 120.115 Employee Assistance Program (EAP). (a) The employer shall provide an EAP for employees. The employer may establish the EAP as a part of its...

Emergency department boarding: a descriptive analysis and measurement of impact on outcomes.

Science.gov (United States)

Salehi, Leila; Phalpher, Prashant; Valani, Rahim; Meaney, Christopher; Amin, Qamar; Ferrari, Kiki; Mercuri, Mathew

2018-04-05

CLINICIAN'S CAPSULE What is known about the topic? Bed boarding is one of the major contributors to emergency department overcrowding. What did this study ask? What are the characteristics of patients with prolonged boarding times, and what are the impacts on patient-oriented outcomes? What did this study find? Patients who were older, sicker, and had isolation and telemetry requirements experienced longer boarding times, and longer inpatient length of stay even after correcting for confounders. Why does this study matter to clinicians? Organization-wide interventions to improve efficiency and flow are required to mitigate the burden of bed boarding.

Board diversity in family firms

OpenAIRE

Menozzi, Anna; Fraquelli, Giovanni; Novara, Jolanda de

2015-01-01

The paper deals with diversity as a key factor to improve the board of directors’ decision process in family firms. The empirical literature about board diversity points at the positive impact of diversity on board functioning and firm performance. The paper uses a statistical diversity index to capture the heterogeneity of board of directors and put it in relation with firm performance, as measured by firm profitability. The empirical analysis is based on a newly collected panel of 327 famil...

Writing on the board as students' preferred teaching modality in a physiology course.

Science.gov (United States)

Armour, Chris; Schneid, Stephen D; Brandl, Katharina

2016-06-01

The introduction of PowerPoint presentation software has generated a paradigm shift in the delivery of lectures. PowerPoint has now almost entirely replaced chalkboard or whiteboard teaching at the undergraduate and graduate levels. This study investigated whether undergraduate biology students preferred to have lectures delivered by PowerPoint or written on the board as well as the reasons behind their preference. Two upper-division physiology courses were surveyed over a period of 7 yr. A total of 1,905 students (86.7%) indicated they preferred lectures delivered by "writing on the board" compared to 291 students (13.3%) who preferred PowerPoint. Common themes drawn from explanations reported by students in favor of writing on the board included: 1) more appropriate pace, 2) facilitation of note taking, and 3) greater alertness and attention. Common themes in favor of PowerPoint included 1) increased convenience, 2) focus on listening, and 3) more accurate and readable notes. Based on the students' very strong preference for writing on the board and the themes supporting that preference, we recommend that instructors incorporate elements of the writing on the board delivery style into whatever teaching modality is used. If instructors plan to use PowerPoint, the presentation should be paced, constructed, and delivered to provide the benefits of lectures written on the board. The advantages of writing on the board can be also incorporated into instruction intended to occur outside the classroom, such as animated narrated videos as part of the flipped classroom approach. Copyright © 2016 The American Physiological Society.

76 FR 52997 - Public Company Accounting Oversight Board; Order Approving Proposed Board Funding Final Rules for...

Science.gov (United States)

2011-08-24

... Accounting Oversight Board; Order Approving Proposed Board Funding Final Rules for Allocation of the Board's... August 18, 2011. I. Introduction On June 21, 2011, the Public Company Accounting Oversight Board (the... public accounting firm, in amounts that are sufficient to cover the costs of processing and reviewing...

40 CFR 26.115 - IRB records.

Science.gov (United States)

2010-07-01

... Policy for Protection of Subjects in Human Research Conducted or Supported by EPA § 26.115 IRB records... in sufficient detail to show attendance at the meetings; actions taken by the IRB; the vote on these...)(5). (b) The records required by this policy shall be retained for at least 3 years, and records...

The Effect of Monitoring Committees on the Relationship between Board Structure and Firm Performance

Directory of Open Access Journals (Sweden)

Aymen Ammari

2016-12-01

Full Text Available The purpose of this study is to investigate the impact of board structure on the performance of French firms in the presence of several monitoring committees. We studied 80 publicly listed French firms spanning from 2001 to 2013. We concluded that large board size has a negative effect on market performance. While large board size in combination with the existence of at least three committees enhances accounting performance and does not have any impact on market performance, the existence of a board dominated by independent directors with the presence of at least three committees seems to have only a negative impact on accounting performance. Our findings indicate that monitoring committees are beneficial for shareholders only for corporations with a large board size.

Playing the Indicator Game: Reflections on Strategies to Position an STS Group in a Multi-disciplinary Environment

Directory of Open Access Journals (Sweden)

Roland Bal

2017-02-01

Full Text Available Roland Bal analyzes the strategies his research group developed to deal with the interlinked dynamics of research evaluation in a multi-disciplinary institutional environment characteristic of much STS research. Scholars in such environments constantly need to navigate and negotiate the standards of evaluation, in complex choreographies of cooperation and competition with other disciplinary groups. Bal describes strategies his group has successfully used, and how these strategies have both shifted the way research quality is assessed within the department as well as changed the way his group works and publishes. In conclusion, he describes performance management systems and research practices as co-constituted and calls for a debate on which forms of evaluation infrastructures allow for better ways of doing research in STS.

The Effect of Board Size and Board Composition on Firms Corporate Environmental Disclosure: A Study of Selected Firms in Nigeria

Directory of Open Access Journals (Sweden)

Uwalomwa Nil Uwuigbe

2011-10-01

Full Text Available Environmental problems have become major headlines due to the negative effects they bring to the stability of the ecosystem. Thus, the increased awareness of social responsibility or, specifically, environmental concern is now a challenge facing the corporate world. Hence this study tests whether board size and board composition have any association with the level of firms’ corporate environmental disclosure in annual reports. To achieve the objective of this study, a total of 40 listed firms on the floor of the Nigerian stock exchange market were used. Also, the study critically developed and utilized the Kinder Lydenberg Domini (KLD rating scheme to analyze the level of corporate environmental disclosure made by firms in their annual reports for the period 2006-2010. In addition, the simple regression analysis was used to test the research propositions as stated in the study. However, empirical findings from the study reveal that while board size has a significant negative relationship with the level of corporate environmental disclosure; board composition on the other hand has a significant positive relationship with the level of firms’ corporate environmental disclosure in the annual report.

Real-Time On-Board Airborne Demonstration of High-Speed On-Board Data Processing for Science Instruments (HOPS)

Science.gov (United States)

Beyon, Jeffrey Y.; Ng, Tak-Kwong; Davis, Mitchell J.; Adams, James K.; Bowen, Stephen C.; Fay, James J.; Hutchinson, Mark A.

2015-01-01

The project called High-Speed On-Board Data Processing for Science Instruments (HOPS) has been funded by NASA Earth Science Technology Office (ESTO) Advanced Information Systems Technology (AIST) program since April, 2012. The HOPS team recently completed two flight campaigns during the summer of 2014 on two different aircrafts with two different science instruments. The first flight campaign was in July, 2014 based at NASA Langley Research Center (LaRC) in Hampton, VA on the NASA's HU-25 aircraft. The science instrument that flew with HOPS was Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) CarbonHawk Experiment Simulator (ACES) funded by NASA's Instrument Incubator Program (IIP). The second campaign was in August, 2014 based at NASA Armstrong Flight Research Center (AFRC) in Palmdale, CA on the NASA's DC-8 aircraft. HOPS flew with the Multifunctional Fiber Laser Lidar (MFLL) instrument developed by Excelis Inc. The goal of the campaigns was to perform an end-to-end demonstration of the capabilities of the HOPS prototype system (HOPS COTS) while running the most computationally intensive part of the ASCENDS algorithm real-time on-board. The comparison of the two flight campaigns and the results of the functionality tests of the HOPS COTS are presented in this paper.

STS-29 crewmembers receive briefing on Student Experiment (SE) 83-9

Science.gov (United States)

1988-01-01

STS-29 Discovery, Orbiter Vehicle (OV) 103, crewmembers receive briefing on Student Experiment (SE) 83-9 Chicken Embryo Development in Space or 'Chix in Space' from student experimenter John C. Vellinger and sponsor Mark S. Deusser. Vellinger (right) explains operation of an incubator used in his experiment to crewmembers, seated around table, and other support personnel in audience. Clockwise from Mission Specialist (MS) Robert C. Springer (hands together at left) are MS James F. Buchli (glasses), Commander Michael L. Coats, Pilot John E. Blaha, MS James P. Bagian, Vellinger, and Deusser. The student's sponsor is Kentucky Fried Chicken (KFC).

STS-90 Pilot Scott Altman arrives at KSC for TCDT

Science.gov (United States)

1998-01-01

STS-90 Pilot Scott Altman poses in the cockpit of his T-38 jet trainer aircraft after arriving at the KSC Shuttle Landing Facility along with other members of the crew from NASAs Johnson Space Center to begin Terminal Countdown Demonstration Test (TCDT) activities. The TCDT is held at KSC prior to each Space Shuttle flight to provide crews with the opportunity to participate in simulated countdown activities. Columbia is targeted for launch of STS-90 on April 16 at 2:19 p.m. EST and will be the second mission of 1998. The mission is scheduled to last nearly 17 days.

40 CFR 81.115 - Northwest Nevada Intrastate Air Quality Control Region.

Science.gov (United States)

2010-07-01

... Quality Control Region. 81.115 Section 81.115 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.115 Northwest Nevada Intrastate Air Quality Control Region. The Northwest Nevada Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

Hospital boards and hospital strategic focus: the impact of board involvement in strategic decision making.

Science.gov (United States)

Ford-Eickhoff, Karen; Plowman, Donde Ashmos; McDaniel, Reuben R

2011-01-01

Despite pressures to change the role of hospital boards, hospitals have made few changes in board composition or director selection criteria. Hospital boards have often continued to operate in their traditional roles as either "monitors" or "advisors." More attention to the direct involvement of hospital boards in the strategic decision-making process of the organizations they serve, the timing and circumstances under which board involvement occurs, and the board composition that enhances their abilities to participate fully is needed. We investigated the relationship between broader expertise among hospital board members, board involvement in the stages of strategic decision making, and the hospital's strategic focus. We surveyed top management team members of 72 nonacademic hospitals to explore the participation of critical stakeholder groups such as the board of directors in the strategic decision-making process. We used hierarchical regression analysis to explore our hypotheses that there is a relationship between both the nature and involvement of the board and the hospital's strategic orientation. Hospitals with broader expertise on their boards reported an external focus. For some of their externally-oriented goals, hospitals also reported that their boards were involved earlier in the stages of decision making. In light of the complex and dynamic environment of hospitals today, those charged with developing hospital boards should match the variety in the external issues that the hospital faces with more variety in board makeup. By developing a board with greater breadth of expertise, the hospital responds to its complex environment by absorbing that complexity, enabling a greater potential for sensemaking and learning. Rather than acting only as monitors and advisors, boards impact their hospitals' strategic focus through their participation in the strategic decision-making process.

STS-61B Astronaut Ross During ACCESS Extravehicular Activity

Science.gov (United States)

1985-01-01

The crew assigned to the STS-61B mission included Bryan D. O'Conner, pilot; Brewster H. Shaw, commander; Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Australia); and SATCOM KU-2 (RCA Americom). Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, VA and the Marshall Space Flight Center (MSFC), ACCESS and EASE were developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). In this STS-61B onboard photo, astronaut Ross was working on the ACCESS experiment during an Extravehicular Activity (EVA). The primary objective of this experiment was to test the ACCESS structural assembly concept for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

Board-to-Board Free-Space Optical Interconnections Passing through Boards for a Bookshelf-Assembled Terabit-Per-Second-Class ATM Switch.

Science.gov (United States)

Hirabayashi, K; Yamamoto, T; Matsuo, S; Hino, S

1998-05-10

We propose free-space optical interconnections for a bookshelf-assembled terabit-per-second-class ATM switch. Thousands of arrayed optical beams, each having a rate of a few gigabits per second, propagate vertically to printed circuit boards, passing through some boards, and are connected to arbitrary transmitters and receivers on boards by polarization controllers and prism arrays. We describe a preliminary experiment using a 1-mm-pitch 2 x 2 beam-collimator array that uses vertical-cavity surface-emitting laser diodes. These optical interconnections can be made quite stable in terms of mechanical shock and temperature fluctuation by the attachment of reinforcing frames to the boards and use of an autoalignment system.

47 CFR 25.115 - Application for earth station authorizations.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Application for earth station authorizations. 25.115 Section 25.115 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25...

German versus Nordic Board Models

DEFF Research Database (Denmark)

Ringe, Georg

2016-01-01

Board structure is an important component of the individual governance of firms, and the appropriateness of the various models is one of the most debated issues in corporate governance today. A comparison of the Nordic and German approaches to the structure of corporate boards reveals stark...... conceptual differences, as emphasized by the 2014 Lekvall Report on the Nordic Corporate Governance Model. This article provides a conceptual comparison between the two approaches to board structure and confirms the fundamental divergence between both models. However, relying on a number of recent legal...... changes and developments in business practice, the article argues that board practices in the two systems effectively blur the structural distinction, and that board organization is converging in practice. It thereby contributes to the broader debates on functionality and comparative corporate law...

Thermoluminescent dose measurements on board Salyut type orbital stations

International Nuclear Information System (INIS)

Akatov, Yu.A.; Arkhangelskij, V.V.; Aleksandrov, A.P.

1984-06-01

A small, vibration- and shock-resistant thermoluminescent dosemeter (TLD) system - named PILLE - was developed for orbital stations at the Central Research Institute for Physics, Hungary, to measure the cosmic radiation dose on-board. The first on-board measurements with this system were performed by B. Farkas, the Hungarian astronaut, on the Salyut-6 space station in 1980. The same instrument was used by other crews in the following years. Doses measured at different sites in Salyut-6 are presented. The dose rates varied from 0.7 to 0.11 mGy.day -1 . After the first cosmic measurements, the system was further developed. The minimum detectable dose of the new TLD system is 1 μGy, i.e. less by one order of magnitude than that of the former system. The self-irradiation dose rate of the TLD bulbs is also reduced by more than an order of magnitude to 10 nGy.h -1 , by use of potassium-free glass for the bulb envelope. This new type of PILLE TLD system is currently on-board Salyut-7. The dose rates (0.12-0.23 mGy.day -1 ) measured in 1983 are presented in detail. (author)

78 FR 66384 - Membership of the Merit Systems Protection Board's Performance Review Board

Science.gov (United States)

2013-11-05

... MERIT SYSTEMS PROTECTION BOARD Membership of the Merit Systems Protection Board's Performance Review Board AGENCY: Merit Systems Protection Board. ACTION: Notice. SUMMARY: Notice is hereby given of the members of the Merit Systems Protection Board's Performance Review Board. DATES: November 5, 2013...

On-Board, Real-Time Preprocessing System for Optical Remote-Sensing Imagery.

Science.gov (United States)

Qi, Baogui; Shi, Hao; Zhuang, Yin; Chen, He; Chen, Liang

2018-04-25

With the development of remote-sensing technology, optical remote-sensing imagery processing has played an important role in many application fields, such as geological exploration and natural disaster prevention. However, relative radiation correction and geometric correction are key steps in preprocessing because raw image data without preprocessing will cause poor performance during application. Traditionally, remote-sensing data are downlinked to the ground station, preprocessed, and distributed to users. This process generates long delays, which is a major bottleneck in real-time applications for remote-sensing data. Therefore, on-board, real-time image preprocessing is greatly desired. In this paper, a real-time processing architecture for on-board imagery preprocessing is proposed. First, a hierarchical optimization and mapping method is proposed to realize the preprocessing algorithm in a hardware structure, which can effectively reduce the computation burden of on-board processing. Second, a co-processing system using a field-programmable gate array (FPGA) and a digital signal processor (DSP; altogether, FPGA-DSP) based on optimization is designed to realize real-time preprocessing. The experimental results demonstrate the potential application of our system to an on-board processor, for which resources and power consumption are limited.

On-Board, Real-Time Preprocessing System for Optical Remote-Sensing Imagery

Science.gov (United States)

Qi, Baogui; Zhuang, Yin; Chen, He; Chen, Liang

2018-01-01

With the development of remote-sensing technology, optical remote-sensing imagery processing has played an important role in many application fields, such as geological exploration and natural disaster prevention. However, relative radiation correction and geometric correction are key steps in preprocessing because raw image data without preprocessing will cause poor performance during application. Traditionally, remote-sensing data are downlinked to the ground station, preprocessed, and distributed to users. This process generates long delays, which is a major bottleneck in real-time applications for remote-sensing data. Therefore, on-board, real-time image preprocessing is greatly desired. In this paper, a real-time processing architecture for on-board imagery preprocessing is proposed. First, a hierarchical optimization and mapping method is proposed to realize the preprocessing algorithm in a hardware structure, which can effectively reduce the computation burden of on-board processing. Second, a co-processing system using a field-programmable gate array (FPGA) and a digital signal processor (DSP; altogether, FPGA-DSP) based on optimization is designed to realize real-time preprocessing. The experimental results demonstrate the potential application of our system to an on-board processor, for which resources and power consumption are limited. PMID:29693585

STS-118 Astronaut Tracy Caldwell During Training

Science.gov (United States)

2006-01-01

Tracy E. Caldwell, STS-118 astronaut and mission specialist, participates in a training session on the usage of a special device, used to lower oneself from a troubled shuttle, in the Space Vehicle Mockup Facility at the Johnson Space Center. Caldwell is wearing a training version of her shuttle launch and entry suit.

Achievement report for fiscal 2000 on development of technology to recycle disintegrated waste gypsum boards; 1999 nendo kaitai haisekko board no saishigenka gijutsu kaihatsu seika hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-03-01

Investigations and researches have been made on disintegrated waste gypsum boards generated in building demolishing sites, with a target of recycling them as a raw material for boards. In the investigations, the actual status of discarding the disintegrated gypsum boards was identified, whereas the harmful substance contents such as of heavy metals were verified to be below the environmental criteria. As a method to remove impurities and foreign materials from the disintegrated waste gypsum boards, the hydration crushing method was established, in which volumetric change when hemihydrate gypsum returns to gypsum dehydrate is utilized, and bond of gypsum particles with each other and with impurities is destructed to separate them into simple substances. Furthermore, discussions were given on the reforming conditions to reform in an energy saving manner the disintegrated waste gypsum boards into high-quality large-size hemihydrate gypsum by using the wet-type process that utilizes the reversible reaction between hemihydrate gypsum and gypsum dehydrate in the disintegrated waste gypsum boards. A manufacturing process to put the recycled gypsum into practical use was also discussed. Prototype board fabrication and tests were performed by using the reformed gypsum board materials, wherein good results were obtained from all of the practical, chemical, and physical tests. (NEDO)

[National Academies' Board on Mathematical Sciences and their Application] Final technical report

Energy Technology Data Exchange (ETDEWEB)

Scott T. Weidman

2005-01-11

The National Academies' Board on Mathematical Sciences and their Applications (BMSA) is a primary interface between the research enterprise and federal agencies that rely on the mathematical sciences. The Board provides objective and authoritative advice on how best to apply the tools of mathematics, statistics, operations research, financial engineering, computational modeling, computational science, information analysis, and decision analysis to practical problems of national importance. In so doing, the Board strengthens the policy-making process and increases the visibility of, and appreciation for, the mathematical sciences while also identifying growth areas for the discipline. The Board consists of 18 pro bono experts from a broad range of quantitative fields, with experience in academia, industry, and national laboratories.

45 CFR 2544.115 - Who may offer a donation?

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false Who may offer a donation? 2544.115 Section 2544... COMMUNITY SERVICE SOLICITATION AND ACCEPTANCE OF DONATIONS § 2544.115 Who may offer a donation? Anyone... donation to the Corporation. ...

Internet message boards for pregnancy loss: who's on-line and why?

Science.gov (United States)

Gold, Katherine J; Boggs, Martha E; Mugisha, Emeline; Palladino, Christie Lancaster

2012-01-01

Pregnancy loss is common, but its significance is often minimized by family, friends, and the community, leaving bereaved parents with unmet need for support. This study sought to describe demographics, usage patterns, and perceived benefits for women participating in Internet pregnancy loss support groups. We requested permission to post an anonymous Internet survey on large and active United States Internet message boards for women with miscarriages and stillbirths. The study purposefully oversampled stillbirth sites and included both closed- and open-ended questions. The University of Michigan Institutional Review Board approved the study. Closed-ended questions were summarized and evaluated with bivariate analysis. We performed a qualitative analysis of open-ended data using an iterative coding process to identify key themes. Of 62 sites queried, 15 granted permission to post the survey on 18 different message boards. We collected 1,039 surveys, of which 1,006 were complete and eligible for analysis. Women were typically white, well educated, and frequent users. They noted message boards helped them to feel less isolated in their loss and grief and they appreciated unique aspects of Internet communication such as convenience, access, anonymity, and privacy. Pregnancy loss message boards are an important aspect of support for many bereaved mothers. African-American women seem to be substantially underrepresented on-line despite being at higher risk for stillbirth. Internet message boards serve a unique function in providing support for women with miscarriage and stillbirth. The benefits are often significantly different from those encountered in traditional face-to-face bereavement support. Copyright © 2012 Jacobs Institute of Women's Health. Published by Elsevier Inc. All rights reserved.

Internationalilzation of the Firm and its Board

DEFF Research Database (Denmark)

Oxelheim, Lars; Gregoric, Aleksandra; Randøy, Trond

competencies required by firm internationalization positively affect board internationalization, whereas the impact of the internationalization of a firm’s commercial operations is positive but not significant across all model specifications. We find that the higher the number of national board members......, the amount of foreigners on the nomination committee also positively relates to the number of foreigners on the board. Rather than age, the median board tenure negatively impacts the prevalence of foreigners on the supervisory board. This barrier to board internationalization may reflect conservatism, fear...

Science-Technology-Society (STS): A New Paradigm in Science Education

Science.gov (United States)

Mansour, Nasser

2009-01-01

Changes in the past two decades of goals for science education in schools have induced new orientations in science education worldwide. One of the emerging complementary approaches was the science-technology-society (STS) movement. STS has been called the current megatrend in science education. Others have called it a paradigm shift for the field…

On the Internationalization of Corporate Boards

DEFF Research Database (Denmark)

Oxelheim, Lars; Gregoric, Aleksandra; Randøy, Trond

2013-01-01

This study investigates the internationalization of corporate boards, using a sample of 346 non-financial listed Nordic firms during 2001-2008. Given a high level of international activity, these firms have surprisingly few foreign directors. The picture of international expertise changes...... considerably, however, if we also count the international experience of national directors. The percentage of foreign directors is related primarily to financial internationalization rather than foreign sales, and thus presumably to the monitoring rather than advisory functions. The international experience...... of the nationals covaries with foreign sales, and increases with the share of foreign directors. Thus both sources of international expertise should be considered when analyzing board internationalization....

Cross-Contamination and Biofilm Formation by Salmonella enterica Serovar Enteritidis on Various Cutting Boards.

Science.gov (United States)

Dantas, Stéfani T A; Rossi, Bruna F; Bonsaglia, Erika C R; Castilho, Ivana G; Hernandes, Rodrigo T; Fernandes, Ary; Rall, Vera L M

2018-02-01

Cross-contamination is one of the main factors related to foodborne outbreaks. This study aimed to analyze the cross-contamination process of Salmonella enterica serovar Enteritidis from poultry to cucumbers, on various cutting board surfaces (plastic, wood, and glass) before and after washing and in the presence and absence of biofilm. Thus, 10 strains of Salmonella Enteritidis were used to test cross-contamination from poultry to the cutting boards and from thereon to cucumbers. Moreover, these strains were evaluated as to their capacity to form biofilm on hydrophobic (wood and plastic) and hydrophilic materials (glass). We recovered the 10 isolates from all unwashed boards and from all cucumbers that had contacted them. After washing, the recovery ranged from 10% to 100%, depending on the board material. In the presence of biofilm, the recovery of salmonellae was 100%, even after washing. Biofilm formation occurred more on wood (60%) and plastic (40%) than glass (10%) boards, demonstrating that bacteria adhered more to a hydrophobic material. It was concluded that the cutting boards represent a critical point in cross-contamination, particularly in the presence of biofilm. Salmonella Enteritidis was able to form a biofilm on these three types of cutting boards but glass showed the least formation.

STS-90 Pilot Scott Altman is suited up for launch

Science.gov (United States)

1998-01-01

STS-90 Pilot Scott Altman is assisted during suit-up activities by Lockheed Suit Technician Valerie McNeil from Johnson Space Center in KSC's Operations and Checkout Building. Altman and the rest of the STS-90 crew will shortly depart for Launch Pad 39B, where the Space Shuttle Columbia awaits a second liftoff attempt at 2:19 p.m. EDT. His first trip into space, Altman is participating in a life sciences research flight that will focus on the most complex and least understood part of the human body - - the nervous system. Neurolab will examine the effects of spaceflight on the brain, spinal cord, peripheral nerves and sensory organs in the human body.

DOE's Environmental Management Site-Specific Advisory Board: The Roles, Work, and Assessment of the Constituent Local Boards - 13587

International Nuclear Information System (INIS)

Alexander, Catherine; Freeman, Jenny; Cantrell, Yvette

2013-01-01

The charter for the Department of Energy's Environmental Management (EM) Site-Specific Advisory Board (SSAB) was approved under the Federal Advisory Committee Act (FACA) in 1994. With a unique mandate to provide public input on issues associated with the cleanup of nuclear legacy sites in the U.S., the EM SSAB comprises eight local boards, which are based at major EM sites. While each board is unique to the community in which it is located and reflects the diversity of the local population, the boards are governed by FACA, related regulations, and DOE policies that are intended to standardize agency advisory board operations. The EM SSAB local boards are made up of a diverse group of citizens who want to understand the mission and goals of the EM program and to help EM achieve those goals for the benefit of their communities. Some are quite passionate about their mission; others need to be coaxed into active participation. Maintaining productive relationships and a supportive environment for effective board operations is the challenge of board management for DOE EM and the board members themselves. DOE draws on research findings and best practices literature from academics and practitioners in the field of public involvement in its board management practices. The EM SSAB is also evaluated annually under the law to ensure that the investment of taxpayer dollars in the board is warranted in light of the contributions of the board. Further evaluation takes place at the agency and site levels in order to identify what aspects of board functioning the agency and board members find important to its success and to address areas where improvement is needed. Board contributions, compliance factors, and measurable outcomes related to board products and process areas are key to agency commitment to ongoing support of the boards and to participant satisfaction and thus continued member involvement. In addition to evaluation of these factors in improving board effectiveness

Evaluation of the 115In(n,n)/sup 115m/In reaction for the ENDF/B-V dosimetry file

International Nuclear Information System (INIS)

Smith, D.L.

1976-12-01

An evaluation of the 115 In(n,n')/sup 115m/In reaction for the ENDF/B-V Dosimetry File is presented. This evaluation is based entirely on reported experimental differential data. Several data sets were renormalized prior to the evaluation in order to take into account recent adjustments in corresponding standard cross sections and in other nuclear parameters used for derivation of cross sections. The present evaluation is compared with the corresponding ENDF/B-IV evaluation. The value of the spectrum-average cross section for the standard neutron field resulting from thermal-neutron fission of 235 U has been computed for this reaction using cross section values from the present evaluation. This computed cross section compares favorably with the result of a recent evaluation of integral data

Hospital board effectiveness: relationships between board training and hospital financial viability.

Science.gov (United States)

Molinari, C; Morlock, L; Alexander, J; Lyles, C A

1992-01-01

This study examined whether hospital governing boards that invest in board education and training are more informed and effective decision-making bodies. Measures of hospital financial viability (i.e., selected financial ratios and outcomes) are used as indicators of hospital board effectiveness. Board participation in educational programs was significantly associated with improved profitability, liquidity, and occupancy levels, suggesting that investment in the education of directors is likely to enhance hospital viability and thus increase board effectiveness.

The faulty Master Events Controller is carried away from STS-99 Endeavour

Science.gov (United States)

2000-01-01

Workers carry away the faulty Enhanced Main Events Controller (E- MEC) from Shuttle Endeavour at Launch Pad 39A. The E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.

AVGS, AR and D for Satellites, ISS, the Moon, Mars and Beyond

Science.gov (United States)

Hintze, Geoffrey C.; Cornett, Keith G.; Rahmatipour, Michael H.; Heaton, Andrew F.; Newman, Larry E.; Fleischmann, Kevin D.; Hamby, Byron J.

2007-01-01

With the continuous need to rotate crew and re-supply the International Space Station (ISS) and the desire to return humans to the Moon and for the first time, place humans on Mars, NASA must develop a more robust and highly reliable capability to perform Autonomous Rendezvous and Capture (AR&C) because, unlike the Apollo missions, NASA plans to send the entire crew to the Lunar or Martian surface and must be able to dock with the Orion spacecraft upon return. In 1997, NASA developed the Video Guidance Sensor (VGS) which was flown and tested on STS-87 and STS-95. In 2001, NASA designed and built a more enhanced version of the VGS, called the Advanced Video Guidance Sensor (AVGS). The AVGS offered significant technology improvements to the precursor VGS design. This paper will describe the AVGS as it was in the DART mission of 2005 and the Orbital Express mission of 2007. The paper will describe the capabilities and design concepts of the AVGS as it was flown on the DART 2005 Mission and the DARPA Orbital Express Mission slated to fly in 2007. The paper will cover the Flight Software, problems encountered, testing for Orbital Express and where NASA is going in the future.

[Is there a physician on board?].

Science.gov (United States)

Andersen, H T

1998-11-01

Physicians responding to emergency calls on board airliners in intercontinental traffic may not be aware of certain legal complications which may arise. For instance, the medical practitioner may hold a license valid in one country, the air carrier may be registered in another, and the patient may be a third state national. Legislation varies between nations, as do court decisions. Physicians may be aware neither of the laws and regulations which apply nor the subtle differences between terms and interpretations used in formal language. This article contains a scenario description from a commercial air liner in intercontinental transit carrying a patient unknown to the physician who responds to a call for medical assistance. The main considerations to be made, the more likely diagnoses and various strategies for immediate interventions are reviewed. Likewise, appraisal and use of medical equipment on board are discussed, as are issues concerning responsibility and liability when equipment is used in supposedly "trained hands". Main themes in the current international medico-legal debate are considered with emphasis on the "Good Samaritan Principle", the responsibility of commercial air carriers, and telemedicine with insurance against law suits. The article concludes with some practical advice to the travelling medical community.

GOVERNING BOARD OF THE PENSION FUND

CERN Multimedia

2004-01-01

The Governing Board held its 120th and 121st meetings on 4 November and 2 December 2003 respectively. At the first of these two meetings, the Board first continued its examination of ESO's requests. In connection to this, the Board heard a presentation of the requests by M. Bloch, ESO's Head of Personnel, including a proposal that ESO's contributions and benefits to its beneficiaries be paid in euros. This option had previously been examined by the Working Group on ESO's Requests which had submitted a negative opinion to the Governing Board. Mr Bloch informed the Board that ESO was suspending that request and therefore invited the Governing Board to concentrate on the other options. After some discussion, the Governing Board decided that the euro-based request should be deemed withdrawn and that the Working Group would resume its examination of the other options put forward by ESO at the beginning of the year. At the same meeting, J.-P. Matheys reported on the recent meeting of the Working Group on Actuarial...

STS-48 MS Buchli and MS Gemar on MB SMS middeck during JSC training session

Science.gov (United States)

1991-01-01

STS-48 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) James F. Buchli (left) and MS Charles D. Gemar listen to instructions while on the middeck of JSC's Motion Based (MB) Shuttle Mission Simulator (SMS). Buchli and Gemar are reviewing inflight procedures during this preflight familiarization session held in the Mission Simulation and Training Facility Bldg 5.

Effect of Board Management and Governmental Model on Zakat Payers’ Trust on Zakat Institutions

OpenAIRE

Erlane K Ghani; Asmah Abdul Aziz; Sakinah Mohamed Tajularifin; Nahla Samargandi

2018-01-01

Trust among zakat payers is important as it contributes to the success of zakat institutions. Zakat payers, are reluctant to pay zakat through zakat institutions due to lack of trust. This study examines whether perceived board management and governmental model may influence zakat payers’ trust on zakat institutions. Using questionnaire survey on 184 zakat payers, this study shows that perceived board management influences zakat payers’ trust on zakat institution...

The Kostyuk report: Corporate board practices in Ukraine

Directory of Open Access Journals (Sweden)

Alexander N. Kostyuk

2005-01-01

Full Text Available The author reports on the corporate board practices in Ukraine. The roles of board of directors are mainly about control. The strategic and advisory roles are not developed. The mode of strategic involvement of the members of supervisory boards in Ukraine is mainly about reviewing and approving. Thus, the board of directors in Ukraine is "a rubber stamp". The degree of independence of directors is very low. Major board practices in Ukraine are: small number of independent directors on the board; low frequency of meeting of the board; small number of committees on the board; the management board influences the supervisory board. Board practices in Ukraine need a sort of recommendations, similar to those, made in UK at the end of 1990s, and at the start of the third millennium.

STS-84 oxygen generator for Mir installation

Science.gov (United States)

1997-01-01

In the SPACEHAB Payload Processing Facility, McDonnell Douglas- SPACEHAB technicians prepare a Russian-made oxygen generator for flight in a SPACEHAB Double Module. The oxygen generator, manufactured in Russia by RSC Energia, will be carried aboard the Space Shuttle Atlantis on Mission STS-84 for the Shuttles scheduled docking with the Russian Space Station Mir next month. The nearly 300-pound generator will replace one of two Mir units that have been malfunctioning recently. The generator functions by electrolysis, which separates water into its oxygen and hydrogen components. The hydrogen is vented and the oxygen is used for breathing by the Mir crew. The generator is 4.2 feet in length and 1.4 feet in diameter. STS-84, which is planned to include a Mir crew exchange of astronaut C. Michael Foale for Jerry M. Linenger, is targeted for a May 15 liftoff. It will be the sixth Shuttle-Mir docking.

STS-40 Mission Insignia

Science.gov (United States)

1990-01-01

The STS-40 patch makes a contemporary statement focusing on human beings living and working in space. Against a background of the universe, seven silver stars, interspersed about the orbital path of Columbia, represent the seven crew members. The orbiter's flight path forms a double-helix, designed to represent the DNA molecule common to all living creatures. In the words of a crew spokesman, ...(the helix) affirms the ceaseless expansion of human life and American involvement in space while simultaneously emphasizing the medical and biological studies to which this flight is dedicated. Above Columbia, the phrase Spacelab Life Sciences 1 defines both the Shuttle mission and its payload. Leonardo Da Vinci's Vitruvian man, silhouetted against the blue darkness of the heavens, is in the upper center portion of the patch. With one foot on Earth and arms extended to touch Shuttle's orbit, the crew feels, he serves as a powerful embodiment of the extension of human inquiry from the boundaries of Earth to the limitless laboratory of space. Sturdily poised amid the stars, he serves to link scentists on Earth to the scientists in space asserting the harmony of efforts which produce meaningful scientific spaceflight missions. A brilliant red and yellow Earth limb (center) links Earth to space as it radiates from a native American symbol for the sun. At the frontier of space, the traditional symbol for the sun vividly links America's past to America's future, the crew states. Beneath the orbiting Shuttle, darkness of night rests peacefully over the United States. Drawn by artist Sean Collins, the STS 40 Space Shuttle patch was designed by the crewmembers for the flight.

46 CFR 115.645 - Alternative Hull Examination (AHE) Procedure.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Alternative Hull Examination (AHE) Procedure. 115.645... AND CERTIFICATION Hull and Tailshaft Examinations § 115.645 Alternative Hull Examination (AHE... underwater hull plating and a detailed examination of all hull welds, propellers, tailshafts, rudders, and...

Study on the Treatment of Wastewater Generated at KSC (Kennedy Space Center) STS (Space Transport System) Operations and Projected Effects on the Design of the STS Hazardous Waste Management Facility at Vandenberg AFB, California.

Science.gov (United States)

1983-10-01

launch which gradually falls back to earth. This dust could be a combination of residual sandblasting sand on the launch support facilities, soil from...considerations, which were identified as follows on items from the STS-6 jar test evaluations: o The Effect of Temperature on Silica Precipitation...concrete and the geometry of the flame ducts at Vandenberg compared to KSC. The other 20% of the sludge results from additives ( diatomite and polymer) to

Clustering of cancer among families of cases with Hodgkin Lymphoma (HL, Multiple Myeloma (MM, Non-Hodgkin's Lymphoma (NHL, Soft Tissue Sarcoma (STS and control subjects

Directory of Open Access Journals (Sweden)

Karunanayake Chandima P

2009-02-01

Full Text Available Abstract Background A positive family history of chronic diseases including cancer can be used as an index of genetic and shared environmental influences. The tumours studied have several putative risk factors in common including occupational exposure to certain pesticides and a positive family history of cancer. Methods We conducted population-based studies of Hodgkin lymphoma (HL, Multiple Myeloma (MM, non-Hodgkin's Lymphoma (NHL, and Soft Tissue Sarcoma (STS among male incident case and control subjects in six Canadian provinces. The postal questionnaire was used to collect personal demographic data, a medical history, a lifetime occupational history, smoking pattern, and the information on family history of cancer. The family history of cancer was restricted to first degree relatives and included relationship to the index subjects and the types of tumours diagnosed among relatives. The information was collected on 1528 cases (HL (n = 316, MM (n = 342, NHL (n = 513, STS (n = 357 and 1506 age ± 2 years and province of residence matched control subjects. Conditional logistic regression analyses adjusted for the matching variables were conducted. Results We found that most families were cancer free, and a minority included two or more affected relatives. HL [(ORadj (95% CI 1.79 (1.33, 2.42], MM (1.38(1.07, 1.78, NHL (1.43 (1.15, 1.77, and STS cases (1.30(1.00, 1.68 had higher incidence of cancer if any first degree relative was affected with cancer compared to control families. Constructing mutually exclusive categories combining "family history of cancer" (yes, no and "pesticide exposure ≥10 hours per year" (yes, no indicated that a positive family history was important for HL (2.25(1.61, 3.15, and for the combination of the two exposures increased risk for MM (1.69(1.14,2.51. Also, a positive family history of cancer both with (1.72 (1.21, 2.45 and without pesticide exposure (1.43(1.12, 1.83 increased risk of NHL. Conclusion HL, MM, NHL

Interfacial scanning tunneling spectroscopy (STS) of chalcogenide/metal hybrid nanostructure

Energy Technology Data Exchange (ETDEWEB)

Saad, Mahmoud M.; Abdallah, Tamer [Physics Department, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt); Easawi, Khalid; Negm, Sohair [Department of Physics and Mathematics, Faculty of Engineering (Shoubra), Benha University (Egypt); Talaat, Hassan, E-mail: hassantalaat@hotmail.com [Physics Department, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt)

2015-05-15

Graphical abstract: - Highlights: • Comparing band gaps values obtained optically with STS. • Comparing direct imaging with calculated dimensions. • STS determination of the interfacial band bending of metal/chalcogenide. - Abstract: The electronic structure at the interface of chalcogenide/metal hybrid nanostructure (CdSe–Au tipped) had been studied by UHV scanning tunneling spectroscopy (STS) technique at room temperature. This nanostructure was synthesized by a phase transfer chemical method. The optical absorption of this hybrid nanostructure was recorded, and the application of the effective mass approximation (EMA) model gave dimensions that were confirmed by the direct measurements using the scanning tunneling microscopy (STM) as well as the high-resolution transmission electron microscope (HRTEM). The energy band gap obtained by STS agrees with the values obtained from the optical absorption. Moreover, the STS at the interface of CdSe–Au tipped hybrid nanostructure between CdSe of size about 4.1 ± 0.19 nm and Au tip of size about 3.5 ± 0.29 nm shows a band bending about 0.18 ± 0.03 eV in CdSe down in the direction of the interface. Such a result gives a direct observation of the electron accumulation at the interface of CdSe–Au tipped hybrid nanostructure, consistent with its energy band diagram. The presence of the electron accumulation at the interface of chalcogenides with metals has an important implication for hybrid nanoelectronic devices and the newly developed plasmon/chalcogenide photovoltaic solar energy conversion.

Development of an ATCA IPMI Controller Mezzanine Board and its usage on an ATCA ROD Evaluator board for the ATLAS LAr upgrade

CERN Document Server

"DUMONT DAYOT, N; The ATLAS collaboration; "CAP, S; "DUMONT DAYOT, N; "FOURNIER, L; "LETENDRE, N; "PERROT, G; "Wingerter, I

2011-01-01

In the context of the LHC upgrades, a new Read-Out Driver (ROD) board for the ATLAS LAr calorimeter is being developed. xTCA (Advanced/Micro Telecom Computing Architecture) is becoming a standard in high energy physics and is a serious candidate for future readout systems. We will present our current developments to master ATCA and to integrate a large number of very high speed links (96 links/8.5 Gbps) on a ROD Evaluator ATCA board. To manage our ROD Evaluator, we have developed a versatile ATCA IPMI controller for ATCA boards which is FPGA Mezzanine Card (FMC) compliant.

STS-61 Space Shuttle mission report

Science.gov (United States)

Fricke, Robert W., Jr.

1994-02-01

The STS-61 Space Shuttle Program Mission Report summarizes the Hubble Space Telescope (HST) servicing mission as well as the Orbiter, External Tank (ET), Solid Rocket Booster (SRB), Redesigned Solid Rocket Motor (RSRM), and the Space Shuttle main engine (SSME) systems performance during the fifty-ninth flight of the Space Shuttle Program and fifth flight of the Orbiter vehicle Endeavour (OV-105). In addition to the Orbiter, the flight vehicle consisted of an ET designated as ET-60; three SSME's which were designated as serial numbers 2019, 2033, and 2017 in positions 1, 2, and 3, respectively; and two SRB's which were designated BI-063. The RSRM's that were installed in each SRB were designated as 360L023A (lightweight) for the left SRB, and 360L023B (lightweight) for the right SRB. This STS-61 Space Shuttle Program Mission Report fulfills the Space Shuttle Program requirement as documented in NSTS 07700, Volume 8, Appendix E. That document requires that each major organizational element supporting the Program report the results of its hardware evaluation and mission performance plus identify all related in-flight anomalies. The primary objective of the STS-61 mission was to perform the first on-orbit servicing of the Hubble Space Telescope. The servicing tasks included the installation of new solar arrays, replacement of the Wide Field/Planetary Camera I (WF/PC I) with WF/PC II, replacement of the High Speed Photometer (HSP) with the Corrective Optics Space Telescope Axial Replacement (COSTAR), replacement of rate sensing units (RSU's) and electronic control units (ECU's), installation of new magnetic sensing systems and fuse plugs, and the repair of the Goddard High Resolution Spectrometer (GHRS). Secondary objectives were to perform the requirements of the IMAX Cargo Bay Camera (ICBC), the IMAX Camera, and the Air Force Maui Optical Site (AMOS) Calibration Test.

24 CFR 968.115 - Modernization and energy conservation standards.

Science.gov (United States)

2010-04-01

... changing or installing a new utility system, conduct a life-cycle cost analysis, reflecting installation... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Modernization and energy conservation standards. 968.115 Section 968.115 Housing and Urban Development Regulations Relating to Housing...

19 CFR 115.13 - Records to be furnished Customs.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Records to be furnished Customs. 115.13 Section 115.13 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS...

19 CFR 115.17 - Appeal to Commissioner of Customs.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Appeal to Commissioner of Customs. 115.17 Section 115.17 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS...

19 CFR 115.7 - Designation of additional Certifying Authorities.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Designation of additional Certifying Authorities. 115.7 Section 115.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS...

19 CFR 115.12 - Records maintained by Certifying Authority.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Records maintained by Certifying Authority. 115.12 Section 115.12 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS...

STS-95 Day 06 Highlights

Science.gov (United States)

1998-01-01

On this sixth day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, test a device called the Video Guidance Sensor, a component of an automated docking system being prepared for use on the International Space Station. As Discovery closes in on Spartan, the astronauts will use a laser system that provides precise measurements of how far away the shuttle is from a target and how fast it is moving toward or away from the target.

Impact of sequential disorder on the scaling behavior of airplane boarding time

Science.gov (United States)

Baek, Yongjoo; Ha, Meesoon; Jeong, Hawoong

2013-05-01

Airplane boarding process is an example where disorder properties of the system are relevant to the emergence of universality classes. Based on a simple model, we present a systematic analysis of finite-size effects in boarding time, and propose a comprehensive view of the role of sequential disorder in the scaling behavior of boarding time against the plane size. Using numerical simulations and mathematical arguments, we find how the scaling behavior depends on the number of seat columns and the range of sequential disorder. Our results show that new scaling exponents can arise as disorder is localized to varying extents.

STS-121: Discovery L-2 Countdown Status Briefing

Science.gov (United States)

2006-01-01

Bruce Buckingham from NASA Public Affairs introduces Pete Nicolenko, NASA Test Director, and Kathy Winters, Shuttle Weather Officer. During this STS-121 two days before launch countdown briefing, Pete Nicolenko says that there are no issues of concern and that they are on schedule for launch. He then presents and discusses an Orbiter Processing Facility (OPF) video. The OPF topics of discussion include: 1) Wheel and tire installation; 2) Gap filler installation; 3) Booster build-up; 4) Transport of External Tank (ET) 119; 5) ET to Shuttle Rocket Booster (SRB) Mate operation; 6) Roll-over of Discovery out of OPF to the Vehicle Assembly Building (VAB); and 7) Roll-out to the pad. Kathy Winters gives her weather forecast for the STS-121 launch. The video ends with a question and answer period from the media.

Study of radial segregation during solidification-technical performance and preliminary results from a GAS payload on STS108

Science.gov (United States)

Holm, P.; Loth, K.; Larsson, B.; Carlberg, T.

The WIS (Weak convection Influencing radial Segregation) payload was built under contract from European Space Agency (ESA) and was flown in a Get Away Special payload on Endeavour STS108 in December 2001. The experiment payload is developed and built by Swedish Space Corporation (SSC). The Principal Investigator is Dr T. Carlberg from Mid Sweden University. The intention with the experiment was to investigate the influence of weak convection, caused by surface tension forces, on radial segregation occurring in crystals grown under microgravity conditions. The geometry studied was a Bridgman configuration with a partially coated surface. The presentation will focus on the experimental technique in detail, including experiences and technical results as well as preliminary scientific results obtained during the flight. The core of the experiment equipment are seven ellipsoidal mirror furnaces with a sample processed in each furnace. The heat source was a 340 W halogen lamp with an axial oriented filament, which was positioned in one of the focal points. In the other focal point, the heating power was concentrated directly to the top of the sample rod. The advantage with this type of furnace is that there is no need for a crucible to heat the sample, which provides less mass and a faster thermal reaction. It also gives the advantage to easy achieve and control a directional melting and solidification.. The sample rods were made of Antimony doped with Tin. The rods (32 x Ø7 mm) were covered with quartz glass tubes with openings of different sizes on the envelope surface in order to induce weak convection. For the thermal control a thermocouple was mounted in the solid part of the sample rod. Each sample was contained in a sample holder with a pressure tight ampoule, pressurized with Argon at 1Atm. The sample holder was mounted directly into the bottom of the furnace. A PC/104 computer based electronic system was used for management and control of the experiment. The

Game Design as STS Research

Directory of Open Access Journals (Sweden)

Joseph Dumit

2017-09-01

Full Text Available Game design offers a powerful pedagogical paradigm for engaging students in thinking and researching sociotechnical systems. Using the example of designing a game around fracking, this paper describes how game design grapples with emergent dynamic processes, and how students are drawn into becoming STS researchers.

Investigations of the effects of cosmic rays on Artemia cysts and tobacco seeds: results of Exobloc II experiment, flown aboard Biocosmos 1887

Energy Technology Data Exchange (ETDEWEB)

Gaubin, Y; Pianezzi, B; Gasset, G; Planel, H [Laboratoire de Biologie Medicale, Faculte de Medecine, Toulouse (France); Delpoux, M [Laboratoire de Biogeographie, Faculte des Sciences, Toulouse (France); Heilmann, C [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires

1990-01-01

Artemia (Brine shrimp) cysts and tobacco seeds, dormant biological material devoid of metabolic activity, were flown aboard the Soviet Biocosmos 1887 in order to investigate the effects of cosmic rays. Artemia cysts and tobacco seeds were used in bulk or in monolayers sandwiched with track detectors. Biological and physical units were located outside and inside the spacecraft. Stacks included lead shielding in order to expose the objects to different doses of radiation. Total dosimetry was performed using thermoluminescent detectors. In spite of low levels of doses, the space flight resulted in a decrease in developmental capacity of Artemia cysts, and in a higher mutation rate in tobacco seeds. The more obvious responses occurred, in both cases, in biological objects exposed to the highest doses. These results are compared to those of previous space experiments. (author).

Some investigations and use of LR-115 track detectors for radon measurements

CERN Document Server

Amrani, D

2001-01-01

Closed passive integrating radon dosimeters based on the use of cellulose nitrate (LR-115 type II) have been developed for assessment of long term radon exposure. This paper presents and comments the results of investigations, of registration efficiency, calibration factors, linearity tests and lower limit of detection for LR-115 detectors from different batches.

MICROBIOLOGICAL EFFECTS OF ON-BOARD FISHING VESSEL HANDLING IN MERLUCCIUS MERLUCCIUS

Directory of Open Access Journals (Sweden)

P. Serratore

2011-01-01

Full Text Available The purpose of the present study was to determine the impact of different manipulation techniques applied on board fishing vessel, on the microbiological quality of the flesh of European hake (Merluccius merluccius during storage at +3°C ± 1°C for a time (T of 10 days after landing (T1-T10. Samples of fish were taken from a fishing vessel of the Adriatic Sea and from one of the Tyrrhenian Sea, treated on-board under different icing conditions: 1 a low ice/product weight ratio and 2 an optimal ice/product weight ratio, up to 1:3 (3. Spoilage bacteria as Total Bacterial Count (TBC and specific spoilage bacteria as Sulphide Producing Bacteria (SPB were enumerated in fish flesh as Colony Forming Units (CFU/g on Plate Count Agar and Lyngby Agar at 20°C for 3-5 days. TBC of the Adriatic fishes (gutted on-board resulted 103 UFC/g at T1-T6, and 104-105 at T10, whereas TBC of the Tyrrhenian fishes (not gutted on-board resulted 10-102 UFC/g at T2- T3, 103 at T6, and 104-105 at T10. SPB resulted 10- 102 UFC/g at T1-T6, and 103- 104 at T10, with absolute values higher in the Adriatic fishes, in respect with the Tyrrhenian fishes, and in the low icing conditions in respect with the optimal icing condition. At the experimented condition, the lowering of the microbiological quality of fish flesh during storage, seems to be more dependent on the gutting versus not gutting on-board practice rather than on the low versus optimal icing treatment.

Governing Board of the Pension Fund

CERN Document Server

2004-01-01

The Governing Board of the Pension Fund held its one-hundred-and-twenty-seventh meeting on 4, 5 and 6 October. During the meeting, the Governing Board heard a report by the actuary on the Actuarial Review as at 1 January 2004. The Governing Board then examined the conclusions to be drawn and the action to be taken as a result of the Review. During its first half-day meeting the Board heard a report on the meetings of the CERN Finance Committee and Council on 15 and 16 September. As a result, the Board asked its Chairman to consult the President of the CERN Council in order to find out about the terms of reference and the composition of the working group on pensions set up by the Council. Next the Board examined a request for compensation to the Fund for the reduction in active members between 2001 and 2003. It was the third such request which the Governing Board would be making to the CERN Council following the latter's 1995 decision to reduce staff numbers. The request related to the previous three years (...

78 FR 11865 - President's Board of Advisors on Historically Black Colleges and Universities

Science.gov (United States)

2013-02-20

.... Brown, Jr., White House Initiative on Historically Black Colleges and Universities, U.S. Department of... DEPARTMENT OF EDUCATION President's Board of Advisors on Historically Black Colleges and Universities AGENCY: U.S. Department of Education, President's Board of Advisors on Historically Black Colleges...

46 CFR 115.700 - Permission for repairs and alterations.

Science.gov (United States)

2010-10-01

... replacement in kind, of electrical wiring, fuel lines, tanks, boilers and other pressure vessels, and steering... 46 Shipping 4 2010-10-01 2010-10-01 false Permission for repairs and alterations. 115.700 Section... AND CERTIFICATION Repairs and Alterations § 115.700 Permission for repairs and alterations. (a...

7 CFR 800.115 - Who may request original services.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Who may request original services. 800.115 Section 800... Original Services § 800.115 Who may request original services. (a) General. Any interested person may request original inspection and weighing services. The kinds of inspection and weighing services are...

Cultural differences and board gender diversity

OpenAIRE

Carrasco , Amélia; Francoeur , Claude; Réal , Isabelle; Laffarga , Joaquina; Ruiz-Barbadillo , Emiliano

2012-01-01

International audience; As evidence of the continuing interest raised by "board gender diversity", major studies (Catalyst, 2008; World Economic Forum, 2010; European Board Diversity Analysis, 2010) were recently carried out and have all led to reports confirming the imbalance of women on boards and the need to address this issue. Moreover, our analysis of these reports indicates that the low proportion of women observed on corporate boards varies across countries, which raises the question a...

STS-93 Commander Collins suits up before launch

Science.gov (United States)

1999-01-01

In the Operations and Checkout Building, STS-93 Commander Eileen M. Collins gets help donning her launch and entry suit. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

STS-93 Mission Specialist Hawley suits up for launch

Science.gov (United States)

1999-01-01

For the third time, during final launch preparations in the Operations and Checkout Building, STS-93 Mission Specialist Steven A. Hawley (Ph.D.) waves after donning his launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Hawley, Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

EuroSCORE II and STS as mortality predictors in patients undergoing TAVI

Directory of Open Access Journals (Sweden)

Vitor Emer Egypto Rosa

2016-02-01

Full Text Available SUMMARY Introduction: the EuroSCORE II and STS are the most used scores for surgical risk stratification and indication of transcatheter aortic valve implantation (TAVI. However, its role as a tool for mortality prediction in patients undergoing TAVI is still unclear. Objective: to evaluate the performance of the EuroSCORE II and STS as predictors of in-hospital and 30-day mortality in patients undergoing TAVI. Methods: we included 59 symptomatic patients with severe aortic stenosis that underwent TAVI between 2010 and 2014. The variables were analyzed using Student's t-test and Fisher's exact test and the discriminative power was evaluated using receiver operating characteristic curve (ROC and area under the curve (AUC with a 95% confidence interval. Results: mean age was 81±7.3 years, 42.3% men. The mean EuroSCORE II was 7.6±7.3 % and STS was 20.7±10.3%. Transfemoral procedure was performed in 88.13%, transapical in 3.38% and transaortic in 8.47%. In-hospital mortality was 10.1% and 30-day mortality was 13.5%. Patients who died had EuroSCORE II and STS higher than the survivors (33.7±16.7vs. 18.6±7.3% p=0,0001 for STS and 13.9±16.1 vs. 4.8±3.8% p=0.0007 for EuroSCORE II. The STS showed an AUC of 0.81 and the EuroSCORE II of 0.77 and there were no differences in the discrimination ability using ROC curves (p=0.72. Conclusion: in this cohort, the STS and EuroSCORE II were predictors of in-hospital and 30-days mortality in patients with severe aortic stenosis undergoing TAVI.

STS-95 Mission Specialist Pedro Duque suits up for launch

Science.gov (United States)

1998-01-01

STS-95 Mission Specialist Pedro Duque of Spain, with the European Space Agency, is helped with his flight suit by suit tech Tommy McDonald in the Operations and Checkout Building. The final fitting takes place prior to the crew walkout and transport to Launch Pad 39B. Targeted for launch at 2 p.m. EST on Oct. 29, the mission is expected to last 8 days, 21 hours and 49 minutes, and return to KSC at 11:49 a.m. EST on Nov. 7. The STS-95 mission includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process.

9 CFR 3.115 - Food and drinking water requirements.

Science.gov (United States)

2010-01-01

... would jeopardize the good health and well-being of the animals. (b) Marine mammals being transported in... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Food and drinking water requirements. 3.115 Section 3.115 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE...

19 CFR 115.41 - Certificate of approval for containers approved after manufacture.

Science.gov (United States)

2010-04-01

... after manufacture. 115.41 Section 115.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT... PURSUANT TO INTERNATIONAL CUSTOMS CONVENTIONS Procedures for Approval of Containers After Manufacture § 115.41 Certificate of approval for containers approved after manufacture. The Certifying Authority shall...

QMX3.3 module-based on-board vehicle charger

Energy Technology Data Exchange (ETDEWEB)

Evans, S. [Delta-Q Technologies, Burnaby, BC (Canada)

2010-07-01

Delta-Q is a tier one supplier to industrial electric vehicle manufacturers offering in-house product design and development as well as sales, marketing and customer service. This presentation discussed on-board chargers for use in electric vehicles. Electric vehicle chargers are needed due to their lower cost, lack of time for generational change, and long lifetime and safety requirements. The presentation discussed universal on-board charger requirements as well as final design requirements. Other topics that were addressed included common control; QMX prototypes; steps from prototype to production; and Delta-Q and tier one partnering. It was concluded that there is a complicated array of diverse requirements with multiple stakeholders and standards. figs.

On-board data management study for EOPAP

Science.gov (United States)

Davisson, L. D.

1975-01-01

The requirements, implementation techniques, and mission analysis associated with on-board data management for EOPAP were studied. SEASAT-A was used as a baseline, and the storage requirements, data rates, and information extraction requirements were investigated for each of the following proposed SEASAT sensors: a short pulse 13.9 GHz radar, a long pulse 13.9 GHz radar, a synthetic aperture radar, a multispectral passive microwave radiometer facility, and an infrared/visible very high resolution radiometer (VHRR). Rate distortion theory was applied to determine theoretical minimum data rates and compared with the rates required by practical techniques. It was concluded that practical techniques can be used which approach the theoretically optimum based upon an empirically determined source random process model. The results of the preceding investigations were used to recommend an on-board data management system for (1) data compression through information extraction, optimal noiseless coding, source coding with distortion, data buffering, and data selection under command or as a function of data activity, (2) for command handling, (3) for spacecraft operation and control, and (4) for experiment operation and monitoring.

STS-107 M.S. Laurel Clark during TCDT M113 training activities

Science.gov (United States)

2002-01-01

KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark (in yellow cap) is instructed on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.

STS-98 U.S. Lab Destiny rests in Atlantis' payload bay

Science.gov (United States)

2001-01-01

KENNEDY SPACE CENTER, Fla. -- The U.S. Lab Destiny rests in the payload bay of Space Shuttle Atlantis. A key element in the construction of the International Space Station, Destiny is 28 feet long and weighs 16 tons. This research and command-and-control center is the most sophisticated and versatile space laboratory ever built. It will ultimately house a total of 23 experiment racks for crew support and scientific research. Destiny will fly on STS-98, the seventh construction flight to the ISS. Launch of STS-98 is scheduled for Jan. 19 at 2:11 a.m. EST.

Ergonomics intervention on an alternative design of a spinal board.

Science.gov (United States)

Zadry, Hilma Raimona; Susanti, Lusi; Rahmayanti, Dina

2017-09-01

A spinal board is the evacuation tool of first aid to help the injured spinal cord. The existing spinal board has several weaknesses, both in terms of user comfort and the effectiveness and efficiency of the evacuation process. This study designs an ergonomic spinal board using the quality function deployment approach. A preliminary survey was conducted through direct observation and interviews with volunteers from the Indonesian Red Cross. Data gathered were translated into a questionnaire and answered by 47 participants in West Sumatra. The results indicate that the selection of materials, the application of strap systems as well as the addition of features are very important in designing an ergonomic spinal board. The data were used in designing an ergonomic spinal board. The use of anthropometric data ensures that this product can accommodate safety and comfort when immobilized, as well as the flexibility and speed of the rescue evacuation process.

Flight Hardware Virtualization for On-Board Science Data Processing

Data.gov (United States)

National Aeronautics and Space Administration — Utilize Hardware Virtualization technology to benefit on-board science data processing by investigating new real time embedded Hardware Virtualization solutions and...

41 CFR 115-1.104-50 - Publication of EPPMR.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Publication of EPPMR. 115-1.104-50 Section 115-1.104-50 Public Contracts and Property Management Federal Property Management....104-50 Publication of EPPMR. (a) Material published in the EPPMR will generally not be of interest to...

STS-95 Day 05 Highlights

Science.gov (United States)

1998-01-01

On this fifth day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, check the status of components of the Hubble Space Telescope Orbital Systems Test (HOST) payload, which provides an on-orbit test bed for hardware that will be used during the third Hubble servicing mission. Then Parazynski and Pilot Steve Lindsey set up some of the tools that will be used during the rendezvous and subsequent capture and reberthing of the Spartan satellite.

Are board meetings proactive or reactive to performance?

Directory of Open Access Journals (Sweden)

Yi Wang

2008-11-01

Full Text Available The purpose of this paper is to investigate the relationship between the intensity of board activity, as represented by board meeting frequency, and firm financial performance, using data from the top 500 Australian companies. Firm performance measures include return on assets, return on equity and shareholder return; several control variables are introduced in the analysis. The results indicate that board meeting frequency has a positive impact on subsequent shareholder return. Regarding the explanatory factors for the level of board activity, it is reported that firms with more board committees tend to have relatively more board and committee meetings; firms with larger boards have less board meetings. In addition, lower managerial ownership leads to more committee meetings.

49 CFR 212.115 - Enforcement actions.

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.115 Enforcement... assess and compromise penalties, to issue emergency orders and compliance orders, institute or cause to...

Next Generation Qualification: Kinemetrics STS-5A Seismometer Evaluation

Energy Technology Data Exchange (ETDEWEB)

Merchant, Bion John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Slad, George William [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2017-10-01

Sandia National Laboratories has tested and evaluated two seismometers, the STS-5A, manufactured by Kinemetrics. These seismometers measure three axes of broadband ground velocity using a UVW configuration with feedback control in a mechanically levelled borehole package. The purpose of the seismometer evaluation was to determine a measured sensitivity, response, self-noise, dynamic range, and self-calibration ability. The Kinemetrics STS-5A seismometers are being evaluated for the U.S. Air Force as part of their Next Generation Qualification effort.

An agenda for board research

Directory of Open Access Journals (Sweden)

Sandra Guerra

2008-01-01

Full Text Available Scholarly investigations on the board of directors, although intense from the mid-1990s onward, did not lead to entirely convincing results. This study proposes discussion on building a multidisciplinary and integrated theoretical framework able to capture the complexity and distinctive dimensions of the board as a group decision-making process. This is achieved through an essay developed from analytical and descriptive review of the literature. A synthesis on board research is presented, aiming to understand theoretical models lenses used to study corporate governance issues. The strengths and weaknesses of these models are pointed out, and their influence on board investigation is observed. This essay concludes by proposing a research agenda that considers the addition of psychological and sociological approaches to economic models of the analysis of group decision-making

Board game

International Nuclear Information System (INIS)

Brennan, N.S.

1982-01-01

A board game comprises a board, a number of counters and two dice. The board is marked to provide a central area, representing the nucleus of an atom, and six or more annular rings extending concentrically around the central area, the rings being divided into 2,8,18,32,48 and 72 squares. Each ring represents an electron shell, and some of the squares are numbered, the number representing the atomic number of different elements. (author)

Does firm performance affect board independence?

Directory of Open Access Journals (Sweden)

Yi Wang

2010-07-01

Full Text Available This paper seeks to shed some light on the antecedents of board independence. Specifically, it attempts to test the conceptual frameworks which make different predictions about the effect of firm performance on the level of board independence. The results provide support for the perspective that appointing more independent members to the boards may merely represent firms’ attempts to comply with institutional pressures. It is found that higher blockholder shareholdings lead to lower independence on the board, and audit and remuneration committees. Moreover, larger firms have relatively more independent directors sitting on nomination and remuneration committees.

STS-61B Astronaut Spring During EASE Extravehicular Activity (EVA)

Science.gov (United States)

1985-01-01

The crew assigned to the STS-61B mission included Bryan D. O'Conner, pilot; Brewster H. Shaw, commander; Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Australia); and SATCOM KU-2 (RCA Americom). Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, Virginia, and the Marshall Space Flight Center (MSFC), the EASE and ACCESS were developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). In this STS-61B onboard photo, astronaut Spring was working on the EASE during an Extravehicular Activity (EVA). The primary objective of this experiment was to test the structural assembly concepts for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Human Resources Division

2002-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Luc Vos with regard to advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 14 to 28 June 2002. Human Resources Division Tel. 74128

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Human Resources Division

2001-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Olivier Francis Martin with regard to indefinite contract. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 8 to 25 June 2001.

Joint Advisory Appeals Board

CERN Multimedia

2003-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Aloïs Girardoz with regard to classification and advancement. As the appellant has not objected, the Board's report and the Director-General's decision will be brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 15 to 29 August 2003. Human Resources Division Tel. 74128

STS-74 Mission Specialists McArther and Ross in OPF

Science.gov (United States)

1995-01-01

In Orbiter Processing Facility Bay 2, STS-74 Mission Specialist William 'Bill' McArthur Jr. (left) and Jerry L. Ross are reviewing the configuration of payload elements in the orbiter Atlantis' payload bay. Ross and McArthur are participating in the Crew Equipment Interface Test (CEIT), an opportunity for flight crew members to become familiar with the payload hardware they will be working with on-orbit. Located in Atlantis' payload bay are the Orbiter Docking System and the Docking Module, two pieces of flight hardware that will play a crucial role in the second docking of the Space Shuttle to the Russian Space Station Mir. STS-74 is currently targeted for an early November launch

The Impact of Corporate Board Meetings on Corporate Performance ...

African Journals Online (AJOL)

Our findings suggest a statistically significant and positive association between the frequency of corporate board meetings and corporate performance, implying that SA boards that meet more frequently tend to generate higher financial performance. A further investigation indicates a significant non-monotonic link between ...

STS-71 astronauts before egress training

Science.gov (United States)

1994-01-01

Astronaut Robert L. Gibson (left), STS-71 mission commander, converses with two crew mates prior to emergency egress training in the Systems Integration Facility at JSC. Astronaut Bonnie J. Dunbar and Gregory J. Harbaugh are attired in training versions o

78 FR 14297 - President's Board of Advisors on Historically Black Colleges and Universities

Science.gov (United States)

2013-03-05

... DEPARTMENT OF EDUCATION President's Board of Advisors on Historically Black Colleges and... Board of Advisors on Historically Black Colleges and Universities scheduled for March 6, 2013, and... for a date to be announced in the future. FOR FURTHER INFORMATION CONTACT: John P. Brown, Designated...

Predictive validity of the Suicide Trigger Scale (STS-3 for post-discharge suicide attempt in high-risk psychiatric inpatients.

Directory of Open Access Journals (Sweden)

Zimri S Yaseen

Full Text Available BACKGROUND: The greatly increased risk of suicide after psychiatric hospitalization is a critical problem, yet we are unable to identify individuals who would attempt suicide upon discharge. The Suicide Trigger Scale v.3 (STS-3, was designed to measure the construct of an affective 'suicide trigger state' hypothesized to precede a suicide attempt (SA. This study aims to test the predictive validity of the STS-3 for post-discharge SA on a high-risk psychiatric-inpatient sample. METHODS: The STS-3, and a psychological test battery measuring suicidality, mood, impulsivity, trauma history, and attachment style were administered to 161 adult psychiatric patients hospitalized following suicidal ideation (SI or SA. Receiver Operator Characteristic and logistic regression analyses were used to assess prediction of SA in the 6-month period following discharge from hospitalization. RESULTS: STS-3 scores for the patients who made post-discharge SA followed a bimodal distribution skewed to high and low scores, thus a distance from median transform was applied to the scores. The transformed score was a significant predictor of post-discharge SA (AUC 0.731, and a subset of six STS-3 scale items was identified that produced improved prediction of post-discharge SA (AUC 0.814. Scores on C-SSRS and BSS were not predictive. Patients with ultra-high (90(th percentile STS-3 scores differed significantly from ultra-low (10(th percentile scorers on measures of affective intensity, depression, impulsiveness, abuse history, and attachment security. CONCLUSION: STS-3 transformed scores at admission to the psychiatric hospital predict suicide attempts following discharge among the high-risk group of suicidal inpatients. Patients with high transformed scores appear to comprise two clinically distinct groups; an impulsive, affectively intense, fearfully attached group with high raw STS-3 scores and a low-impulsivity, low affect and low trauma-reporting group with low raw

Statement by the outgoing Chairperson of the Board of Governors regarding the working arrangements of the Board

International Nuclear Information System (INIS)

2009-01-01

At the request of the outgoing Chairperson of the Board of Governors, her statement delivered in the Board of Governors meeting on 22 September 2009, regarding the working arrangements of the Board, is reproduced herewith for information

Bi-phase CO{sub 2} cooling of the CBM STS detector

Energy Technology Data Exchange (ETDEWEB)

Lavrik, Evgeny [Physikalisches Institut der Universitaet Tuebingen (Germany); Collaboration: CBM-Collaboration

2016-07-01

The Compressed Baryonic Matter (CBM) experiment aims to study the properties of nuclear matter at high net-baryon densities. The Silicon Tracking System (STS) is the key detector to reconstruct charged particle tracks created in heavy-ion interactions. The foreseen interaction rate of up to 10 MHz requires radiation hard detectors as well as efficient cooling of the silicon sensors. To avoid thermal runaway the system must be kept at -5 C or below all the time. This is rather challenging because the overall thermal load in the 2 m{sup 3} STS enclosure is up to 40 kW. Because of these requirements liquid CO{sub 2} is used as a cooling agent as it is superior in terms of volumetric heat transfer coefficient compared to other agents. This contribution shows the thermal simulations and measurement results of the STS front-end electronic boxes as well as an overview of 1 kW TRACI-XL cooling plant developed at GSI and its use to perform thermal measurements of a fully heat loaded STS quarter station.

Women on board: female board membership as a form of elite democratization

NARCIS (Netherlands)

Heemskerk, E.M.; Fennema, M.

2014-01-01

Corporate elites have been all-male bastions until the twenty-first century. The recent inclusion of women in the corporate elite needs explanation because it is an abrupt change in recruitment practices. We consider female presence in corporate boards as a sign of the democratization of elite

A management, leadership, and board road map to transforming care for patients.

Science.gov (United States)

Toussaint, John

2013-01-01

Over the last decade I have studied 115 healthcare organizations in II countries, examining them from the boardroom to the patient bedside. In that time, I have observed one critical element missing from just about every facility: a set of standards that could reliably produce zero-defect care for patients. This lack of standards is largely rooted in the Sloan management approach, a top-down management and leadership structure that is void of standardized accountability. This article offers an alternative approach: management by process--an operating system that engages frontline staff in decisions and imposes standards and processes on the act of managing. Organizations that have adopted management by process have seen quality improve and costs decrease because the people closest to the work are expected to identify problems and solve them. Also detailed are the leadership behaviors required for an organization to successfully implement the management-by-process operating system and the board of trustees' role in supporting the transformation.

On-board aircrew dosimetry using a semiconductor spectrometer

CERN Document Server

Spurny, F

2002-01-01

Radiation fields on board aircraft contain particles with energies up to a few hundred MeV. Many instruments have been tested to characterise these fields. This paper presents the results of studies on the use of an Si diode spectrometer to characterise these fields. The spectrometer has been in use since spring 2000 on more than 130 return flights to monitor and characterise the on-board field. During a Czech Airlines flight from Prague to New York it was possible to register the effects of an intense solar flare, (ground level event, GLE 60), which occurred on 15 April 2001. It was found that the number of deposition events registered was increased by about 70% and the dose in Si by a factor of 2.0 when compared with the presence of galactic cosmic rays alone. Directly measured data are interpreted with respect to on-earth reference field calibration (photons, CERN high-energy particles); it was found that this approach leads to encouraging results and should be followed up. (7 refs).

The effect of national cultural differences of board members on integrated reporting

Directory of Open Access Journals (Sweden)

Simona Alfiero

2018-01-01

Full Text Available This research, based on stakeholder theory and the national cultural dimensions, aims to test the influence of foreigners on board and its size on Integrated Reporting (IR practices. The analysis is based on a sample of 1,058 European companies from 18 different countries, who adopted or not the IR for the year 2015, and it relies on a Logit. The dependent variable is a dummy (presenting or not the IR and the independent variables are represented by the board characteristics (foreigners and size. The impact of the critical mass on the presence of foreigners and the cultural dimension on the basis of directors’ nationality was tested relying on the masculinity/femininity dimension of Hofstede. Besides, the directors’ country of origin was considered, namely if they belong to the major European countries presenting a wider IR diffusion. The relationship between foreigners on board and IR is found to be negative. This means that companies with at least one foreigner are less inclined to adopt IR. The results show that the boards with more of three foreign administrators have a major propensity to adopt the IR. The membership of the directors in countries with a feminist culture also has a positive effect.

STS-74 view of ODS from Payload Changout Room

Science.gov (United States)

1995-01-01

Workers at Launch Pad 39A are preparing to close the payload bay doors on the Space Shuttle Atlantis for its upcoming launch on Mission STS-74 and the second docking with the Russian Space Station Mir. Uppermost in the payload bay is the Orbiter Docking System (ODS), which also flew on the first docking flight between the Space Shuttle and MIR. Lowermost is the primary payload of STS-74, the Russian-built Docking Module. During the mission, the Docking Module will first be attached to ODS and then to Mir. It will be left attached to Mir to become a permanent extension that will afford adequate clearance between the orbiter and the station during future dockings. At left in the payload bay, looking like a very long pole, is the Canadian-built Remote Manipulator System arm that will be used by the crew to hoist the Docking Module and attach it to the ODS.

GOVERNING BOARD OF THE PENSION FUND

CERN Multimedia

2002-01-01

The Governing Board held its 108th and 109th meetings on 5 February and 5 March respectively. At the first of these meetings, the Board heard a report by its Chairman, P. Levaux, on the CERN Council Session of December 2001. The Chairman reported that the Board that the 0.8% adjustment of pensions proposed by the Governing Board had been accepted as well as an amendment to the Rules of the Fund reducing the period of service required for entitlement to a deferred retirement pension from 10 to 5 years. The Governing Board also heard a report by the Chairman of the Investment Committee, G. Maurin, on the Committee's two January meetings. At the first of these, the Committee had addressed its structure and operating methods. Various proposals had been put forward aimed at increasing the Committee's efficiency and response time. Specific proposals will be submitted to the Governing Board during the year. In addition, on the basis of two specially commissioned studies, the Committee had examined the issue of curre...

Views of STS-4 crew during a training session in the SMS

Science.gov (United States)

1982-01-01

Views of STS-4 crew during a training session in the Shuttle Mission Simulator (SMS) in bldg 5. Astronauts Thomas K. Mattingly, II. (left) and Henry W. Hartsfield, Jr., commander and pilot respectively for STS-4 get in some training time in the SMS.

Views of STS-5 crew during a training session in the SMS

Science.gov (United States)

1982-01-01

Views of STS-5 crew during a training session in the Shuttle Mission Simulator (SMS). Astronaut Robert F. Overmyer, STS-5 pilot, participates in training session wearing a communications kit assembly (ASSY). He is dressed in regular flight suit and is studying flight documentation.

On-Board Rendezvous Targeting for Orion

Science.gov (United States)

Weeks, Michael W.; DSouza, Christopher N.

2010-01-01

The Orion On-board GNC system is among the most complex ever developed for a space mission. It is designed to operate autonomously (independent of the ground). The rendezvous system in particular was designed to operate on the far side of the moon, and in the case of loss-of-communications with the ground. The vehicle GNC system is designed to retarget the rendezvous maneuvers, given a mission plan. As such, all the maneuvers which will be performed by Orion, have been designed and are being incorporated into the flight code.

Instrumentation and control aging management: A focus on electronic parts and boards

International Nuclear Information System (INIS)

Crocombette, C.; Simon, G.; Favaro, P.; Naser, J.; Guffroy, G.

2002-01-01

Full text: The nuclear power industry is currently facing increasing aging and obsolescence issues with original equipment installed for instrumentation, control, and safety system applications. One area that needs attention is the aging of electronic boards and components used in instrumentation and control (I and C) systems in nuclear power plants (NPPs). In this context, EPRI has launched a project dedicated to NPP electronic component and board aging management. The goals of this project are: 1) to better understand the degradation mechanisms of I and C electronic systems; 2) to develop new methods to monitor prevalent mechanisms and forecast generic aging cases; and 3) to give guidelines for the aging management of I and C electronic systems. The ultimate objectives are: 1) to reduce the likelihood of losing plant availability due to a board or component failure; and 2) to reduce the global cost of maintenance by optimizing preventive maintenance tasks and the schedule for refurbishment or renewal. Degradation mechanisms of electronic boards in NPP - Aging mechanisms of electronic parts depend on technologies, manufacturing quality, and conditions of environment and operation. Aging of electronic parts is well documented in harsh environments (e.g., aerospace, military, or automotive industries data). However, only a small amount of data on electronic part failures in NPPs is available because the conditions are benign and the failure rates are supposed to be low. It is thus difficult to identify what will predominantly cause the aging of electronic systems after 20 or 30 years of operation. Usual causes are temperature, corrosion, temperature cycles, or extrinsic aggressions (Electrical Over Stress (EOS), Electro Static Discharges (ESD)). From field data and bibliographic analyses, we found that electrolytic capacitors, relays, potentiometers, power devices (thyristors, power transistors, etc.), optocouplers, on-board connectors, printed boards, integrated

DOE's Environmental Management Site-Specific Advisory Board: The Roles, Work, and Assessment of the Constituent Local Boards - 13587

Energy Technology Data Exchange (ETDEWEB)

Alexander, Catherine [U.S. Dept. of Energy, Office of Environmental Management, Office of Intergovernmental and Community Activities, 1000 Independence Avenue, S.W.,Washington, D.C. 20585 (United States); Freeman, Jenny [Strata-G, LLC, 2027 Castaic Lane, Knoxville, TN 37932 (United States); Cantrell, Yvette [Restoration Services, Inc., 136 Mitchell Road, Oak Ridge, TN 37830 (United States)

2013-07-01

The charter for the Department of Energy's Environmental Management (EM) Site-Specific Advisory Board (SSAB) was approved under the Federal Advisory Committee Act (FACA) in 1994. With a unique mandate to provide public input on issues associated with the cleanup of nuclear legacy sites in the U.S., the EM SSAB comprises eight local boards, which are based at major EM sites. While each board is unique to the community in which it is located and reflects the diversity of the local population, the boards are governed by FACA, related regulations, and DOE policies that are intended to standardize agency advisory board operations. The EM SSAB local boards are made up of a diverse group of citizens who want to understand the mission and goals of the EM program and to help EM achieve those goals for the benefit of their communities. Some are quite passionate about their mission; others need to be coaxed into active participation. Maintaining productive relationships and a supportive environment for effective board operations is the challenge of board management for DOE EM and the board members themselves. DOE draws on research findings and best practices literature from academics and practitioners in the field of public involvement in its board management practices. The EM SSAB is also evaluated annually under the law to ensure that the investment of taxpayer dollars in the board is warranted in light of the contributions of the board. Further evaluation takes place at the agency and site levels in order to identify what aspects of board functioning the agency and board members find important to its success and to address areas where improvement is needed. Board contributions, compliance factors, and measurable outcomes related to board products and process areas are key to agency commitment to ongoing support of the boards and to participant satisfaction and thus continued member involvement. In addition to evaluation of these factors in improving board

STS-36 Commander Creighton listens to music on OV-104's forward flight deck

Science.gov (United States)

1990-01-01

STS-36 Commander John O. Creighton, smiling and wearing a headset, listens to music as the tape recorder freefloats in front of him. During this lighter moment of the mission, Creighton is positioned at the commanders station on the forward flight deck of Atlantis, Orbiter Vehicle (OV) 104. Forward flight deck windows W1 and W2 appear on his left. Creighton and four other astronauts spent four days, 10 hours and 19 minutes aboard the spacecraft for the Department of Defense (DOD) devoted mission.

Joint Advisory Appeals Board

CERN Multimedia

2003-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Poul Frandsen concerning his assimilation into the new career structure. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 13 to 24 January 2003. Human Resources Division Tel. 74128

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Personnel Division

1999-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Joào Bento with regard to residential category. As the appellant has not objected, the recommendations of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article RÊVIÊ1.20 of the Staff Regulations.The relevant documents will therefore be posted on the notice boards of the Administration Building (N¡ 60) from 29 October to 12 November 1999.Personnel DivisionTel. 74128

Joint Advisory Appeals Board

CERN Multimedia

HR Department

2006-01-01

The Joint Advisory Appeals Board was convened to examine an appeal lodged by a member of the personnel with regard to advancement. The person concerned has requested that the report of the Board and the final decision of the Director-General be brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (No. 60) from 24 March to 10 April 2006. Human Resources Department Tel. 74128

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Human Resources Division

2002-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Jack Blanchard with regard to 'non recognition of specific functions'. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 12th to 26th April 2002. Human Resources Division Tel. 74128

Joint Advisory Appeals Board

CERN Multimedia

2004-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mrs Maria DIMOU with regard to a periodic one-step increase. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 30 April to 14 May 2004. Human Resources Department Tel. 74128

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Human Resources Division

2001-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Joël Lahaye with regard to non-resident allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 18 May to 1st June 2001.

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Human Resources Division

2002-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Bertrand Nicquevert with regard to the non-resident allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 29 November to 13 December 2002. Human Resources Division Tel. 74128

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Human Resources Division

2002-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Antonio Millich with regard to advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 27 September to 11 October 2002. Human Resources Division Tel. 74128

Joint Advisory Appeals Board

CERN Multimedia

Human Resources Department

2005-01-01

The Joint Advisory Appeals Board was convened to examine an appeal lodged by a member of the personnel with regard to a periodic one-step increase. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 1 to 15 April 2005. Human Resources Department Tel. 74128

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Human Resources Division

2002-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Gert Jan Bossen with regard to dependent child allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 1st to 15 March 2002. Human Resources Division Tel. 74128

JOINT ADVISORY APPEALS BOARD

CERN Multimedia

Human Resources Division

2002-01-01

The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Serge Peraire with regard to exceptional advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 17 to 31 May 2002. Human Resources Division Tel. 74128

STS-31 crewmembers during simulation on the flight deck of JSC's FB-SMS

Science.gov (United States)

1988-01-01

On the flight deck of JSC's fixed based (FB) shuttle mission simulator (SMS), Mission Specialist (MS) Steven A. Hawley (left), on aft flight deck, looks over the shoulders of Commander Loren J. Shriver, seated at the commanders station (left) and Pilot Charles F. Bolden, seated at the pilots station and partially blocked by the seat's headrest (right). The three astronauts recently named to the STS-31 mission aboard Discovery, Orbiter Vehicle (OV) 103, go through a procedures checkout in the FB-SMS. The training simulation took place in JSC's Mission Simulation and Training Facility Bldg 5.

STS-100 Crew Interview: Scott Parazynski

Science.gov (United States)

2001-01-01

STS-100 Mission Specialist Scott Parazynski is seen being interviewed. He answers questions about his inspiration to become an astronaut and his career path. He gives details on the mission's goals and significance, the rendezvous and docking of Endeavour with the International Space Station (ISS), the mission's spacewalks, and installation and capabilities of the Space Station robotic arm, UHF antenna, and Rafaello Logistics Module. Parazynski then discusses his views about space exploration as it becomes an international collaboration.

13 CFR 115.36 - Indemnity settlements and reinstatement of Principal.

Science.gov (United States)

2010-01-01

... for SBA's consideration must include current financial information, including financial statements... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Indemnity settlements and reinstatement of Principal. 115.36 Section 115.36 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

25 CFR 115.1000 - Who owns the records associated with this part?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Who owns the records associated with this part? 115.1000 Section 115.1000 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES TRUST FUNDS FOR TRIBES AND INDIVIDUAL INDIANS Records § 115.1000 Who owns the records associated with this...

MANAGEMENT BOARD OF 5/05/08 (MB115)