WorldWideScience

Sample records for flow-sensitive dephasing fsd

  1. Noncontrast MR angiography (MRA) of infragenual arteries using flow-sensitive dephasing (FSD)-prepared steady-state free precession (SSFP) at 3.0 Tesla: Comparison with contrast-enhanced MRA.

    Science.gov (United States)

    Zhang, Nan; Fan, Zhaoyang; Luo, Nan; Bi, Xiaoming; Zhao, Yike; An, Jing; Liu, Jiayi; Chen, Zhong; Fan, Zhanming; Li, Debiao

    2016-02-01

    To evaluate the feasibility and diagnostic performance of flow-sensitive dephasing (FSD)-prepared steady-state free precession (SSFP) MR angiography (MRA) for imaging infragenual arteries at 3.0T, with contrast enhanced MR angiography (CE MRA) as reference. Twenty consecutive patients with suspicion of lower extremity arterial disease undergoing routine CE MRA were recruited. FSD MRA was performed at calf before CE MRA. Image quality and stenosis degree of infragenual arteries from both techniques were independently evaluated and compared. Six patients in this study underwent DSA examination. Three undiagnostic segments were excluded with severe venous contamination in CE MRA. A total of 197 calf arterial segments images were analyzed. No significant difference existed in the relative signal intensity (rSI) of arterial segments between FSD MRA and CE MRA techniques (0.92 ± 0.09 versus 0.93 ± 0.05; P = 0.207). However, the subjective image quality score was slightly higher in FSD MRA (3.66 ± 0.81 versus 3.49 ± 0.87; P = 0.050). With CE MRA images as reference standard, slight overestimation existed in FSD MRA (2.19 ± 1.24 versus 2.09 ± 1.18; P = 0.019), with total agreement of 84.3% on the basis of all arterial segments. The sensitivity, specificity, negative predictive value, and positive predictive value of FSD MRA was 96.4%, 93.0%, 98.5%, and 84.1%. No significant difference in the stenosis degree score was detected between MRA (FSD MRA and CE MRA) and DSA (P > 0.05). FSD MRA performed on at 3.0T without the use of contrast medium provides diagnostic images allowing for arterial stenosis assessment of calf arteries that was highly comparable with CE MRA. Moreover, venous contamination was less problematic with FSD MRA. © 2015 Wiley Periodicals, Inc.

  2. Noncontrast magnetic resonance angiography of the hand: improved arterial conspicuity by multidirectional flow-sensitive dephasing magnetization preparation in 3D balanced steady-state free precession imaging.

    Science.gov (United States)

    Fan, Zhaoyang; Hodnett, Philip A; Davarpanah, Amir H; Scanlon, Timothy G; Sheehan, John J; Varga, John; Carr, James C; Li, Debiao

    2011-08-01

    : To develop a flow-sensitive dephasing (FSD) preparative scheme to facilitate multidirectional flow-signal suppression in 3-dimensional balanced steady-state free precession imaging and to validate the feasibility of the refined sequence for noncontrast magnetic resonance angiography (NC-MRA) of the hand. : A new FSD preparative scheme was developed that combines 2 conventional FSD modules. Studies using a flow phantom (gadolinium-doped water 15 cm/s) and the hands of 11 healthy volunteers (6 males and 5 females) were performed to compare the proposed FSD scheme with its conventional counterpart with respect to the signal suppression of multidirectional flow. In 9 of the 11 healthy subjects and 2 patients with suspected vasculitis and documented Raynaud phenomenon, respectively, 3-dimensional balanced steady-state free precession imaging coupled with the new FSD scheme was compared with spatial-resolution-matched (0.94 × 0.94 × 0.94 mm) contrast-enhanced magnetic resonance angiography (0.15 mmol/kg gadopentetate dimeglumine) in terms of overall image quality, venous contamination, motion degradation, and arterial conspicuity. : The proposed FSD scheme was able to suppress 2-dimensional flow signal in the flow phantom and hands and yielded significantly higher arterial conspicuity scores than the conventional scheme did on NC-MRA at the regions of common digitals and proper digitals. Compared with contrast-enhanced magnetic resonance angiography, the refined NC-MRA technique yielded comparable overall image quality and motion degradation, significantly less venous contamination, and significantly higher arterial conspicuity score at digital arteries. : The FSD-based NC-MRA technique is improved in the depiction of multidirectional flow by applying a 2-module FSD preparation, which enhances its potential to serve as an alternative magnetic resonance angiography technique for the assessment of hand vascular abnormalities.

  3. A study of arteries of foot by flow sensitive dephasing prepared balanced steady-state free precession MR angiography in diabetes

    International Nuclear Information System (INIS)

    Zou Liqiu; Liu Xiaoyi; Liu Xin; Feng Fei; Qi Yulong; Liu Pengcheng

    2011-01-01

    Objective: To investigate balanced steady-state free precession with flow-sensitive dephasing magnetization preparation (FSD-bSSFP) in the assessment of arteries of foot in diabetic patients. Methods: The lower-extremity peripheral arteries of 43 diabetic patients were evaluated by FSD-bSSFP no contrast MRA and contrast-enhanced MRA (CE-MRA) in. Two experienced observers assessed the image quality, degree of venous contaminated and visibility of pedal artery branches by FSD-bSSFP and CE-MRA respectively in consensus. The signal intensity (SI), signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) of the source images of both groups were measured and Wilcoxon and t tests were performed. Results: The image score of FSD-bSSFP group was 2.7±1.1 and CE-MRA was 2.6±0.8, there was no statistical difference (Z= 0.134, P>0.05). The image score of demonstration of the pedal artery branches and degree of venous contamination on FSD-bSSFP were 3.2±0.9 and 1.8±0.4 respectively which were superior to that of CE-MRA (2.5±0.9 and 2.1±0.8 respectively). Significant statistical difference existed between the two groups in demonstration of pedal artery branches (Z=5.246, P 0.05). But CNR of CE-MRA was superior to that of FSD-bSSFP and significant statistical difference existed between these two methods (t=5.113, P<0.01). Conclusion: FSD-bSSFP without contrast could be used in the evaluation of foot arteries in patients of renal dysfunction and diabetes. (authors)

  4. Mitigation of near-band balanced steady-state free precession through-plane flow artifacts using partial dephasing.

    Science.gov (United States)

    Datta, Anjali; Cheng, Joseph Y; Hargreaves, Brian A; Baron, Corey A; Nishimura, Dwight G

    2018-06-01

    To mitigate artifacts from through-plane flow at the locations of steady-state stopbands in balanced steady-state free precession (SSFP) using partial dephasing. A 60° range in the phase accrual during a TR was created over the voxel by slightly unbalancing the slice-select dephaser. The spectral profiles of SSFP with partial dephasing for various constant flow rates and during pulsatile flow were simulated to determine if partial dephasing decreases through-plane flow artifacts originating near SSFP dark bands while maintaining on-resonant signal. Simulations were then validated in a flow phantom. Lastly, phase-cycled SSFP cardiac cine images were acquired with and without partial dephasing in six subjects. Partial dephasing decreased the strength and non-linearity of the dependence of the signal at the stopbands on the through-plane flow rate. It thus mitigated hyper-enhancement from out-of-slice signal contributions and transient-related artifacts caused by variable flow both in the phantom and in vivo. In six volunteers, partial dephasing noticeably decreased artifacts in all of the phase-cycled cardiac cine datasets. Partial dephasing can mitigate the flow artifacts seen at the stopbands in balanced SSFP while maintaining the sequence's desired signal. By mitigating hyper-enhancement and transient-related artifacts originating from the stopbands, partial dephasing facilitates robust multiple-acquisition phase-cycled SSFP in the heart. Magn Reson Med 79:2944-2953, 2018. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

  5. Genomic structure, expression and association study of the porcine FSD2.

    Science.gov (United States)

    Lim, Kyu-Sang; Lee, Kyung-Tai; Lee, Si-Woo; Chai, Han-Ha; Jang, Gulwon; Hong, Ki-Chang; Kim, Tae-Hun

    2016-09-01

    The fibronectin type III and SPRY domain containing 2 (FSD2) on porcine chromosome 7 is considered a candidate gene for pork quality, since its two domains, which were present in fibronectin and ryanodine receptor. The fibronectin type III and SPRY domains were first identified in fibronectin and ryanodine receptor, respectively, which are candidate genes for meat quality. The aim of this study was to elucidate the genomic structure of FSD2 and functions of single nucleotide polymorphisms (SNPs) within FSD2 that are related to meat quality in pigs. Using a bacterial artificial chromosome clone sequence, we revealed that porcine FSD2 consisted of 13 exons encoding 750 amino acids. In addition, FSD2 was expressed in heart, longissimus dorsi muscle, psoas muscle, and tendon among 23 kinds of porcine tissues tested. A total of ten SNPs, including four missense mutations, were identified in the exonic region of FSD2, and two major haplotypes were obtained based on the SNP genotypes of 633 Berkshire pigs. Both haplotypes were associated significantly with intramuscular fat content (IMF, P meat color, affecting yellowness (P = 0.002). These haplotype effects were further supported by the alteration of putative protein structures with amino acid substitutions. Taken together, our results suggest that FSD2 haplotypes are involved in regulating meat quality including IMF, MP, and meat color in pigs, and may be used as meaningful molecular makers to identify pigs with preferable pork quality.

  6. Benford's law and the FSD distribution of economic behavioral micro data

    Science.gov (United States)

    Villas-Boas, Sofia B.; Fu, Qiuzi; Judge, George

    2017-11-01

    In this paper, we focus on the first significant digit (FSD) distribution of European micro income data and use information theoretic-entropy based methods to investigate the degree to which Benford's FSD law is consistent with the nature of these economic behavioral systems. We demonstrate that Benford's law is not an empirical phenomenon that occurs only in important distributions in physical statistics, but that it also arises in self-organizing dynamic economic behavioral systems. The empirical likelihood member of the minimum divergence-entropy family, is used to recover country based income FSD probability density functions and to demonstrate the implications of using a Benford prior reference distribution in economic behavioral system information recovery.

  7. Qubit dephasing due to quasiparticle tunneling

    Energy Technology Data Exchange (ETDEWEB)

    Zanker, Sebastian; Marthaler, Michael; Schoen, Gerd [Institut fuer Theoretische Festkoerperphysik, Karlsruhe Institute of Technology, D-76128 Karlsruhe (Germany)

    2015-07-01

    We study dephasing of a superconducting qubit due to quasiparticle tunneling through a Josephson junction. While qubit decay due to tunneling processes is well understood within a golden rule approximation, pure dephasing due to BCS quasiparticles gives rise to a divergent golden rule rate. We calculate qubit dephasing due to quasiparticle tunneling beyond lowest order approximation in coupling between qubit and quasiparticles. Summing up a certain class of diagrams we show that qubit dephasing due to purely longitudinal coupling to quasiparticles leads to dephasing ∝ exp(-x(t)) where x(t) ∝ t{sup 3/2} for short time scales and x(t) ∝ tlog(t) for long time scales.

  8. Novel diyne-bridged dyes for efficient dye-sensitized solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Jing-Kun, E-mail: fjk@njust.edu.cn [Department of Chemistry, School of Chemical Engineering, Nanjing University of Science and Technology, Xiaolingwei Street No. 200, Nanjing, 210094 (China); Sun, Tengxiao [Department of Chemistry, School of Chemical Engineering, Nanjing University of Science and Technology, Xiaolingwei Street No. 200, Nanjing, 210094 (China); Tian, Yi [Advanced Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, 980-8577 (Japan); Zhang, Yingjun, E-mail: ZhangYingjun@hec.cn [HEC Pharm Group, HEC R& D Center, Dongguan, 523871 (China); Jin, Chuanfei [HEC Pharm Group, HEC R& D Center, Dongguan, 523871 (China); Xu, Zhimin; Fang, Yu; Hu, Xiangyu; Wang, Haobin [Department of Chemistry, School of Chemical Engineering, Nanjing University of Science and Technology, Xiaolingwei Street No. 200, Nanjing, 210094 (China)

    2017-07-01

    Three new metal free organic dyes (FSD101-103) were synthesized to investigate the influence of diyne unit on dye molecules. FSD101 and FSD102 with diyne unit and FSD103 with monoyne unit were applied as sensitizers in the dye-sensitized solar cells (DSSCs). The optical and electrochemical properties, theoretical studies, and photovoltaic parameters of DSSCs sensitized by these dyes were systematically investigated. By replacing the monoyne unit with a diyne unit, FSD101 exhibited broader absorption spectrum, lower IP, higher EA, lower band gap energy, higher oscillator strength, more efficient electron injection ability, broader IPCE response range and higher τ{sub e} in comparison with FSD103. Hence, DSSC sensitized by FSD101 showed higher J{sub sc} and V{sub oc} values, and demonstrated a power conversion efficiency of 3.12%, about 2-fold as that of FSD103 (1.55%). FSD102 showed similar results as FSD101, with a power conversion efficiency of 2.98%, despite a stronger electron withdraw cyanoacrylic acid group was introduced. This may be due to the lower efficiency of the electron injection from dye to TiO{sub 2} and lower τ{sub e} of FSD102 than that of FSD101. These results indicate that the performance of DSSCs can be significantly improved by introducing a diyne unit into this type of organic dyes. - Highlights: • Diyne-bridge was introduced into dye molecules by a transition-metal-free protocol. • Power conversion efficiency grows from 1.55% to 3.12% by replacing monoyne unit with diyne unit. • FSD101 with diyne unit shows the highest electron lifetime resulting in a higher V{sub oc}.

  9. Full system decontamination (FSD) at NPP Stade prior to dismantling activities

    International Nuclear Information System (INIS)

    Christoph Stiepani; Karl Seidelmann

    2006-01-01

    Full text of publication follows: Introduction: Minimization of personnel dose rates and generation of material free for release is of the highest priority and requires Full System Decontamination (FSD) as a first and important measure when decommissioning Nuclear Power Plants. Framatome ANP has many years experience with Full System Decontaminations for operating nuclear power plants in general and for decommissioning in particular. The latest decommissioning project was the FSD at the PWR Stade which was permanently shut down in November 2003 after 31 years of operation. FSD was scheduled within a short period after shutdown and prior to decommissioning activities. Full System Decontamination at Stade: The PWR Stade is a 4 loop design. FSD included the entire primary circuit with RPV and the auxiliary systems (RHR, VCS and RWCU). The decontamination circuit had a total volume of ∼310 m 3 and an overall surface of ∼17000 m 2 . The Framatome ANP decontamination process HP/CORD R UV was selected for application. The decontamination was performed by using NPP systems in combination with the Framatome mobile decontamination equipment AMDA R (Automated Mobile Decontamination Appliance). A total of 4 decontamination cycles were performed and excellent results were obtained. The average decontamination factor (DF) was 160 for the steam generators with an outstanding ambient dose reduction factor (DRF) of 75. Conclusions: FSD at the PWR Stade has shown that the HP/CORD UV process yields excellent results in primary and auxiliary systems. The significant ambient dose reduction factor of 75 is remarkable. This very high DRF, no other decontamination application came even close, will result in excellent cost-benefit ratios for additional decommissioning activities at Stade. The applied HP/CORD UV process is not a specific decontamination process for decommissioning. Therefore the obtained decontamination and dose reduction factors demonstrate the advantage/potential for

  10. Universal dephasing control during quantum computation

    International Nuclear Information System (INIS)

    Gordon, Goren; Kurizki, Gershon

    2007-01-01

    Dephasing is a ubiquitous phenomenon that leads to the loss of coherence in quantum systems and the corruption of quantum information. We present a universal dynamical control approach to combat dephasing during all stages of quantum computation, namely, storage and single- and two-qubit operators. We show that (a) tailoring multifrequency gate pulses to the dephasing dynamics can increase fidelity; (b) cross-dephasing, introduced by entanglement, can be eliminated by appropriate control fields; (c) counterintuitively and contrary to previous schemes, one can increase the gate duration, while simultaneously increasing the total gate fidelity

  11. Coherence-generating power of quantum dephasing processes

    Science.gov (United States)

    Styliaris, Georgios; Campos Venuti, Lorenzo; Zanardi, Paolo

    2018-03-01

    We provide a quantification of the capability of various quantum dephasing processes to generate coherence out of incoherent states. The measures defined, admitting computable expressions for any finite Hilbert-space dimension, are based on probabilistic averages and arise naturally from the viewpoint of coherence as a resource. We investigate how the capability of a dephasing process (e.g., a nonselective orthogonal measurement) to generate coherence depends on the relevant bases of the Hilbert space over which coherence is quantified and the dephasing process occurs, respectively. We extend our analysis to include those Lindblad time evolutions which, in the infinite-time limit, dephase the system under consideration and calculate their coherence-generating power as a function of time. We further identify specific families of such time evolutions that, although dephasing, have optimal (over all quantum processes) coherence-generating power for some intermediate time. Finally, we investigate the coherence-generating capability of random dephasing channels.

  12. Quantum Metrology beyond the Classical Limit under the Effect of Dephasing

    Science.gov (United States)

    Matsuzaki, Yuichiro; Benjamin, Simon; Nakayama, Shojun; Saito, Shiro; Munro, William J.

    2018-04-01

    Quantum sensors have the potential to outperform their classical counterparts. For classical sensing, the uncertainty of the estimation of the target fields scales inversely with the square root of the measurement time T . On the other hand, by using quantum resources, we can reduce this scaling of the uncertainty with time to 1 /T . However, as quantum states are susceptible to dephasing, it has not been clear whether we can achieve sensitivities with a scaling of 1 /T for a measurement time longer than the coherence time. Here, we propose a scheme that estimates the amplitude of globally applied fields with the uncertainty of 1 /T for an arbitrary time scale under the effect of dephasing. We use one-way quantum-computing-based teleportation between qubits to prevent any increase in the correlation between the quantum state and its local environment from building up and have shown that such a teleportation protocol can suppress the local dephasing while the information from the target fields keeps growing. Our method has the potential to realize a quantum sensor with a sensitivity far beyond that of any classical sensor.

  13. Dephasing of optically generated electron spins in semiconductors

    International Nuclear Information System (INIS)

    Idrish Miah, M.

    2010-01-01

    Dephasing of optically generated electron spins in the presence of the external magnetic field and electric bias in semiconductor nano-structures has been studied by time- and polarization-resolved spectrometry. The obtained experimental data are presented in dependence of the strength of the magnetic field. The optically generated electron-spin precession frequency and dephasing time and rate are estimated. It is found that both the spin precession frequency and dephasing rate increase linearly with the external magnetic field up to about 9 T. However, the spin dephasing time is within sub-μs and is found to decrease exponentially with the strength of the external magnetic field. The results are discussed by exploring possible mechanisms of spin dephasing in low-dimensional semiconductor structures, where the quantum-confinement persists within the nano-range.

  14. Dephasing of optically generated electron spins in semiconductors

    Energy Technology Data Exchange (ETDEWEB)

    Idrish Miah, M., E-mail: m.miah@griffith.edu.a [Department of Physics, University of Chittagong, Chittagong, Chittagong - 4331 (Bangladesh)

    2010-09-13

    Dephasing of optically generated electron spins in the presence of the external magnetic field and electric bias in semiconductor nano-structures has been studied by time- and polarization-resolved spectrometry. The obtained experimental data are presented in dependence of the strength of the magnetic field. The optically generated electron-spin precession frequency and dephasing time and rate are estimated. It is found that both the spin precession frequency and dephasing rate increase linearly with the external magnetic field up to about 9 T. However, the spin dephasing time is within sub-{mu}s and is found to decrease exponentially with the strength of the external magnetic field. The results are discussed by exploring possible mechanisms of spin dephasing in low-dimensional semiconductor structures, where the quantum-confinement persists within the nano-range.

  15. Which are the male factors associated with female sexual dysfunction (FSD)?

    Science.gov (United States)

    Maseroli, E; Fanni, E; Mannucci, E; Fambrini, M; Jannini, E A; Maggi, M; Vignozzi, L

    2016-09-01

    It has been generally assumed that partner's erectile dysfunction, premature, and delayed ejaculation play a significant role in determining female sexual dysfunction (FSD). This study aimed to evaluate the role of the male partner's sexual function, as perceived by women, in determining FSD. A consecutive series of 156 heterosexual women consulting our clinic for FSD was retrospectively studied. All patients underwent a structured interview and completed the Female Sexual Function Index (FSFI). FSFI total score decreased as a function of partner's age, conflicts within the couple, relationship without cohabitation and the habit of engaging in intercourse to please the partner; FSFI total score increased as a function of frequency of intercourse, attempts to conceive and fertility-focused intercourse. FSFI total score showed a negative, stepwise correlation with partner's perceived hypoactive sexual desire (HSD) (r = -0.327; p dysfunction, premature and delayed ejaculation. In an age-adjusted model, partner's HSD was negatively related to FSFI total score (Wald = 9.196, p = 0.002), arousal (Wald = 7.893, p = 0.005), lubrication (Wald = 5.042, p = 0.025), orgasm (Wald = 9.293, p = 0.002), satisfaction (Wald = 12.764, p sexual pleasure, and with a higher frequency of masturbation, even after adjusting for age. In patients not reporting any reduction in libido, FSFI total score was significantly lower when their partner's libido was low (p = 0.041); the correlation disappeared if the patient also experienced HSD. In conclusion, the presence of erectile dysfunction, premature, and delayed ejaculation of the partner may not act as a primary contributing factor to FSD, as determined by FSFI scores; conversely, women's sexuality seems to be mostly impaired by the perceived reduction in their partner's sexual interest. © 2016 American Society of Andrology and European Academy of Andrology.

  16. Room-Temperature Dephasing in InAs Quantum Dots

    DEFF Research Database (Denmark)

    Borri, Paola; Langbein, Wolfgang; Mørk, Jesper

    2000-01-01

    The room temperature dephasing in InAs/InGaAs/GaAs self-assembled quantum dots, embedded in a waveguide for laser applications, is measured using two independent methods: spectral hole burning and four-wave mixing. Without the application of bias current for electrical carrier injection......, a dephasing time of ~260 fs, weakly dependent on the optical excitation density, is found and attributed to phonon interaction. The application of bias current, leading to population inversion in the dot ground state and optical gain, strongly decreases the dephasing time to less than 50 fs, likely due...

  17. FSD: Frequency Space Differential measurement of CMB spectral distortions

    Science.gov (United States)

    Mukherjee, Suvodip; Silk, Joseph; Wandelt, Benjamin D.

    2018-04-01

    Although the Cosmic Microwave Background agrees with a perfect blackbody spectrum within the current experimental limits, it is expected to exhibit certain spectral distortions with known spectral properties. We propose a new method, Frequency Space Differential (FSD) to measure the spectral distortions in the CMB spectrum by using the inter-frequency differences of the brightness temperature. The difference between the observed CMB temperature at different frequencies must agree with the frequency derivative of the blackbody spectrum, in the absence of any distortion. However, in the presence of spectral distortions, the measured inter-frequency differences would also exhibit deviations from blackbody which can be modeled for known sources of spectral distortions like y & μ. Our technique uses FSD information for the CMB blackbody, y, μ or any other sources of spectral distortions to model the observed signal. Successful application of this method in future CMB missions can provide an alternative method to extract spectral distortion signals and can potentially make it feasible to measure spectral distortions without an internal blackbody calibrator.

  18. Dephasing in self-organized InAlGaAs quantum dots

    DEFF Research Database (Denmark)

    Leosson, K.; Birkedal, Dan; Hvam, Jørn Märcher

    2002-01-01

    We report the first direct measurements of dephasing in III-V semiconductor quantum dots at low temperature using degenerate four-wave mixing. At OK, the coherence time is limited by the population lifetime whereas pure dephasing due to exciton-phonon interactions appears only at finite temperatu......We report the first direct measurements of dephasing in III-V semiconductor quantum dots at low temperature using degenerate four-wave mixing. At OK, the coherence time is limited by the population lifetime whereas pure dephasing due to exciton-phonon interactions appears only at finite...

  19. Relaxometry and Dephasing Imaging of Superparamagnetic Magnetite Nanoparticles Using a Single Qubit

    Science.gov (United States)

    Schmid-Lorch, Dominik; Häberle, Thomas; Reinhard, Friedemann; Zappe, Andrea; Slota, Michael; Bogani, Lapo; Finkler, Amit; Wrachtrup, Jörg

    2015-08-01

    To study the magnetic dynamics of superparamagnetic nanoparticles we use scanning probe relaxometry and dephasing of the nitrogen-vacancy (NV) center in diamond, characterizing the spin-noise of a single 10-nm magnetite particle. Additionally, we show the anisotropy of the NV sensitivity's dependence on the applied decoherence measurement method. By comparing the change in relaxation (T 1 ) and dephasing (T 2 ) time in the NV center when scanning a nanoparticle over it, we are able to extract the nanoparticle's diameter and distance from the NV center using an Ornstein-Uhlenbeck model for the nanoparticle's fluctuations. This scanning-probe technique can be used in the future to characterize different spin label substitutes for both medical applications and basic magnetic nanoparticle behavior.

  20. Ab initio folding of mixed-fold FSD-EY protein using formula-based polarizable hydrogen bond (PHB) charge model

    Science.gov (United States)

    Zhang, Dawei; Lazim, Raudah; Mun Yip, Yew

    2017-09-01

    We conducted an all-atom ab initio folding of FSD-EY, a protein with a ββα configuration using non-polarizable (AMBER) and polarizable force fields (PHB designed by Gao et al.) in implicit solvent. The effect of reducing the polarization effect integrated into the force field by the PHB model, termed the PHB0.7 was also examined in the folding of FSD-EY. This model incorporates into the force field 70% of the original polarization effect to minimize the likelihood of over-stabilizing the backbone hydrogen bonds. Precise folding of the β-sheet of FSD-EY was further achieved by relaxing the REMD structure obtained in explicit water.

  1. Dephasing in InAs/GaAs quantum dots

    DEFF Research Database (Denmark)

    Borri, Paola; Langbein, Wolfgang Werner; Mørk, Jesper

    1999-01-01

    The room-temperature dephasing in InAs/GaAs self-assembled quantum dots is measured using two independent methods: spectal-hole burning and four-wave mixing. Dephasing times weakly dependent on the excitation density are found, with a low density value of 290+/-80 fs from spectal-hole burning...

  2. Coherence and dephasing in self-assembled quantum dots

    DEFF Research Database (Denmark)

    Hvam, Jørn Märcher; Leosson, K.; Birkedal, Dan

    2003-01-01

    We measured dephasing times in InGaAl/As self-assembled quantum dots at low temperature using degenerate four-wave mixing. At 0K, the coherence time of the quantum dots is lifetime limited, whereas at finite temperatures pure dephasing by exciton-phonon interactions governs the quantum dot...

  3. Rapid adiabatic passage in quantum dots: Influence of scattering and dephasing

    DEFF Research Database (Denmark)

    Schuh, K.; Jahnke, F.; Lorke, Michael

    2011-01-01

    Theoretical investigations for the realization of population inversion of semiconductor quantum dot ground-state transitions by means of adiabatic passage with chirped optical pulses are presented. While the inversion due to Rabi oscillations depends sensitively on the resonance condition...... to describe carrier scattering and dephasing in the corresponding simulations and allow to quantify the conditions to simultaneously invert an ensamble of quantum dots....

  4. Influence of pure dephasing on emission spectra from single photon sources

    DEFF Research Database (Denmark)

    Næsby Rasmussen, Andreas; Skovgård, Troels Suhr; Kristensen, Philip Trøst

    2008-01-01

    We investigate the light-matter interaction of a quantum dot with the electromagnetic field in a lossy microcavity and calculate emission spectra for nonzero detuning and dephasing. It is found that dephasing shifts the intensity of the emission peaks for nonzero detuning. We investigate the char......We investigate the light-matter interaction of a quantum dot with the electromagnetic field in a lossy microcavity and calculate emission spectra for nonzero detuning and dephasing. It is found that dephasing shifts the intensity of the emission peaks for nonzero detuning. We investigate...

  5. Prisoners' dilemma in the presence of collective dephasing

    International Nuclear Information System (INIS)

    Nawaz, Ahmad

    2012-01-01

    We quantize prisoners' dilemma in the presence of collective dephasing with a dephasing rate γ. It is shown that for a two-parameter set of strategies, Q⊗Q is Nash equilibrium below a cut-off value of time. Beyond this cut-off it bifurcates into two new Nash equilibria Q⊗D and D⊗Q. Furthermore, for the maximum value of decoherence C⊗D and D⊗C also become Nash equilibria. At this stage the game has four Nash equilibria. On the other hand, for a three-parameter set of strategies, there is no pure strategy Nash equilibrium; however, there is a mixed strategy (non-unique) Nash equilibrium that is not affected by collective dephasing. (paper)

  6. Dephasing times in quantum dots due to elastic LO phonon-carrier collisions

    DEFF Research Database (Denmark)

    Uskov, A. V.; Jauho, Antti-Pekka; Tromborg, Bjarne

    2000-01-01

    Interpretation of experiments on quantum dot (QD) lasers presents a challenge: the phonon bottleneck, which should strongly suppress relaxation and dephasing of the discrete energy states, often seems to be inoperative. We suggest and develop a theory for an intrinsic mechanism for dephasing in Q......: second-order elastic interaction between quantum dot charge carriers and LO phonons. The calculated dephasing times are of the order of 200 fs at room temperature, consistent with experiments. The phonon bottleneck thus does not prevent significant room temperature dephasing....

  7. Constraints on dephasing widths and shifts in three-level quantum systems

    International Nuclear Information System (INIS)

    Berman, P.R.; O'Connell, Ross C.

    2005-01-01

    It is shown that the density matrix equations for a three-level quantum system interacting with external radiation fields can lead to negative populations if arbitrary dephasing rates and shifts are included in these equations. To guarantee non-negative populations, the equations themselves impose certain restrictions on the dephasing widths and shifts. The constraints on the widths are shown to be identical to those that can be derived from a model of Markovian dephasing events, independent of any atom-field interaction

  8. Magneto-exciton dephasing in a single quantum dot

    Science.gov (United States)

    Rodriguez, F. J.; Reyes, A.; Olaya-Castro, A.; Quiroga, L.

    2001-03-01

    Ultrafast spectroscopy experiments on single quantum dot (SQD) in magnetic fields provide a variety of unexpected results, one of them being the recently reported entanglement of exciton states. In order to explore the entanglement robustness, dephasing mechanisms must be considered. By calculating the non-linear time resolved optical spectrum of a SQD, we present a theoretical study on the exciton-exciton scattering contribution to the magneto-exciton dephasing time. Our results show that the time evolution of \\chi^(3) presents, under non-steady-state condition, a beating between the bound biexciton and the first unbound biexciton state in the strong confinement regime. The contribution coming from both left and right polarized emitted photons allows us to predict the creation of exciton entanglement, in agreement with recent experimental results. Previous theoretical works have only addressed the stationary optical response. By contrast, our results based on a full time dependent calculation show new features specially for the fast dephasing case.

  9. A comparative study of two phenomenological models of dephasing in series and parallel resistors

    International Nuclear Information System (INIS)

    Bandopadhyay, Swarnali; Chaudhuri, Debasish; Jayannavar, Arun M.

    2010-01-01

    We compare two recent phenomenological models of dephasing using a double barrier and a quantum ring geometry. While the stochastic absorption model generates controlled dephasing leading to Ohm's law for large dephasing strengths, a Gaussian random phase based statistical model shows many inconsistencies.

  10. Fiber-optic sensor demonstrator (FSD) for the monitoring of spacecraft subsystems on ESA's PROBA-2

    Science.gov (United States)

    Kruzelecky, Roman V.; Zou, Jing; Mohammed, Najeeb; Haddad, Emile; Jamroz, Wes; Ricci, Francesco; Lamorie, Joshua; Edwards, Eric; McKenzie, Iain; Vuilleumier, Pierrik

    2017-11-01

    MPB Communications (MPBC) is developing solutions to the monitoring requirements of spacecraft based on its fiber-laser and Fiber Bragg Grating expertise. This is cumulating in the Fiber Sensor Demonstrator for ESA's Proba-2 that is scheduled for launch in 2007. The advantages of the MPBC approach include a central interrogation system that can be used to control a variety of different fiber-optic sensors including temperature, pressure, actuator status, and propellant leakage. This paper reviews the design and ground qualification of the FSD system in preparation for integration with Proba-2. The FSD will provide monitoring for various Proba-2 subsystems, including a hybrid propulsion system. Some of the challenges associated with using fiber-optics in space are discussed.

  11. Dephasing in semiconductor-superconductor structures by coupling to a voltage probe

    DEFF Research Database (Denmark)

    Mortensen, Niels Asger; Jauho, Antti-Pekka; Flensberg, Karsten

    2000-01-01

    We study dephasing in semiconductor-superconductor structures caused by coupling to a voltage probe. We consider structures where the semiconductor consists of two scattering regions between which partial dephasing is possible. As a particular example we consider a situation with a double barrier...

  12. FSD for operating NPPs as part of sustainable dose reduction - recontamination evaluation for the German PWR Grafenrheinfeld

    International Nuclear Information System (INIS)

    Stellwag, Bernhard; Hoffmann-Wankerl, Stephan; Schuetz, Sigrid; Jacob, Astrid

    2012-09-01

    Full-system decontamination (FSD) or replacement of steam generators (SG) and other large components in mature PWR plants results in large bare metal surfaces in the reactor system. The AREVA chemistry concept for sustainable dose rate reduction at such plants includes a passivation treatment for formation of high-quality oxide films in the reactor system and high pH operation in combination with zinc injection during subsequent power operation. The effectiveness of these measures has been proven by plant operation experience. The systematic evaluation of plant-specific experience is used for further optimization of the concept. These measures were also applied at the 1350 MW-class 4-loop PWR Grafenrheinfeld after an FSD with the AREVA decontamination process HP/CORD R UV in 28 th outage. The passivation treatment consisted of zinc injection during plant heat-up and parallel adjustment of a high pH value. It was carried out in the plant operation condition 'subcritical hot' for 200 hours and a pH (300 deg. C) of 7.1. During the cycle, the pH value was increased to 7.4 and zinc injection was continued. This paper evaluates the recontamination of the plant inclusive the first refueling outage since the FSD. The evaluation is based on routine chemistry and dose rate surveillance data and on the results of special measurement programs conducted at the plant before and after the FSD. Results of surface gamma activity measurements and fuel crud analyses are also described. Data is evaluated with regard to release, transport and deposition of corrosion products and nuclides in the reactor system. The plant-specific contamination sources and their pathways are outlined. Compared to the first refueling outage of the plant in 1983, the dose rate level at the main loops could be more than halved in spite of already activated core internals and crud on fuel assemblies, the in-core instrumentation and the control rods including guide assemblies and drive rods. The FSD

  13. Exciton dephasing and biexciton binding in CdSe/ZnSe islands

    DEFF Research Database (Denmark)

    Wagner, Hans Peter; Tranitz, H.-P.; Preis, H

    1999-01-01

    The dephasing of excitons and the formation of biexcitons in self-organized CdSe/ZnSe islands grown by molecular-beam epitaxy is investigated using spectrally resolved four-wave mixing. A distribution of exciton-exciton scattering efficiencies and dephasing times in the range of 0.5-10 ps...

  14. Dephasing and hyperfine interaction in carbon nanotubes double quantum dots

    DEFF Research Database (Denmark)

    Reynoso, Andres Alejandro; Flensberg, Karsten

    2012-01-01

    We study theoretically the return probability experiment, which is used to measure the dephasing time T-2*, in a double quantum dot (DQD) in semiconducting carbon nanotubes with spin-orbit coupling and disorder-induced valley mixing. Dephasing is due to hyperfine interaction with the spins of the C...... with these for DQDs in clean nanotubes, whereas the disorder effect is always relevant when the magnetic field is perpendicular to the nanotube axis....

  15. Feedback controlled dephasing and population relaxation in a two-level system

    International Nuclear Information System (INIS)

    Wang Jin

    2009-01-01

    This Letter presents the maximum achievable stability and purity that can be obtained in a two-level system with both dephasing and population relaxation processes by using homodyne-mediated feedback control. An analytic formula giving the optimal amplitudes of the driving and feedback for the steady-state is also presented. Experimental examples are used to show the importance of controlling the dephasing process.

  16. Heat transport in the XXZ spin chain: from ballistic to diffusive regimes and dephasing enhancement

    International Nuclear Information System (INIS)

    Mendoza-Arenas, J J; Al-Assam, S; Clark, S R; Jaksch, D

    2013-01-01

    In this work we study the heat transport in an XXZ spin-1/2 Heisenberg chain with homogeneous magnetic field, incoherently driven out of equilibrium by reservoirs at the boundaries. We focus on the effect of bulk dephasing (energy-dissipative) processes in different parameter regimes of the system. The non-equilibrium steady state of the chain is obtained by simulating its evolution under the corresponding Lindblad master equation, using the time evolving block decimation method. In the absence of dephasing, the heat transport is ballistic for weak interactions, while being diffusive in the strongly interacting regime, as evidenced by the heat current scaling with the system size. When bulk dephasing takes place in the system, diffusive transport is induced in the weakly interacting regime, with the heat current monotonically decreasing with the dephasing rate. In contrast, in the strongly interacting regime, the heat current can be significantly enhanced by dephasing for systems of small size. (paper)

  17. Female sexual dysfunction (FSD): Prevalence and impact on quality of life (QoL).

    Science.gov (United States)

    Nappi, Rossella E; Cucinella, Laura; Martella, Silvia; Rossi, Margherita; Tiranini, Lara; Martini, Ellis

    2016-12-01

    Female sexual dysfunction (FSD) and quality of life (QOL) are both multidimensional and have a bidirectional relationship across the reproductive life span and beyond. Methodological difficulties exist in estimating the real prevalence of FSD because it is hard to determine the level of distress associated with sexual symptoms in a large-scale survey. Approximately 40-50% of all women report at least one sexual symptom, and some conditions associated with hormonal changes at menopause, such as vulvovaginal atrophy (VVA) and hypoactive sexual desire disorder (HSDD), have a significant impact on sexual function and QOL. Sexual distress peaks at midlife, declines with age and is strongly partner-related. Many postmenopausal women are still sexually active, especially if they are in a stable partnership. Even though sexual functioning is impaired, a variety of psychosocial factors may maintain sexual satisfaction. That being so, health care providers (HCPs) should proactively address sexual symptoms at midlife and in older women, from a balanced perspective. Adequate counselling should be offered. Women with distressing symptoms may benefit from tailored hormonal and non-hormonal therapies, whereas women without distress related to their sexual experiences should not receive any specific treatment. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  18. Exciton dephasing in ZnSe quantum wires

    DEFF Research Database (Denmark)

    Wagner, Hans Peter; Langbein, Wolfgang Werner; Hvam, Jørn Märcher

    1998-01-01

    The homogeneous linewidths of excitons in wet-etched ZnSe quantum wires of lateral sizes down to 23 nm are studied by transient four-wave mixing. The low-density dephasing time is found to increase with decreasing wire width. This is attributed mainly to a reduction of electron-exciton scattering...

  19. Spin-Dephasing Anisotropy for Electrons in a Diffusive Quasi-1D GaAs Wire

    NARCIS (Netherlands)

    Liu, J.; Last, T.; Koop, E. J.; Denega, S.; van Wees, B. J.; van der Wal, C. H.

    We present a numerical study of dephasing of electron spin ensembles in a diffusive quasi-one-dimensional GaAs wire due to the D'yakonov-Perel' spin-dephasing mechanism. For widths of the wire below the spin precession length and for equal strength of Rashba and linear Dresselhaus spin-orbit fields

  20. Vibronic dephasing model for coherent-to-incoherent crossover in DNA

    Science.gov (United States)

    Karasch, Patrick; Ryndyk, Dmitry A.; Frauenheim, Thomas

    2018-05-01

    In this paper, we investigate the interplay between coherent and incoherent charge transport in cytosine-guanine (GC-) rich DNA molecules. Our objective is to introduce a physically grounded approach to dephasing in large molecules and to understand the length-dependent charge transport characteristics, and especially the crossover from the coherent tunneling to incoherent hopping regime at different temperatures. Therefore, we apply the vibronic dephasing model and compare the results to the Büttiker probe model which is commonly used to describe decoherence effects in charge transport. Using the full ladder model and simplified one-dimensional model of DNA, we consider molecular junctions with alternating and stacked GC sequences and compare our results to recent experimental measurements.

  1. Binding-energy distribution and dephasing of localized biexcitons

    DEFF Research Database (Denmark)

    Langbein, Wolfgang Werner; Hvam, Jørn Märcher; Umlauff, M.

    1997-01-01

    We report on the binding energy and dephasing of localized biexciton states in narrow ZnSe multiple quantum wells. The measured binding-energy distribution of the localized biexcitons shows a width of 2.2 meV centered at 8.5 meV, and is fairly independent of the exciton localization energy. In fo...

  2. Dissipation, dephasing and quantum Darwinism in qubit systems with random unitary interactions

    Science.gov (United States)

    Balaneskovic, Nenad; Mendler, Marc

    2016-09-01

    We investigate the influence of dissipation and decoherence on quantum Darwinism by generalizing Zurek's original qubit model of decoherence and the establishment of pointer states [W.H. Zurek, Nat. Phys. 5, 181 (2009); see also arXiv: quant-ph/0707.2832v1, pp. 14-19.]. Our model allows for repeated multiple qubit-qubit couplings between system and environment which are described by randomly applied two-qubit quantum operations inducing entanglement, dissipation and dephasing. The resulting stationary qubit states of system and environment are investigated. They exhibit the intricate influence of entanglement generation, dissipation and dephasing on this characteristic quantum phenomenon.

  3. Wave attenuation model for dephasing and measurement of ...

    Indian Academy of Sciences (India)

    There are different ways to model dephasing in mesoscopic systems. An interesting method is to attach a voltage probe [3] to the sample as in the inset of figure 1 (Buttiker's model). In this model, an electron captured by a voltage probe is injected back with an uncorrelated phase leading to irreversible loss of phase memory ...

  4. Resonance Raman and optical dephasing study of tricarbocyanine dyes

    NARCIS (Netherlands)

    Ashworth, SH; Kummrow, A; Lenz, K

    Fluorescence lineshape analysis based on resonance Raman spectra of the dye HITCI was used to determine the details and magnitude of the vibrational part of the line broadening function, Forced light scattering (FLS) was applied to measure optical dephasing of HITCI in ethylene glycol, pumping at

  5. Reducing dephasing in coupled quantum dot-cavity systems by engineering the carrier wavefunctions

    DEFF Research Database (Denmark)

    Nysteen, Anders; Nielsen, Per Kær; Mørk, Jesper

    2012-01-01

    We demonstrate theoretically how photon-assisted dephasing by the electron-phonon interaction in a coupled cavity-quantum dot system can be significantly reduced for specific QD-cavity detunings. Our starting point is a recently published theory,1 which considers longitudinal acoustic phonons......, described by a non-Markovian model, interacting with a coupled quantum dot-cavity system. The reduction of phonon-induced dephasing is obtained by placing the cavity-quantum dot system inside an infinite slab, assuming spherical electronic wavefunctions. Based on our calculations, we expect this to have...

  6. Semiclassical Monte Carlo simulation studies of spin dephasing in InP and InSb nanowires

    Directory of Open Access Journals (Sweden)

    Ashish Kumar

    2012-03-01

    Full Text Available We use semiclassical Monte Carlo approach to investigate spin polarized transport in InP and InSb nanowires. D’yakonov-Perel (DP relaxation and Elliott-Yafet (EY relaxation are the two main relaxation mechanisms for spin dephasing in III-V channels. The DP relaxation occurs because of bulk inversion asymmetry (Dresselhaus spin-orbit interaction and structural inversion asymmetry (Rashba spin-orbit interaction. The injection polarization direction studied is that along the length of the channel. The dephasing rate is found to be very strong for InSb as compared to InP which has larger spin dephasing lengths. The ensemble averaged spin components vary differently for both InP and InSb nanowires. The steady state spin distribution also shows a difference between the two III-V nanowires.

  7. Dephasing in coherent communication with weak signal states

    International Nuclear Information System (INIS)

    Jarzyna, Marcin; Banaszek, Konrad; Demkowicz-Dobrzański, Rafał

    2014-01-01

    We analyse the ultimate quantum limit on the accessible information for an optical communication scheme when time bins carry coherent light pulses prepared in one of several orthogonal modes and the phase undergoes diffusion after each channel use. This scheme, an example of a quantum memory channel, can be viewed as noisy pulse position modulation (PPM) keying with phase fluctuations occurring between consecutive PPM symbols. We derive a general expression for the output states in the Fock basis and implement a numerical procedure to calculate the Holevo quantity. Using asymptotic properties of Toeplitz matrices, we also present an analytic expression for the Holevo quantity valid for very weak signals and sufficiently strong dephasing when the dominant contribution comes from the single-photon sector in the Hilbert space of signal states. Based on numerical results we conjecture an inequality for contributions to the Holevo quantity from multiphoton sectors which implies that in the asymptotic limit of weak signals, for arbitrarily small dephasing the accessible information scales linearly with the average number of photons contained in the pulse. Such behaviour presents a qualitative departure from the fully coherent case. (paper)

  8. Factors affecting the effectiveness of a projection dephaser in 2D gradient-echo imaging

    International Nuclear Information System (INIS)

    Bakker, Chris J G; Peters, Nicky H G M; Vincken, Koen L; Bom, Martijn van der; Seppenwoolde, Jan-Henry

    2007-01-01

    Projection dephasers are often used for background suppression and dynamic range improvement in thick-slab 2D imaging in order to promote the visibility of subslice structures, e.g., blood vessels and interventional devices. In this study, we explored the factors that govern the effectiveness of a projection dephaser by simulations and phantom experiments. This was done for the ideal case of a single subslice hyper- or hypointensity against a uniform background in the absence of susceptibility effects. Simulations and experiments revealed a pronounced influence of the slice profile, the nominal flip angle and the TE and TR of the acquisition, the size, intraslice position and MR properties of the subslice structure, and T 1 of the background. The complexity of the ideal case points to the necessity of additional explorations when considering the use of projection dephasers under less ideal conditions, e.g., in the presence of tissue heterogeneities and susceptibility gradients

  9. Charge transport and magnetoresistance of G4-DNA molecular device modulated by counter ions and dephasing effect

    International Nuclear Information System (INIS)

    Kang, Da-wei; Sun, Meng-le; Zuo, Zheng-wei; Wang, Hui-xian; Lv, Shi-jie; Li, Xin-zhong; Li, Li-ben

    2016-01-01

    The charge transport properties of the G4-DNA molecular device in the presence of counter ions and dephasing effect are investigated based on the Green function method and Landauer–Büttiker theory. The currents through the G4-DNA molecular device depend on the interference patterns at different coupling configurations. There is an effective electrostatic interaction between the counter ions and the G4-DNA molecule which introduces disorder into the on-site energies of G bases. The current through the device can be enhanced by the small disorder which avoids the strong interference of electrons at the same energy in some coupling configurations, however the diagonal disorder can suppress the overall current due to the Anderson localization of charge carriers when the disorder is large. In the presence of dephasing effect the current through the device at all coupling configurations can be enhanced as a result of the phase coherence losing of electron. As for the magnetic field response, the magnetoresistance of the device is always suppressed by the counter ions and dephasing effect. - Highlights: • The counter ions can some times enhance the current through G4-DNA molecule. • The dephasing effect can enhance the current of the device at all four coupling configurations. • The magnetoresistance is always suppressed by the counter ions and dephasing effect.

  10. Financial Development and Investment-Cash Flow Sensitivity

    Directory of Open Access Journals (Sweden)

    Jungwon Suh

    2007-06-01

    Full Text Available Using firm-level data from thirty-five countries around the world, this paper empirically examines whether investment-cash flow sensitivity reflects financial constraints. Recent US studies have raised questions on the prediction that investment-cash flow sensitivity is a measure of financial constraints. Looking at thirty-five countries with varying degrees of financial development, this study tests whether investment-cash flow sensitivity is in fact related to financial constraints. In most countries, the evidence supporting the argument that firms likely facing financially constraints display high investment-cash flow sensitivity is weak. Moreover, the evidence that firms in the absence of developed financial markets display high investment-cash flow sensitivity is also weak. Overall, the results from this international investigation do not support the prediction that investment-cash flow sensitivity reflects financial constraints.

  11. Copper plasmonics and catalysis: role of electron-phonon interactions in dephasing localized surface plasmons

    Science.gov (United States)

    Sun, Qi-C.; Ding, Yuchen; Goodman, Samuel M.; H. Funke, Hans; Nagpal, Prashant

    2014-10-01

    Copper metal can provide an important alternative for the development of efficient, low-cost and low-loss plasmonic nanoparticles, and selective nanocatalysts. However, poor chemical stability and lack of insight into photophysics and plasmon decay mechanisms has impeded study. Here, we use smooth conformal ALD coating on copper nanoparticles to prevent surface oxidation, and study dephasing time for localized surface plasmons on different sized copper nanoparticles. Using dephasing time as a figure of merit, we elucidate the role of electron-electron, electron-phonon, impurity, surface and grain boundary scattering on the decay of localized surface plasmon waves. Using our quantitative analysis and different temperature dependent measurements, we show that electron-phonon interactions dominate over other scattering mechanisms in dephasing plasmon waves. While interband transitions in copper metal contributes substantially to plasmon losses, tuning surface plasmon modes to infrared frequencies leads to a five-fold enhancement in the quality factor. These findings demonstrate that conformal ALD coatings can improve the chemical stability for copper nanoparticles, even at high temperatures (>300 °C) in ambient atmosphere, and nanoscaled copper is a good alternative material for many potential applications in nanophotonics, plasmonics, catalysis and nanoscale electronics.Copper metal can provide an important alternative for the development of efficient, low-cost and low-loss plasmonic nanoparticles, and selective nanocatalysts. However, poor chemical stability and lack of insight into photophysics and plasmon decay mechanisms has impeded study. Here, we use smooth conformal ALD coating on copper nanoparticles to prevent surface oxidation, and study dephasing time for localized surface plasmons on different sized copper nanoparticles. Using dephasing time as a figure of merit, we elucidate the role of electron-electron, electron-phonon, impurity, surface and grain

  12. Tadalafil once daily: Narrative review of a treatment option for female sexual dysfunctions (FSD in midlife and older women

    Directory of Open Access Journals (Sweden)

    Chiara Borghi

    2017-03-01

    Full Text Available Female Sexual Disorders (FSD include a complex, multidimensional, individual experience that can change as an individual age, suggesting that these problems are caused by multiple factors including psychosocial factors, personal relationships, pathologic changes caused by diseases, and pharmacologic influences. Menopause is an important time for middle aged women and postmenopausal physiological changes could have a significant role in the development of FSD. Few is still known about their correct definition and treatment. Their incidence, prevalence and risk factors are difficult to define because of a high level of overlap in the experience of problems with desire, arousal, and orgasm. Little evidences are known about the best therapeutic approach, and both non-pharmacological and pharmacological treatment options have been described. Among these, phosphodiesterase type 5 inhibitors could be an effective option for many subtypes of female sexual disorders, with an improvement in different aspects of sexual function, such as desire, arousal, orgasm and sexual satisfaction. In this paper authors reviewed what is already known about the use of these vasoactive agents, particularly tadalafil, as a treatment option for female sexual disturbances.

  13. Dynamical decoupling sequences for multi-qubit dephasing suppression and long-time quantum memory

    International Nuclear Information System (INIS)

    Paz-Silva, Gerardo A; Lee, Seung-Woo; Green, Todd J; Viola, Lorenza

    2016-01-01

    We consider a class of multi-qubit dephasing models that combine classical noise sources and linear coupling to a bosonic environment, and are controlled by arbitrary sequences of dynamical decoupling pulses. Building on a general transfer filter-function framework for open-loop control, we provide an exact representation of the controlled dynamics for arbitrary stationary non-Gaussian classical and quantum noise statistics, with analytical expressions emerging when all dephasing sources are Gaussian. This exact characterization is used to establish two main results. First, we construct multi-qubit sequences that ensure maximum high-order error suppression in both the time and frequency domain and that can be exponentially more efficient than existing ones in terms of total pulse number. Next, we show how long-time multi-qubit storage may be achieved by meeting appropriate conditions for the emergence of a fidelity plateau under sequence repetition, thereby generalizing recent results for single-qubit memory under Gaussian dephasing. In both scenarios, the key step is to endow multi-qubit sequences with a suitable displacement anti-symmetry property, which is of independent interest for applications ranging from environment-assisted entanglement generation to multi-qubit noise spectroscopy protocols. (paper)

  14. Raman study of vibrational dephasing in liquid CH3CN and CD3CN

    International Nuclear Information System (INIS)

    Schroeder, J.; Schiemann, V.H.; Sharko, P.T.; Jonas, J.

    1977-01-01

    The Raman line shapes of the ν 1 (a 1 ) C--H and C--D fundamentals in liquid acetonitrile and acetonitrile-d 3 have been measured as a function of pressure up to 4 kbar within the temperature interval 30--120 degreeC. Densities have also been determined. From the isotropic component of the vibrational Raman band shape the vibrational relaxation times have been obtained as a function of temperature and pressure (density). The experimental results can be summarized as follows: (i) as T increases at constant density rho, the vibrational relaxation rate (tau/sub vib/) -1 increases; (ii) at constant T as density is raised tau/sub vib/ -1 increases; (iii) at constant pressure the T increase produces higher tau/sub vib/ -1 , however, the change is more pronounced for the CD 3 CN liquid. Isotopic dilution studies of the CH 3 CN/CD 3 CN mixtures shows no significant effect on (tau/sub vib/ -1 ). The experimental data are interpreted in terms of the Kubo stochastic line shape theory and the dephasing model of Fischer and Laubereau. The results based on Kubo formalism indicate that dephasing is the dominant relaxation mechanism and that the modulation is fast. The isolated binary collision model proposed by Fischer and Laubereau for vibrational dephasing reproduces the essential features of the density and temperature dependence of the (tau/sub vib/) -1 and suggests that pure dephasing is the dominant broadening mechanism for the isotropic line shapes studied. In the calculation the elastic collision times were approximated by the Enskog relaxation times

  15. The effect of electron-electron interaction induced dephasing on electronic transport in graphene nanoribbons

    Energy Technology Data Exchange (ETDEWEB)

    Kahnoj, Sina Soleimani; Touski, Shoeib Babaee [School of Electrical and Computer Engineering, University of Tehran, P.O. Box 14395-515, Tehran (Iran, Islamic Republic of); Pourfath, Mahdi, E-mail: pourfath@ut.ac.ir, E-mail: pourfath@iue.tuwien.ac.at [School of Electrical and Computer Engineering, University of Tehran, P.O. Box 14395-515, Tehran (Iran, Islamic Republic of); Institute for Microelectronics, TU Wien, Gusshausstrasse 27–29/E360, 1040 Vienna (Austria)

    2014-09-08

    The effect of dephasing induced by electron-electron interaction on electronic transport in graphene nanoribbons is theoretically investigated. In the presence of disorder in graphene nanoribbons, wavefunction of electrons can set up standing waves along the channel and the conductance exponentially decreases with the ribbon's length. Employing the non-equilibrium Green's function formalism along with an accurate model for describing the dephasing induced by electron-electron interaction, we show that this kind of interaction prevents localization and transport of electrons remains in the diffusive regime where the conductance is inversely proportional to the ribbon's length.

  16. The effect of dephasing on edge state transport through p-n junctions in HgTe/CdTe quantum wells.

    Science.gov (United States)

    Zhang, Ying-Tao; Song, Juntao; Sun, Qing-Feng

    2014-02-26

    Using the Landauer-Büttiker formula, we study the effect of dephasing on the transport properties of the HgTe/CdTe p-n junction. It is found that in the HgTe/CdTe p-n junction the topologically protected gapless helical edge states manifest a quantized 2e²/h plateau robust against dephasing, in sharp contrast to the case for the normal HgTe/CdTe quantum well. This robustness of the transport properties of the edge states against dephasing should be attributed to the special construction of the HgTe/CdTe p-n junction, which limits the gapless helical edge states to a very narrow region and thus weakens the influence of the dephasing on the gapless edge states to a large extent. Our results demonstrate that the p-n junction could be a substitute device for use in experimentally observing the robust edge states and quantized plateau. Finally, we present a feasible scheme based on current experimental methods.

  17. Observation of the in-plane spin-dephasing anisotropy in [111]-grown GaAs/AlGaAs quantum well

    International Nuclear Information System (INIS)

    Zhao, Chunbo; Li, Junbin; Yu, Ying; Ni, Haiqiao; Niu, Zhichuan; Zhang, Xinhui

    2014-01-01

    The electron density and temperature dependent in-plane spin-dephasing anisotropy in [111]-grown GaAs quantum well (QW) has been investigated by time-resolved magneto-Kerr rotation technique. Due to the specific symmetry of [111]-grown quantum well, the in-plane Rashba and linear Dresselhaus effective spin-orbit magnetic field is parallel to each other for electron wave vectors in all directions. However, an obvious in-plane spin-dephasing anisotropy comparing [2 ¯ 11] with [01 ¯ 1] crystalline orientations has been observed and discussed in this work. Our results demonstrate the innegligible spin dephasing channel through inhomogeneous broadening induced by the out-of-plane non-linear Dresselhaus field, which arises naturally from the C 3 symmetry of [111]-grown GaAs QW

  18. Spatial correlation in matter-wave interference as a measure of decoherence, dephasing, and entropy

    Science.gov (United States)

    Chen, Zilin; Beierle, Peter; Batelaan, Herman

    2018-04-01

    The loss of contrast in double-slit electron diffraction due to dephasing and decoherence processes is studied. It is shown that the spatial intensity correlation function of diffraction patterns can be used to distinguish between dephasing and decoherence. This establishes a measure of time reversibility that does not require the determination of coherence terms of the density matrix, while von Neumann entropy, another measure of time reversibility, does require coherence terms. This technique is exciting in view of the need to understand and control the detrimental experimental effect of contrast loss and for fundamental studies on the transition from the classical to the quantum regime.

  19. Many-Particle Dephasing after a Quench

    Science.gov (United States)

    Kiendl, Thomas; Marquardt, Florian

    2017-03-01

    After a quench in a quantum many-body system, expectation values tend to relax towards long-time averages. However, temporal fluctuations remain in the long-time limit, and it is crucial to study the suppression of these fluctuations with increasing system size. The particularly important case of nonintegrable models has been addressed so far only by numerics and conjectures based on analytical bounds. In this work, we are able to derive analytical predictions for the temporal fluctuations in a nonintegrable model (the transverse Ising chain with extra terms). Our results are based on identifying a dynamical regime of "many-particle dephasing," where quasiparticles do not yet relax but fluctuations are nonetheless suppressed exponentially by weak integrability breaking.

  20. Sensitivity analysis of time-dependent laminar flows

    International Nuclear Information System (INIS)

    Hristova, H.; Etienne, S.; Pelletier, D.; Borggaard, J.

    2004-01-01

    This paper presents a general sensitivity equation method (SEM) for time dependent incompressible laminar flows. The SEM accounts for complex parameter dependence and is suitable for a wide range of problems. The formulation is verified on a problem with a closed form solution obtained by the method of manufactured solution. Systematic grid convergence studies confirm the theoretical rates of convergence in both space and time. The methodology is then applied to pulsatile flow around a square cylinder. Computations show that the flow starts with symmetrical vortex shedding followed by a transition to the traditional Von Karman street (alternate vortex shedding). Simulations show that the transition phase manifests itself earlier in the sensitivity fields than in the flow field itself. Sensitivities are then demonstrated for fast evaluation of nearby flows and uncertainty analysis. (author)

  1. Incorporating excitation-induced dephasing into the Maxwell-Bloch numerical modeling of photon echoes

    International Nuclear Information System (INIS)

    Burr, G.W.; Harris, Todd L.; Babbitt, Wm. Randall; Jefferson, C. Michael

    2004-01-01

    We describe the incorporation of excitation-induced dephasing (EID) into the Maxwell-Bloch numerical simulation of photon echoes. At each time step of the usual numerical integration, stochastic frequency jumps of ions--caused by excitation of neighboring ions--is modeled by convolving each Bloch vector with the Bloch vectors of nearby frequency detunings. The width of this convolution kernel follows the instantaneous change in overall population, integrated over the simulated bandwidth. This approach is validated by extensive comparison against published and original experimental results. The enhanced numerical model is then used to investigate the accuracy of experiments designed to extrapolate to the intrinsic dephasing time T 2 from data taken in the presence of EID. Such a modeling capability offers improved understanding of experimental results, and should allow quantitative analysis of engineering tradeoffs in realistic optical coherent transient applications

  2. Quantum capacity of dephasing channels with memory

    International Nuclear Information System (INIS)

    D'Arrigo, A; Benenti, G; Falci, G

    2007-01-01

    We show that the amount of coherent quantum information that can be reliably transmitted down a dephasing channel with memory is maximized by separable input states. In particular, we model the channel as a Markov chain or a multimode environment of oscillators. While in the first model, the maximization is achieved for the maximally mixed input state, in the latter it is convenient to exploit the presence of a decoherence-protected subspace generated by memory effects. We explicitly compute the quantum channel capacity for the first model while numerical simulations suggest a lower bound for the latter. In both cases memory effects enhance the coherent information. We present results valid for arbitrary input size

  3. Large-eddy simulation of a bluff-body stabilised turbulent premixed flame using the transported flame surface density approach

    Science.gov (United States)

    Lee, Chin Yik; Cant, Stewart

    2017-07-01

    A premixed propane-air flame stabilised on a triangular bluff body in a model jet-engine afterburner configuration is investigated using large-eddy simulation (LES). The reaction rate source term for turbulent premixed combustion is closed using the transported flame surface density (TFSD) model. In this approach, there is no need to assume local equilibrium between the generation and destruction of subgrid FSD, as commonly done in simple algebraic closure models. Instead, the key processes that create and destroy FSD are accounted for explicitly. This allows the model to capture large-scale unsteady flame propagation in the presence of combustion instabilities, or in situations where the flame encounters progressive wrinkling with time. In this study, comprehensive validation of the numerical method is carried out. For the non-reacting flow, good agreement for both the time-averaged and root-mean-square velocity fields are obtained, and the Karman type vortex shedding behaviour seen in the experiment is well represented. For the reacting flow, two mesh configurations are used to investigate the sensitivity of the LES results to the numerical resolution. Profiles for the velocity and temperature fields exhibit good agreement with the experimental data for both the coarse and dense mesh. This demonstrates the capability of LES coupled with the TFSD approach in representing the highly unsteady premixed combustion observed in this configuration. The instantaneous flow pattern and turbulent flame behaviour are discussed, and the differences between the non-reacting and reacting flow are described through visualisation of vortical structures and their interaction with the flame. Lastly, the generation and destruction of FSD are evaluated by examining the individual terms in the FSD transport equation. Localised regions where straining, curvature and propagation are each dominant are observed, highlighting the importance of non-equilibrium effects of FSD generation and

  4. Production of high-quality electron bunches by dephasing and beam loading in channeled and unchanneled laser plasma accelerators

    International Nuclear Information System (INIS)

    Geddes, C.G.R.; Toth, Cs.; Tilborg, J. van; Esarey, E.; Schroeder, C.B.; Bruhwiler, D.; Nieter, C.; Cary, J.; Leemans, W.P.

    2005-01-01

    High-quality electron beams, with a few 10 9 electrons within a few percent of the same energy above 80 MeV, were produced in a laser wakefield accelerator by matching the acceleration length to the length over which electrons were accelerated and outran (dephased from) the wake. A plasma channel guided the drive laser over long distances, resulting in production of the high-energy, high-quality beams. Unchanneled experiments varying the length of the target plasma indicated that the high-quality bunches are produced near the dephasing length and demonstrated that channel guiding was more stable and efficient than relativistic self-guiding. Consistent with these data, particle-in-cell simulations indicate production of high-quality electron beams when trapping of an initial bunch of electrons suppresses further injection by loading the wake. The injected electron bunch is then compressed in energy by dephasing, when the front of the bunch begins to decelerate while the tail is still accelerated

  5. Time-resolved photoelectron spectrometry of a dephasing process in pyrazine

    International Nuclear Information System (INIS)

    Pavlov, R.L.; Pavlov, L.I.; Delchev, Ya.I.; Pavlova, S.I.

    2001-01-01

    The first femtosecond time-resolved photoelectron imaging (PEI) is presented. The method is characterized by photoionization of NO and further applied to ultrafast dephasing in pyrazine. Intermediate case behaviour in radiationless transition is clearly observed in time-resolved photoelectron kinetic energy distribution. Femtosecond PEI is with much improved efficiency than conventional photoelectron spectroscopies. It is anticipated that the unifield approach of time-resolved photoelectron and photoion imaging opens the possibility of observing photon-induced dynamics in real time

  6. Control quantum evolution speed of a single dephasing qubit for arbitrary initial states via periodic dynamical decoupling pulses.

    Science.gov (United States)

    Song, Ya-Ju; Tan, Qing-Shou; Kuang, Le-Man

    2017-03-08

    We investigate the possibility to control quantum evolution speed of a single dephasing qubit for arbitrary initial states by the use of periodic dynamical decoupling (PDD) pulses. It is indicated that the quantum speed limit time (QSLT) is determined by initial and final quantum coherence of the qubit, as well as the non-Markovianity of the system under consideration during the evolution when the qubit is subjected to a zero-temperature Ohmic-like dephasing reservoir. It is shown that final quantum coherence of the qubit and the non-Markovianity of the system can be modulated by PDD pulses. Our results show that for arbitrary initial states of the dephasing qubit with non-vanishing quantum coherence, PDD pulses can be used to induce potential acceleration of the quantum evolution in the short-time regime, while PDD pulses can lead to potential speedup and slow down in the long-time regime. We demonstrate that the effect of PDD on the QSLT for the Ohmic or sub-Ohmic spectrum (Markovian reservoir) is much different from that for the super-Ohmic spectrum (non-Markovian reservoir).

  7. Towards optimized suppression of dephasing in systems subject to pulse timing constraints

    International Nuclear Information System (INIS)

    Hodgson, Thomas E.; D'Amico, Irene; Viola, Lorenza

    2010-01-01

    We investigate the effectiveness of different dynamical decoupling protocols for storage of a single qubit in the presence of a purely dephasing bosonic bath, with emphasis on comparing quantum coherence preservation under uniform versus nonuniform delay times between pulses. In the limit of instantaneous bit-flip pulses, this is accomplished by establishing a different representation of the controlled qubit evolution, where the decoherence behavior after an arbitrary number of pulses is directly expressed in terms of the uncontrolled decoherence function. In particular, analytical expressions are obtained for approximation of the long- and short-term coherence behavior for both Ohmic and supra-Ohmic environments. By focusing on the realistic case of pure dephasing in an excitonic qubit, we quantitatively assess the impact of physical constraints on achievable pulse separations, and show that little advantage of high-level decoupling schemes based on concatenated or optimal design may be expected if pulses cannot be applied sufficiently fast. In such constrained scenarios, we demonstrate how simple modifications of repeated periodic-echo protocols can offer significantly improved coherence preservation in realistic parameter regimes. We expect similar conclusions to be relevant to other constrained qubit devices exposed to quantum or classical phase noise.

  8. Threshold for strong thermal dephasing in periodically poled KTP in external cavity frequency doubling

    DEFF Research Database (Denmark)

    Lundeman, Jesper Holm; Jensen, Ole Bjarlin; Andersen, Peter E.

    2009-01-01

    We present a measurement series of the efficiency of periodically poled KTP used for second-harmonic generation in an external phase-locked cavity. Due to the high absorption (0.01 cm^−1) in the PPKTP crystal at the pump wavelength a strong thermal dephasing of the periodically poled grating...

  9. Exceptionally slow rise in differential reflectivity spectra of excitons in GaN: effect of excitation-induced dephasing

    International Nuclear Information System (INIS)

    Stanton, C.J.; Kenrow, J.; El Sayed, K.; Jho, Y.D.; Kim, D.S.; Song, J.J.; Fischer, Arthur Joseph

    2004-01-01

    Femtosecond differential reflectivity spectroscopy (DRS) and four-wave mixing (FWM) experiments were performed simultaneously to study the initial temporal dynamics of the exciton line-shapes in GaN epilayers. Beats between the A-B excitons were found only for positive time delay in both DRS and FWM experiments. The rise time at negative time delay for the DRS was much slower than the FWM signal or differential transmission spectroscopy at the exciton resonance. A numerical solution of a six band semiconductor Bloch equation model including nonlinearities at the Hartree-Fock level shows that this slow rise in the DRS results from excitation induced dephasing, that is, the strong density dependence of the dephasing time which changes with the laser excitation energy.

  10. Phase-sensitive flow cytometer

    Energy Technology Data Exchange (ETDEWEB)

    Steinkamp, J.A.

    1992-12-31

    This report describes phase-sensitive flow cytometer (FCM) which provides additional FCM capability to use the fluorescence lifetime of one or more fluorochromes bound to single cells to provide additional information regarding the cells. The resulting fluorescence emission can be resolved into individual fluorescence signals if two fluorochromes are present or can be converted directly to a decay lifetime from a single fluorochrome. The excitation light for the fluorochromes is modulated to produce an amplitude modulated fluorescence pulse as the fluorochrome is excited in the FCM. The modulation signal also forms a reference signal that is phase-shifted a selected amount for subsequent mixing with the output modulated fluorescence intensity signal in phase-sensitive detection circuitry. The output from the phase-sensitive circuitry is then an individual resolved fluorochrome signal or a single fluorochrome decay lifetime, depending on the applied phase shifts.

  11. The Neopuff's PEEP valve is flow sensitive.

    LENUS (Irish Health Repository)

    Hawkes, Colin Patrick

    2011-03-01

    The current recommendation in setting up the Neopuff is to use a gas flow of 5-15 L\\/min. We investigated if the sensitivity of the positive end expiratory pressure (PEEP) valve varies at different flow rates within this range.

  12. Atomistic Galois insertions for flow sensitive integrity

    DEFF Research Database (Denmark)

    Nielson, Flemming; Nielson, Hanne Riis

    2017-01-01

    Several program verification techniques assist in showing that software adheres to the required security policies. Such policies may be sensitive to the flow of execution and the verification may be supported by combinations of type systems and Hoare logics. However, this requires user assistance...... and to obtain full automation we shall explore the over-approximating nature of static analysis. We demonstrate that the use of atomistic Galois insertions constitutes a stable framework in which to obtain sound and fully automatic enforcement of flow sensitive integrity. The framework is illustrated...

  13. Sensitivity Analysis for Steady State Groundwater Flow Using Adjoint Operators

    Science.gov (United States)

    Sykes, J. F.; Wilson, J. L.; Andrews, R. W.

    1985-03-01

    Adjoint sensitivity theory is currently being considered as a potential method for calculating the sensitivity of nuclear waste repository performance measures to the parameters of the system. For groundwater flow systems, performance measures of interest include piezometric heads in the vicinity of a waste site, velocities or travel time in aquifers, and mass discharge to biosphere points. The parameters include recharge-discharge rates, prescribed boundary heads or fluxes, formation thicknesses, and hydraulic conductivities. The derivative of a performance measure with respect to the system parameters is usually taken as a measure of sensitivity. To calculate sensitivities, adjoint sensitivity equations are formulated from the equations describing the primary problem. The solution of the primary problem and the adjoint sensitivity problem enables the determination of all of the required derivatives and hence related sensitivity coefficients. In this study, adjoint sensitivity theory is developed for equations of two-dimensional steady state flow in a confined aquifer. Both the primary flow equation and the adjoint sensitivity equation are solved using the Galerkin finite element method. The developed computer code is used to investigate the regional flow parameters of the Leadville Formation of the Paradox Basin in Utah. The results illustrate the sensitivity of calculated local heads to the boundary conditions. Alternatively, local velocity related performance measures are more sensitive to hydraulic conductivities.

  14. Exciton dephasing in single InGaAs quantum dots

    DEFF Research Database (Denmark)

    Leosson, Kristjan; Østergaard, John Erland; Jensen, Jacob Riis

    2000-01-01

    The homogeneous linewidth of excitonic transitions is a parameter of fundamental physical importance. In self-assembled quantum dot systems, a strong inhomogeneous broadening due to dot size fluctuations masks the homogeneous linewidth associated with transitions between individual states....... The homogeneous and inhomogeneous broadening of InGaAs quantum dot luminescence is of central importance for the potential application of this material system in optoelectronic devices. Recent measurements of MOCVD-grown InAs/InGaAs quantum dots indicate a large homogeneous broadening at room temperature due...... to fast dephasing. We present an investigation of the low-temperature homogeneous linewidth of individual PL lines from MBE-grown In0.5Ga0.5As/GaAs quantum dots....

  15. Vibrational frequencies and dephasing times in excited electronic states by femtosecond time-resolved four-wave mixing

    Science.gov (United States)

    Joo, Taiha; Albrecht, A. C.

    1993-06-01

    Time-resolved degenerate four-wave mixing (TRDFWM) for an electronically resonant system in a phase-matching configuration that measures population decay is reported. Because the spectral width of input light exceeds the vibrational Bohr frequency of a strong Raman active mode, the vibrational coherence produces strong oscillations in the TRDFWM signal together with the usual population decay from the excited electronic state. The data are analyzed in terms of a four-level system: ground and excited electronic states each split by a vibrational quantum of a Raman active mode. Absolute frequencies and their dephasing times of the vibrational modes at ≈590 cm -1 are obtained for the excited as well as the ground electronic state. The vibrational dephasing rate in the excited electronic state is about an order of magnitude faster than that in the ground state, the origin of which is speculated upon.

  16. Non-Markovian finite-temperature two-time correlation functions of system operators of a pure-dephasing model

    International Nuclear Information System (INIS)

    Goan, Hsi-Sheng; Jian, Chung-Chin; Chen, Po-Wen

    2010-01-01

    We evaluate the non-Markovian finite-temperature two-time correlation functions (CF's) of system operators of a pure-dephasing spin-boson model in two different ways, one by the direct exact operator technique and the other by the recently derived evolution equations, valid to second order in the system-environment interaction Hamiltonian. This pure-dephasing spin-boson model that is exactly solvable has been extensively studied as a simple decoherence model. However, its exact non-Markovian finite-temperature two-time system operator CF's, to our knowledge, have not been presented in the literature. This may be mainly due to the fact, illustrated in this article, that in contrast to the Markovian case, the time evolution of the reduced density matrix of the system (or the reduced quantum master equation) alone is not sufficient to calculate the two-time system operator CF's of non-Markovian open systems. The two-time CF's obtained using the recently derived evolution equations in the weak system-environment coupling case for this non-Markovian pure-dephasing model happen to be the same as those obtained from the exact evaluation. However, these results significantly differ from the non-Markovian two-time CF's obtained by wrongly directly applying the quantum regression theorem (QRT), a useful procedure to calculate the two-time CF's for weak-coupling Markovian open systems. This demonstrates clearly that the recently derived evolution equations generalize correctly the QRT to non-Markovian finite-temperature cases. It is believed that these evolution equations will have applications in many different branches of physics.

  17. Interaction and dephasing of center-of-mass quantized excitons in wide ZnSe/Zn0.94Mg0.06Se quantum wells

    DEFF Research Database (Denmark)

    Wagner, Hans Peter; Schätz, A.; Maier, R.

    1998-01-01

    We investigate the interaction and dephasing of the excitons in wide ZnSe/Zn0.94Mg0.06Se quantum wells by spectrally resolved, femtosecond four-wave mixing (FWM). Polarization-dependent measurements indicate that excitation-induced dephasing is the dominant FWM process. The biexcitons of the center...... repulsion for coherent excitons. The exciton interaction rates with acoustic and optical phonons are deduced by their temperature dependencies. The acoustic-phonon scattering is found to be strongly reduced in the investigated wide wells due to the reduced accessible phonon wave vector....

  18. Determining the nature of excitonic dephasing in high-quality GaN/AlGaN quantum wells through time-resolved and spectrally resolved four-wave mixing spectroscopy

    Science.gov (United States)

    Gallart, M.; Ziegler, M.; Crégut, O.; Feltin, E.; Carlin, J.-F.; Butté, R.; Grandjean, N.; Hönerlage, B.; Gilliot, P.

    2017-07-01

    Applying four-wave mixing spectroscopy to a high-quality GaN/AlGaN single quantum well, we report on the experimental determination of excitonic dephasing times at different temperatures and exciton densities in III-nitride heterostructures. By comparing the evolution with the temperature of the dephasing and the spin-relaxation rate, we conclude that both processes are related to the rate of excitonic collisions. When spin relaxation occurs in the motional-narrowing regime, it remains constant over a large temperature range as the spin-precession frequency increases linearly with temperature, hence compensating for the observed decrease in the dephasing time. From those measurements, a value of the electron-hole exchange interaction strength of 0.45 meV at T =10 K is inferred.

  19. Adjoint sensitivity theory for steady-state ground-water flow

    International Nuclear Information System (INIS)

    1983-11-01

    In this study, adjoint sensitivity theory is developed for equations of two-dimensional steady-state flow in a confined aquifer. Both the primary flow equation and the adjoint sensitivity equation are solved using the Galerkin finite element method. The developed computer code is used to investigate the regional flow parameters of the Leadville Formation of the Paradox Basin in Utah and the Wolcamp carbonate/sandstone aquifer of the Palo Duro Basin in the Texas Panhandle. Two performance measures are evaluated, local heads and velocity in the vicinity of potential high-level nuclear waste repositories. The results illustrate the sensitivity of calculated local heads to the boundary conditions. Local velocity-related performance measures are more sensitive to hydraulic conductivities. The uncertainty in the performance measure is a function of the parameter sensitivity, parameter variance and the correlation between parameters. Given a parameter covariance matrix, the uncertainty of the performance measure can be calculated. Although no results are presented here, the implications of uncertainty calculations for the two studies are discussed. 18 references, 25 figures

  20. CASH-FLOW SENSITIVITY TO PAYMENTS FOR MATERIAL RESSOURCES

    Directory of Open Access Journals (Sweden)

    Lavinia Elena BRÎNDESCU OLARIU

    2014-12-01

    Full Text Available The financing decision is taken based on the expectations concerning the future cash-flows generated in the operating activity, which should provide coverage for the debt service and allow for an increase of the shareholders’ wealth. Still, the future cash-flows are affected by risk, which makes the sensitivity analysis a very important part of the decision process. The current research sets to evaluate the sensitivity of the payment capacity to variations of the payments for raw materials and consumables. The study employs 391 forecasted yearly cash-flow statements collected from 50 companies together with detailed information concerning the hypotheses of the forecasts. The results of the study allow for the establishment of benchmarks for the payment capacity’s sensitivity, the determination of the mechanisms through which the variation of payments for raw materials and consumables impacts the payment capacity, as well as the identification of the possible causes of such a variation.

  1. Sensitivity quantification of remote detection NMR and MRI

    Science.gov (United States)

    Granwehr, J.; Seeley, J. A.

    2006-04-01

    A sensitivity analysis is presented of the remote detection NMR technique, which facilitates the spatial separation of encoding and detection of spin magnetization. Three different cases are considered: remote detection of a transient signal that must be encoded point-by-point like a free induction decay, remote detection of an experiment where the transient dimension is reduced to one data point like phase encoding in an imaging experiment, and time-of-flight (TOF) flow visualization. For all cases, the sensitivity enhancement is proportional to the relative sensitivity between the remote detector and the circuit that is used for encoding. It is shown for the case of an encoded transient signal that the sensitivity does not scale unfavorably with the number of encoded points compared to direct detection. Remote enhancement scales as the square root of the ratio of corresponding relaxation times in the two detection environments. Thus, remote detection especially increases the sensitivity of imaging experiments of porous materials with large susceptibility gradients, which cause a rapid dephasing of transverse spin magnetization. Finally, TOF remote detection, in which the detection volume is smaller than the encoded fluid volume, allows partial images corresponding to different time intervals between encoding and detection to be recorded. These partial images, which contain information about the fluid displacement, can be recorded, in an ideal case, with the same sensitivity as the full image detected in a single step with a larger coil.

  2. Time-Resolved Speckle Analysis: A New Approach to Coherence and Dephasing of Optical Excitations in Solids

    DEFF Research Database (Denmark)

    Langbein, Wolfgang Werner; Hvam, Jørn Märcher; Zimmermann, R.

    1999-01-01

    ). This method determines the decays of intensity and coherence separately, thus distinguishing lifetime from pure dephasing. The secondary emission of excitons in semiconductor quantum wells is investigated. Here the combination of static disorder and inelastic scattering leads to a partially coherent emission....... The temperature dependence is well explained by phonon scattering....

  3. The Neopuff's PEEP valve is flow sensitive.

    LENUS (Irish Health Repository)

    Hawkes, Colin Patrick

    2012-01-31

    AIM: The current recommendation in setting up the Neopuff is to use a gas flow of 5-15 L\\/min. We investigated if the sensitivity of the positive end expiratory pressure (PEEP) valve varies at different flow rates within this range. METHODS: Five Neopuffs were set up to provide a PEEP of 5 cm H(2) O. The number of clockwise revolutions to complete occlusion of the PEEP valve and the mean and range of pressures at each quarter clockwise revolution were recorded at gas flow rates between 5 and 15 L\\/min. Results: At 5, 10 and 15 L\\/min, 0.5, 1.7 and 3.4 full clockwise rotations were required to completely occlude the PEEP valve, and pressures rose from 5 to 11.4, 18.4 and 21.5 cm H(2) O, respectively. At a flow rate of 5 L\\/min, half a rotation of the PEEP dial resulted in a rise in PEEP from 5 to 11.4cm H(2) O. At 10 L\\/min, half a rotation resulted in a rise from 5 to 7.7cm H(2) O, and at 15 L\\/min PEEP rose from 5 to 6.8cm H(2) O. CONCLUSION: Users of the Neopuff should be aware that the PEEP valve is more sensitive at lower flow rates and that half a rotation of the dial at 5 L\\/min gas flow can more than double the PEEP.

  4. Interactions, Disorder and Dephasing in Superconducting Films and Quantum Hall Systems

    International Nuclear Information System (INIS)

    Auerbach, A.

    1999-01-01

    It is shown that a large class of two dimensional Superconductor to Insulator (SC-I), and (Quantum Hall to Insulator (QH-I) transitions can be understood by assuming that the thermodynamic transition in the clean system is first order. The finite correlation lengths at that transition yield a natural separation of the disorder into short and long wavelengths which are then straightforward to incorporate perturbatively and semi classically respectively. This approach reduces problems of disorder+interactions to puddle network models, whose studies have already yielded insight into experiments of QH-I and SC-I. For the CQH-I, the difference between Landauer-Buttiker and Boltzman theories highlights effects of dephasing

  5. Ultrafast Dephasing and Incoherent Light Photon Echoes in Organic Amorphous Systems

    Science.gov (United States)

    Yano, Ryuzi; Matsumoto, Yoshinori; Tani, Toshiro; Nakatsuka, Hiroki

    1989-10-01

    Incoherent light photon echoes were observed in organic amorphous systems (cresyl violet in polyvinyl alcohol and 1,4-dihydroxyanthraquinone in polymethacrylic acid) by using temporally-incoherent nanosecond laser pulses. It was found that an echo decay curve of an organic amorphous system is composed of a sharp peak which decays very rapidly and a slowly decaying wing at the tail. We show that the persistent hole burning (PHB) spectra were reproduced by the Fourier-cosine transforms of the echo decay curves. We claim that in general, we must take into account the multi-level feature of the system in order to explain ultrafast dephasing at very low temperatures.

  6. Temporal fluctuations after a quantum quench: Many-particle dephasing

    Science.gov (United States)

    Marquardt, Florian; Kiendl, Thomas

    After a quantum quench, the expectation values of observables continue to fluctuate in time. In the thermodynamic limit, one expects such fluctuations to decrease to zero, in order for standard statistical physics to hold. However, it is a challenge to determine analytically how the fluctuations decay as a function of system size. So far, there have been analytical predictions for integrable models (which are, naturally, somewhat special), analytical bounds for arbitrary systems, and numerical results for moderate-size systems. We have discovered a dynamical regime where the decrease of fluctuations is driven by many-particle dephasing, instead of a redistribution of occupation numbers. On the basis of this insight, we are able to provide exact analytical expressions for a model with weak integrability breaking (transverse Ising chain with additional terms). These predictions explicitly show how fluctuations are exponentially suppressed with system size.

  7. Electromagnetic holographic sensitivity field of two-phase flow in horizontal wells

    Science.gov (United States)

    Zhang, Kuo; Wu, Xi-Ling; Yan, Jing-Fu; Cai, Jia-Tie

    2017-03-01

    Electromagnetic holographic data are characterized by two modes, suggesting that image reconstruction requires a dual-mode sensitivity field as well. We analyze an electromagnetic holographic field based on tomography theory and Radon inverse transform to derive the expression of the electromagnetic holographic sensitivity field (EMHSF). Then, we apply the EMHSF calculated by using finite-element methods to flow simulations and holographic imaging. The results suggest that the EMHSF based on the partial derivative of radius of the complex electric potential φ is closely linked to the Radon inverse transform and encompasses the sensitivities of the amplitude and phase data. The flow images obtained with inversion using EMHSF better agree with the actual flow patterns. The EMHSF overcomes the limitations of traditional single-mode sensitivity fields.

  8. Quantum correlation of high dimensional system in a dephasing environment

    Science.gov (United States)

    Ji, Yinghua; Ke, Qiang; Hu, Juju

    2018-05-01

    For a high dimensional spin-S system embedded in a dephasing environment, we theoretically analyze the time evolutions of quantum correlation and entanglement via Frobenius norm and negativity. The quantum correlation dynamics can be considered as a function of the decoherence parameters, including the ratio between the system oscillator frequency ω0 and the reservoir cutoff frequency ωc , and the different environment temperature. It is shown that the quantum correlation can not only measure nonclassical correlation of the considered system, but also perform a better robustness against the dissipation. In addition, the decoherence presents the non-Markovian features and the quantum correlation freeze phenomenon. The former is much weaker than that in the sub-Ohmic or Ohmic thermal reservoir environment.

  9. Extended forward sensitivity analysis of one-dimensional isothermal flow

    International Nuclear Information System (INIS)

    Johnson, M.; Zhao, H.

    2013-01-01

    Sensitivity analysis and uncertainty quantification is an important part of nuclear safety analysis. In this work, forward sensitivity analysis is used to compute solution sensitivities on 1-D fluid flow equations typical of those found in system level codes. Time step sensitivity analysis is included as a method for determining the accumulated error from time discretization. The ability to quantify numerical error arising from the time discretization is a unique and important feature of this method. By knowing the relative sensitivity of time step with other physical parameters, the simulation is allowed to run at optimized time steps without affecting the confidence of the physical parameter sensitivity results. The time step forward sensitivity analysis method can also replace the traditional time step convergence studies that are a key part of code verification with much less computational cost. One well-defined benchmark problem with manufactured solutions is utilized to verify the method; another test isothermal flow problem is used to demonstrate the extended forward sensitivity analysis process. Through these sample problems, the paper shows the feasibility and potential of using the forward sensitivity analysis method to quantify uncertainty in input parameters and time step size for a 1-D system-level thermal-hydraulic safety code. (authors)

  10. Computational Study of pH-sensitive Hydrogel-based Microfluidic Flow Controllers

    Science.gov (United States)

    Kurnia, Jundika C.; Birgersson, Erik; Mujumdar, Arun S.

    2011-01-01

    This computational study investigates the sensing and actuating behavior of a pH-sensitive hydrogel-based microfluidic flow controller. This hydrogel-based flow controller has inherent advantage in its unique stimuli-sensitive properties, removing the need for an external power supply. The predicted swelling behavior the hydrogel is validated with steady-state and transient experiments. We then demonstrate how the model is implemented to study the sensing and actuating behavior of hydrogels for different microfluidic flow channel/hydrogel configurations: e.g., for flow in a T-junction with single and multiple hydrogels. In short, the results suggest that the response of the hydrogel-based flow controller is slow. Therefore, two strategies to improve the response rate of the hydrogels are proposed and demonstrated. Finally, we highlight that the model can be extended to include other stimuli-responsive hydrogels such as thermo-, electric-, and glucose-sensitive hydrogels. PMID:24956303

  11. Hole dephasing caused by hole-hole interaction in a multilayered black phosphorus.

    Science.gov (United States)

    Li, Lijun; Khan, Muhammad Atif; Lee, Yoontae; Lee, Inyeal; Yun, Sun Jin; Youn, Doo-Hyeb; Kim, Gil-Ho

    2017-11-01

    We study the magnetotransport of holes in a multilayered black phosphorus in a temperature range of 1.9 to 21.5 K. We observed a negative magnetoresistance at magnetic fields up to 1.5 T. This negative magetoresistance was analyzed by weak localization theory in diffusive regime. At the lowest temperature and the highest carrier density we found a phase coherence length of 48 nm. The linear temperature dependence of the dephasing rate shows that the hole-hole scattering processes with small energy transfer are the dominant contribution in breaking the carrier phase coherence.

  12. Reducing pure dephasing of quantum bits by collective encoding in quantum dot arrays

    International Nuclear Information System (INIS)

    Grodecka, A; Machnikowski, P; Jacak, L

    2006-01-01

    We show that phonon-induced pure dephasing of an excitonic (charge) quantum bit in a quantum dot (QD) may be reduced by collective encoding of logical qubits in QD arrays. We define the logical qubit on an array of 2, 4 and 8 QDs, connecting the logical 0) state with the presence of excitons in the appropriately chosen half of dots and the logical 1) state with the other half of the dots occupied. We give quantitative estimates of the resulting total error of a single qubit operation for an InAs/GaAs system

  13. Sensitivity Analysis of Unsteady Flow Fields and Impact of Measurement Strategy

    Directory of Open Access Journals (Sweden)

    Takashi Misaka

    2014-01-01

    Full Text Available Difficulty of data assimilation arises from a large difference between the sizes of a state vector to be determined, that is, the number of spatiotemporal mesh points of a discretized numerical model and a measurement vector, that is, the amount of measurement data. Flow variables on a large number of mesh points are hardly defined by spatiotemporally limited measurements, which poses an underdetermined problem. In this study we conduct the sensitivity analysis of two- and three-dimensional vortical flow fields within a framework of data assimilation. The impact of measurement strategy, which is evaluated by the sensitivity of the 4D-Var cost function with respect to measurements, is investigated to effectively determine a flow field by limited measurements. The assimilation experiment shows that the error defined by the difference between the reference and assimilated flow fields is reduced by using the sensitivity information to locate the limited number of measurement points. To conduct data assimilation for a long time period, the 4D-Var data assimilation and the sensitivity analysis are repeated with a short assimilation window.

  14. Improved sensitivity and limit-of-detection of lateral flow devices using spatial constrictions of the flow-path.

    Science.gov (United States)

    Katis, Ioannis N; He, Peijun J W; Eason, Robert W; Sones, Collin L

    2018-05-03

    We report on the use of a laser-direct write (LDW) technique that allows the fabrication of lateral flow devices with enhanced sensitivity and limit of detection. This manufacturing technique comprises the dispensing of a liquid photopolymer at specific regions of a nitrocellulose membrane and its subsequent photopolymerisation to create impermeable walls inside the volume of the membrane. These polymerised structures are intentionally designed to create fluidic channels which are constricted over a specific length that spans the test zone within which the sample interacts with pre-deposited reagents. Experiments were conducted to show how these constrictions alter the fluid flow rate and the test zone area within the constricted channel geometries. The slower flow rate and smaller test zone area result in the increased sensitivity and lowered limit of detection for these devices. We have quantified these via the improved performance of a C-Reactive Protein (CRP) sandwich assay on our lateral flow devices with constricted flow paths which demonstrate an improvement in its sensitivity by 62x and in its limit of detection by 30x when compared to a standard lateral flow CRP device. Crown Copyright © 2018. Published by Elsevier B.V. All rights reserved.

  15. Role of energy exchange in vibrational dephasing processes in liquids and solids

    International Nuclear Information System (INIS)

    Marks, S.

    1981-08-01

    Three theories which claim relevance to the dephasing of molecular vibrations in condensed phase matter are presented. All of these theories predict (in certain limiting cases) that the widths and shifts of molecular vibrations will obey an Arrhenius temperature dependence. The basic tenets of the theories are detailed so that the differences between them may be used in an experiment to distinguish between them. One model, based on intermolecular energy exchange of low-frequency modes, results in dephasing the high-frequency modes when anharmonic coupling is present. A computer analysis of temperature dependent experimental lineshapes can result in the extraction of various parameters such as the anharmonic shifts and the exchange rates. It is shown that, in order to properly assess the relative validity of the three models, other evidence must be obtained such as the spectral parameters of the low-frequency modes, the combination bands, and the isotopic dilution behavior. This evidence is presented for d 14 -durene (perdeutero-1,2,4,5-tetramethylbenzene) and compared to previous data obtained on pure h 14 -durene. An extension of the (HSC) intermolecular energy exchange model which allows for the possibility of partial delocalization of the low-frequency modes gives an adequate description of the experimental evidence. Isotopic dilution experiments, in particular, have resulted in a detailed picture of the energy transfer dynamics of the low-frequency modes. A section in which some spontaneous Raman spectra support a model of inhomogeneous broadening in liquids based on results of picosecond stimulated Raman spectroscopy is presented. The model is that a distribution of environmental sites is created by a distribution in the local density and thus creates inhomogeneous broadening

  16. Sensitivity of Regulated Flow Regimes to Climate Change in the Western United States

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Tian [Pacific Northwest National Laboratory, Richland, Washington; Voisin, Nathalie [Pacific Northwest National Laboratory, Richland, Washington; Leng, Guoyong [Pacific Northwest National Laboratory, Richland, Washington; Huang, Maoyi [Pacific Northwest National Laboratory, Richland, Washington; Kraucunas, Ian [Pacific Northwest National Laboratory, Richland, Washington

    2018-03-01

    Water management activities or flow regulations modify water fluxes at the land surface and affect water resources in space and time. We hypothesize that flow regulations change the sensitivity of river flow to climate change with respect to unmanaged water resources. Quantifying these changes in sensitivity could help elucidate the impacts of water management at different spatiotemporal scales and inform climate adaptation decisions. In this study, we compared the emergence of significant changes in natural and regulated river flow regimes across the Western United States from simulations driven by multiple climate models and scenarios. We find that significant climate change-induced alterations in natural flow do not cascade linearly through water management activities. At the annual time scale, 50% of the Hydrologic Unit Code 4 (HUC4) sub-basins over the Western U.S. regions tend to have regulated flow regime more sensitive to the climate change than natural flow regime. Seasonality analyses show that the sensitivity varies remarkably across the seasons. We also find that the sensitivity is related to the level of water management. For 35% of the HUC4 sub-basins with the highest level of water management, the summer and winter flows tend to show a heightened sensitivity to climate change due to the complexity of joint reservoir operations. We further demonstrate that the impacts of considering water management in models are comparable to those that arises from uncertainties across climate models and emission scenarios. This prompts further climate adaptation studies research about nonlinearity effects of climate change through water management activities.

  17. Contrast-enhanced three-dimensional MR angiography of neck vessels: does dephasing effect alter diagnostic accuracy?

    International Nuclear Information System (INIS)

    Cosottini, M.; Calabrese, R.; Murri, L.; Puglioli, M.; Zampa, V.; Michelassi, M.C.; Ortori, S.; Bartolozzi, C.

    2003-01-01

    The aim of this study was to evaluate diagnostic accuracy of contrast-enhanced MRA (CEMRA) compared with digital subtraction angiography (DSA) in studying neck vessels of 48 patients. In three groups of patients, we used three MRA protocols differing for voxel size to assess if intravoxel dephasing effects could modify accuracy of CEMRA. Accuracy and correlation with DSA results were calculated in all patients and separately in the three groups. A qualitative analysis of the likeness between morphology of the stenosis in CEMRA and DSA images was also assessed. In all patients accuracy and agreement with DSA were 96% and k=0.85 in subclavian arteries, 96% and k=0.84 in vertebral artery, 97% and k=0.88 in common carotid arteries, and 94% and k=0.86 in internal carotid arteries. In the three groups accuracy and agreement with DSA did not show any significant difference. Qualitative analysis of CEMRA and DSA images revealed a better agreement in depicting the morphology of stenosis using a smaller voxel size. The CEMRA represents a powerful tool for the non-invasive evaluation of neck vessels. Overestimation trend of CEMRA is confirmed and the reduction of voxel size, decreasing the dephasing intravoxel effect, allows to have a better overlapping of stenosis morphology on CEMRA compared with DSA, but it does not yield diagnostic gain in the stenosis grading. (orig.)

  18. Least Squares Shadowing Sensitivity Analysis of Chaotic Flow Around a Two-Dimensional Airfoil

    Science.gov (United States)

    Blonigan, Patrick J.; Wang, Qiqi; Nielsen, Eric J.; Diskin, Boris

    2016-01-01

    Gradient-based sensitivity analysis has proven to be an enabling technology for many applications, including design of aerospace vehicles. However, conventional sensitivity analysis methods break down when applied to long-time averages of chaotic systems. This breakdown is a serious limitation because many aerospace applications involve physical phenomena that exhibit chaotic dynamics, most notably high-resolution large-eddy and direct numerical simulations of turbulent aerodynamic flows. A recently proposed methodology, Least Squares Shadowing (LSS), avoids this breakdown and advances the state of the art in sensitivity analysis for chaotic flows. The first application of LSS to a chaotic flow simulated with a large-scale computational fluid dynamics solver is presented. The LSS sensitivity computed for this chaotic flow is verified and shown to be accurate, but the computational cost of the current LSS implementation is high.

  19. Oscillation and decay of particle current due to a quench and dephasing in an interacting fermionic system

    OpenAIRE

    Choo, Kenny; Bissbort, Ulf; Poletti, Dario

    2017-01-01

    We study the response of a particle current to dissipative dephasing in an interacting, few-body fermionic lattice system. The particles are prepared in the ground state in presence of an artificial magnetic gauge field, which is subsequently quenched to zero. The initial current decays non-trivially in the dissipative environment and we explore the emerging dynamics and its dependence on various system parameters.

  20. Acoustic phonon dephasing in shallow GaAs/Ga 1- xAl xAs single quantum wells

    Science.gov (United States)

    Cassabois, G.; Meccherini, S.; Roussignol, Ph.; Bogani, F.; Gurioli, M.; Colocci, M.; Planel, R.; Thierry-Mieg, V.

    1998-07-01

    The intermediate dimensionality regime is studied on a set of shallow GaAs/Ga 1- xAl xAs single quantum wells. Such heterostructures exhibit 2D strong excitonic electroabsorption together with near 3D fast transport properties. We report dephasing time measurements ( T2) of the heavy-hole exciton and we show that the acoustic phonon contribution decreases with x to a value in good agreement with theoretical predictions for GaAs bulk.

  1. Sensitivity Analysis of Transonic Flow over J-78 Wings

    Directory of Open Access Journals (Sweden)

    Alexander Kuzmin

    2015-01-01

    Full Text Available 3D transonic flow over swept and unswept wings with an J-78 airfoil at spanwise sections is studied numerically at negative and vanishing angles of attack. Solutions of the unsteady Reynolds-averaged Navier-Stokes equations are obtained with a finite-volume solver on unstructured meshes. The numerical simulation shows that adverse Mach numbers, at which the lift coefficient is highly sensitive to small perturbations, are larger than those obtained earlier for 2D flow. Due to the larger Mach numbers, there is an onset of self-exciting oscillations of shock waves on the wings. The swept wing exhibits a higher sensitivity to variations of the Mach number than the unswept one.

  2. Deterministic sensitivity analysis of two-phase flow systems: forward and adjoint methods. Final report

    International Nuclear Information System (INIS)

    Cacuci, D.G.

    1984-07-01

    This report presents a self-contained mathematical formalism for deterministic sensitivity analysis of two-phase flow systems, a detailed application to sensitivity analysis of the homogeneous equilibrium model of two-phase flow, and a representative application to sensitivity analysis of a model (simulating pump-trip-type accidents in BWRs) where a transition between single phase and two phase occurs. The rigor and generality of this sensitivity analysis formalism stem from the use of Gateaux (G-) differentials. This report highlights the major aspects of deterministic (forward and adjoint) sensitivity analysis, including derivation of the forward sensitivity equations, derivation of sensitivity expressions in terms of adjoint functions, explicit construction of the adjoint system satisfied by these adjoint functions, determination of the characteristics of this adjoint system, and demonstration that these characteristics are the same as those of the original quasilinear two-phase flow equations. This proves that whenever the original two-phase flow problem is solvable, the adjoint system is also solvable and, in principle, the same numerical methods can be used to solve both the original and adjoint equations

  3. Hypersonic Separated Flows About "Tick" Configurations With Sensitivity to Model Design

    Science.gov (United States)

    Moss, J. N.; O'Byrne, S.; Gai, S. L.

    2014-01-01

    This paper presents computational results obtained by applying the direct simulation Monte Carlo (DSMC) method for hypersonic nonequilibrium flow about "tick-shaped" model configurations. These test models produces a complex flow where the nonequilibrium and rarefied aspects of the flow are initially enhanced as the flow passes over an expansion surface, and then the flow encounters a compression surface that can induce flow separation. The resulting flow is such that meaningful numerical simulations must have the capability to account for a significant range of rarefaction effects; hence the application of the DSMC method in the current study as the flow spans several flow regimes, including transitional, slip, and continuum. The current focus is to examine the sensitivity of both the model surface response (heating, friction and pressure) and flowfield structure to assumptions regarding surface boundary conditions and more extensively the impact of model design as influenced by leading edge configuration as well as the geometrical features of the expansion and compression surfaces. Numerical results indicate a strong sensitivity to both the extent of the leading edge sharpness and the magnitude of the leading edge bevel angle. Also, the length of the expansion surface for a fixed compression surface has a significant impact on the extent of separated flow.

  4. Increased flow sensitivity from gradient recalled echoes and short TRs

    International Nuclear Information System (INIS)

    Hearshen, D.O.; Froelich, J.W.; Wehrli, F.W.; Haggar, A.M.; Shimakawa, A.

    1986-01-01

    Time-of-flight effects from flow have been characterized in spin-echo images. ''Paradoxical'' enhancement and flow void are observed. Similar enhancement is seen on GRASS images. With no flow void and gradients existing throughout the volume, spins experiencing radio-frequency pulses will give rise to signals even for fast flow, providing a greater velocity sensitivity. GRASS images were obtained from a volunteer with a blood pressure cuff placed over the right thigh. With the cuff inflated, flow in the popliteal vein results in signal saturation. Increasing TR increases intensity in the popliteal vein relative to other vessels. This suggests a clinical role for the technique in assessment of slow flow

  5. Sensitivity to draught in turbulent air flows

    Energy Technology Data Exchange (ETDEWEB)

    Todde, V

    1998-09-01

    Even though the ventilation system is designed to supply air flows at constant low velocity and controlled temperature, the resulting air movement in rooms is strongly characterised by random fluctuations. When an air flow is supplied from an inlet, a shear layer forms between the incoming and the standstill air in the room, and large scale vortices develops by coalescence of the vorticity shed at the inlet of the air supply. After a characteristically downstream distance, large scale vortices loose their identity because of the development of cascading eddies and transition to turbulence. The interaction of these vortical structures will rise a complicated three dimensional air movement affected by fluctuations whose frequencies could vary from fractions of Hz to several KHz. The perception and sensitivity to the cooling effect enhanced by these air movements depend on a number of factors interacting with each other: physical properties of the air flow, part and extension of the skin surface exposed to the air flow, exposure duration, global thermal condition, gender and posture of the person. Earlier studies were concerned with the percentage of dissatisfied subjects as a function of air velocity and temperature. Recently, experimental observations have shown that also the fluctuations, the turbulence intensity and the direction of air velocity have an important impact on draught discomfort. Two experimental investigations have been developed to observe the human reaction to horizontal air movements on bared skin surfaces, hands and neck. Attention was concentrated on the effects of relative turbulence intensity of air velocity and exposure duration on perception and sensitivity to the air movement. The air jet flows, adopted for the draught experiment in the neck, were also the object of an experimental study. This experiment was designed to observe the centre-line velocity of an isothermal circular air jet, as a function of the velocity properties at the outlet

  6. Dephasing of LO-phonon-plasmon hybrid modes in n-type GaAs

    Science.gov (United States)

    Vallée, F.; Ganikhanov, F.; Bogani, F.

    1997-11-01

    The relaxation dynamics of coherent phononlike LO-phonon-plasmon hybrid modes is investigated in n-doped GaAs using an infrared time-resolved coherent anti-Stokes Raman scattering technique. Measurements performed for different crystal temperatures in the range 10-300 K as a function of the electron density injected by doping show a large reduction of the hybrid mode dephasing time compared to the bare LO-phonon one for densities larger than 1016 cm-3. The results are interpreted in terms of coherent decay of the LO-phonon-plasmon mixed mode in the weak-coupling regime and yield information on the plasmon and electron relaxation. The estimated average electron momentum relaxation times are smaller than those deduced from Hall mobility measurements, as expected from our theoretical model.

  7. General solution to inhomogeneous dephasing and smooth pulse dynamical decoupling

    Science.gov (United States)

    Zeng, Junkai; Deng, Xiu-Hao; Russo, Antonio; Barnes, Edwin

    2018-03-01

    In order to achieve the high-fidelity quantum control needed for a broad range of quantum information technologies, reducing the effects of noise and system inhomogeneities is an essential task. It is well known that a system can be decoupled from noise or made insensitive to inhomogeneous dephasing dynamically by using carefully designed pulse sequences based on square or delta-function waveforms such as Hahn spin echo or CPMG. However, such ideal pulses are often challenging to implement experimentally with high fidelity. Here, we uncover a new geometrical framework for visualizing all possible driving fields, which enables one to generate an unlimited number of smooth, experimentally feasible pulses that perform dynamical decoupling or dynamically corrected gates to arbitrarily high order. We demonstrate that this scheme can significantly enhance the fidelity of single-qubit operations in the presence of noise and when realistic limitations on pulse rise times and amplitudes are taken into account.

  8. Dynamics of electronic dephasing in the Fenna-Matthews-Olson complex

    International Nuclear Information System (INIS)

    Hayes, Dugan; Panitchayangkoon, Gitt; Fransted, Kelly A; Caram, Justin R; Freed, Karl F; Engel, Gregory S; Wen Jianzhong

    2010-01-01

    Electronic coherence has been shown to persist in the Fenna-Matthews-Olson (FMO) antenna complex from green sulfur bacteria at 77 K for at least 660 fs, several times longer than the typical lifetime of a coherence in a dynamic environment at this temperature. Such long-lived coherence was proposed to improve energy transfer efficiency in photosynthetic systems by allowing an excitation to follow a quantum random walk as it approaches the reaction centre. Here we present a model for bath-induced electronic transitions, demonstrating that the protein matrix protects coherences by globally correlating fluctuations in transition energies. We also quantify the dephasing rates for two particular electronic coherences in the FMO complex at 77 K using two-dimensional Fourier transform electronic spectroscopy and find that the lifetimes of individual coherences are distinct. Within the framework of noise-assisted transport, this result suggests that the FMO complex has been locally tuned by natural selection to optimize transfer efficiency by exploiting quantum coherence.

  9. Sensitivity Analysis of Unsaturated Flow and Contaminant Transport with Correlated Parameters

    Science.gov (United States)

    Relative contributions from uncertainties in input parameters to the predictive uncertainties in unsaturated flow and contaminant transport are investigated in this study. The objectives are to: (1) examine the effects of input parameter correlations on the sensitivity of unsaturated flow and conta...

  10. Sensitivity of mitochondria of the mouse liver cells to radiation

    Energy Technology Data Exchange (ETDEWEB)

    Shima, A [Tokyo Univ. (Japan). Faculty of Science

    1974-06-01

    In order to study the sensitivity of mitochondria (Mt) of the liver cells to radiation, 0.4 mg of riboflavine (RF) was intraperitoneally injected into mice which had been fed RF deficient food for 13 weeks. Three hours later 400 R of X-ray (190 KVP, 25 mA, 0.5 mmCu, 0.5 mmAl filter, FSD 61.5 cm, and HVL 0.80 mmCu) were irradiated to the whole body, and giant Mt of the liver cells were observed. When the liver cells were observed 24 hours after injection, neither giant Mt nor mitotic findings of Mt were found. All Mt observed were small (1.2 ..mu..), although mice received 400 R of X-ray.

  11. Investment cash flow sensitivity and financing constraints : New evidence from Indian business group firms

    NARCIS (Netherlands)

    George, R.; Kabir, Mohammed Rezaul; Qian, J.

    2011-01-01

    A controversy exists on the use of the investment–cash flow sensitivity as a measure of financing constraints of firms.Were-examine this controversy by analyzing firms affiliated to Indian business groups. We find a strong investment–cash flow sensitivity for both group-affiliated and independent

  12. Suppressed spin dephasing for two-dimensional and bulk electrons in GaAs wires due to engineered cancellation of spin-orbit interaction terms

    NARCIS (Netherlands)

    Denega, S.Z.; Last, Thorsten; Liu, J.; Slachter, A.; Rizo, P.J.; Loosdrecht, P.H.M. van; Wees, B.J. van; Reuter, D.; Wieck, A.D.; Wal, C.H. van der

    2010-01-01

    We report a study of suppressed spin dephasing for quasi-one-dimensional electron ensembles in wires etched into a GaAs/AlGaAs heterojunction system. Time-resolved Kerr-rotation measurements show a suppression that is most pronounced for wires along the [110] crystal direction. This is the

  13. Interfacing of differential-capacitive biomimetic hair flow-sensors for optimal sensitivity

    International Nuclear Information System (INIS)

    + Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" data-affiliation=" (Transducers Science and Technology Group, MESA+ Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" >Dagamseh, A M K; + Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" data-affiliation=" (Transducers Science and Technology Group, MESA+ Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" >Bruinink, C M; + Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" data-affiliation=" (Transducers Science and Technology Group, MESA+ Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" >Wiegerink, R J; + Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" data-affiliation=" (Transducers Science and Technology Group, MESA+ Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" >Lammerink, T S J; + Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" data-affiliation=" (Transducers Science and Technology Group, MESA+ Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" >Droogendijk, H; + Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" data-affiliation=" (Transducers Science and Technology Group, MESA+ Research Institute, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands))" >Krijnen, G J M

    2013-01-01

    Biologically inspired sensor-designs are investigated as a possible path to surpass the performance of more traditionally engineered designs. Inspired by crickets, artificial hair sensors have shown the ability to detect minute flow signals. This paper addresses developments in the design, fabrication, interfacing and characterization of biomimetic hair flow-sensors towards sensitive high-density arrays. Improvement of the electrode design of the hair sensors has resulted in a reduction of the smallest hair movements that can be measured. In comparison to the arrayed hairs-sensor design, the detection-limit was arguably improved at least twelve-fold, down to 1 mm s –1 airflow amplitude at 250 Hz as measured in a bandwidth of 3 kHz. The directivity pattern closely resembles a figure-of-eight. These sensitive hair-sensors open possibilities for high-resolution spatio-temporal flow pattern observations. (paper)

  14. Rainfall Variability and Landuse Conversion Impacts to Sensitivity of Citarum River Flow

    Directory of Open Access Journals (Sweden)

    Dyah Marganingrum

    2013-07-01

    Full Text Available The objective of this study is to determine the sensitivity of Citarum river flow to climate change and land conversion. It will provide the flow information that required in the water resources sustainability. Saguling reservoir is one of the strategic reservoirs, which 75% water is coming from the inflow of Upper Citarum measured at Nanjung station. Climate variability was identified as rainfall variability. Sensitivity was calculated as the elasticity value of discharge using three-variate model of statistical approach. The landuse conversion was calculated used GIS at 1994 and 2004. The results showed that elasticity at the Nanjung station and Saguling station decreased from 1.59 and 1.02 to 0.68 and 0.62 respectively. The decreasing occurred in the before the dam was built period (1950-1980 to the after reservoirs operated period (1986-2008. This value indicates that: 1 Citarum river flow is more sensitive to rainfall variability that recorded at Nanjung station than Saguling station, 2 rainfall character is more difficult to predict. The landuse analysis shows that forest area decrease to ± 27% and built up area increased to ± 26%. Those implied a minimum rainfall reduction to± 8% and minimum flow to ± 46%. Those were caused by land conversion and describing that the vegetation have function to maintain the base flow for sustainable water resource infrastructure.

  15. Detector for the FSD Fourier-diffractometer based on ZnS(Ag)/6LiF scintillation screen and wavelength shifting fibers readout

    International Nuclear Information System (INIS)

    Kuz'min, E.S.; Balagurov, A.M.; Bokuchava, G.D.; Zhuk, V.V.; Kudryashev, V.A.; Bulkin, A.P.; Trunov, V.A.

    2001-01-01

    At the IBR-2 pulsed reactor (FLNP, JINR, Dubna), a specialized time-of-flight instrument Fourier-Stress-Diffractometer (FSD) intended for the measurement of internal stresses in bulk samples by using high-resolution neutron diffraction is under construction. One of the main components of the diffractometer is a new-type detector with combined electronic - geometrical focusing uniting a large solid angle and a small geometry contribution to the instrumental resolution. The first two modules of the detector, based on scintillation screen ZnS(Ag)/ 6 LiF with wavelength shifting fibers readout have been developed and tested. The design of the detector and associated electronics are described. The method of time focusing surface approximation, using the screen flexibility is proposed. Characteristics of the tested modules in comparison with a detector of the previous generation are presented and advantages of the new detector design for high-resolution diffractometry are discussed

  16. Sensitivity of mitochondria of the mouse liver cells to radiation

    International Nuclear Information System (INIS)

    Shima, Akihiro

    1974-01-01

    In order to study the sensitivity of mitochondria (Mt) of the liver cells to radiation, 0.4 mg of riboflavine (RF) was intraperitoneally injected into mice which had been fed RF deficient food for 13 weeks. Three hours later 400 R of X-ray (190 KVP, 25 mA, 0.5 mmCu, 0.5 mmAl filter, FSD 61.5 cm, and HVL 0.80 mmCu) were irradiated to the whole body, and giant Mt of the liver cells were observed. When the liver cells were observed 24 hours after injection, neither giant Mt nor mitotic findings of Mt were found. All Mt observed were small (1.2 μ), although mice received 400 R of X-ray. (Serizawa, K.)

  17. Identification of contact and respiratory sensitizers using flow cytometry

    International Nuclear Information System (INIS)

    Goutet, Michele; Pepin, Elsa; Langonne, Isabelle; Huguet, Nelly; Ban, Masarin

    2005-01-01

    Identification of the chemicals responsible for respiratory and contact allergies in the industrial area is an important occupational safety issue. This study was conducted in mice to determine whether flow cytometry is an appropriate method to analyze and differentiate the specific immune responses to the respiratory sensitizer trimellitic anhydride (TMA) and to the contact sensitizer dinitrochlorobenzene (DNCB) used at concentrations with comparable immunogenic potential. Mice were exposed twice on the flanks (days 0, 5) to 10% TMA or 1% DNCB and challenged three times on the ears (days 10, 11, 12) with 2.5% TMA or 0.25% DNCB. Flow cytometry analyses were conducted on draining lymph node cells harvested on days 13 and 18. Comparing TMA and DNCB immune responses on day 13, we found obvious differences that persisted for most of them on day 18. An increased proportion of IgE+ cells correlated to total serum IgE level and an enhancement of MHC II molecule expression were observed in the lymph node B lymphocytes from TMA-treated mice. The percentage of IL-4-producing CD4+ lymphocytes and the IL-4 receptor expression were clearly higher following TMA exposure. In contrast, higher proportions of IL-2-producing cells were detected in CD4+ and CD8+ cells from DNCB-treated mice. Both chemicals induced a significant increase in the percentage of IFN-γ-producing cells among CD8+ lymphocytes but to a greater proportion following TMA treatment. In conclusion, this study encourages the use of flow cytometry to discriminate between contact and respiratory sensitizers by identifying divergent expression of immune response parameters

  18. Critical test of vibrational dephasing theories in solids using spontaneous Raman scattering in isotopically mixed crystals

    International Nuclear Information System (INIS)

    Marks, S.; Cornelius, P.A.; Harris, C.B.

    1980-01-01

    A series of experiments have been conducted in order to evaluate the relative importance of several recent theories of vibrational dephasing in solids. The theories are discussed briefly, and are used to interpret the temperature dependence of the C--H and C--D stretch bands in the spontaneous Raman spectra of h 14 - and d 14 -1,2,4,5-tetramethyl benzene (durene). The infrared spectra of these same molecules are also reported in the region of the combination bands involving C--H (or C--D) stretches and low-frequency modes. The results support the applicability of the model of Harris et al., [C. B. Harris, R. M. Shelby and P. A. Cornelius, Phys. Rev. Lett. 38, 1415 (1977); Chem Phys. Lett. 57, 8 (1978); R. M. Shelby, C. B. Harris, and P. A. Cornelius, J. Chem. Phys. 70, 34 (1979)], based on energy exchange in anharmonically coupled low-frequency modes. This theory is then used, in connection with Raman spectra obtained in isotopically mixed samples of durene, to elucidate the vibrational dynamics underlying the dephasing. It is found that the results are consistent with the hypothesis that some low-frequency modes in this molecule are significantly delocalized or ''excitonic'' in character, and that this delocalization may be studied by means of Raman spectroscopy on the low-frequency modes themselves, as well as by exchange analysis of the coupled high-frequency modes. These conclusions represent a generalization and extension of the previously published exchange model [R. M. Shelby, C. B. Harris, and P. A. Cornelius, J. Chem Phys. 70, 34 (1979)

  19. The source of investment cash flow sensitivity in manufacturing firms: Is it asymmetric information or agency costs?

    Directory of Open Access Journals (Sweden)

    Daniel Makina

    2016-09-01

    Full Text Available In the literature, positive investment cash flow sensitivity is attributed to either asymmetric information induced financing constraints or the agency costs of free cash flow. Using data from a sample of 68 manufacturing firms listed on the South African JSE, this paper contributes to the literature by investigating the source of investment cash flow sensitivity. We have found that asymmetric information explains the positive investment cash flow sensitivity better than agency costs. Furthermore, asymmetric information has been observed to be more pronounced in low-dividend-paying firms and small firms. Despite South Africa’s having a developed financial system by international standards, small firms are seen to be financially constrained. We attribute the absence of investment cash flow sensitivity due to agency costs to good corporate governance of South African listed firms. Thus the paper provides further evidence in support of the proposition in the literature that the source of investment cash flow sensitivity may depend on the institutional setting of a country, such as its corporate governance.

  20. Microscopic theory of multiple-phonon-mediated dephasing and relaxation of quantum dots near a photonic band gap

    Science.gov (United States)

    Roy, Chiranjeeb; John, Sajeev

    2010-02-01

    We derive a quantum theory of the role of acoustic and optical phonons in modifying the optical absorption line shape, polarization dynamics, and population dynamics of a two-level atom (quantum dot) in the “colored” electromagnetic vacuum of a photonic band-gap (PBG) material. This is based on a microscopic Hamiltonian describing both radiative and vibrational processes quantum mechanically. We elucidate the extent to which phonon-assisted decay limits the lifetime of a single photon-atom bound state and derive the modified spontaneous emission dynamics due to coupling to various phonon baths. We demonstrate that coherent interaction with undamped phonons can lead to an enhanced lifetime of a photon-atom bound state in a PBG. This results in reduction of the steady-state atomic polarization but an increase in the fractionalized upper state population in the photon-atom bound state. We demonstrate, on the other hand, that the lifetime of the photon-atom bound state in a PBG is limited by the lifetime of phonons due to lattice anharmonicities (breakup of phonons into lower energy phonons) and purely nonradiative decay. We also derive the modified polarization decay and dephasing rates in the presence of such damping. This leads to a microscopic, quantum theory of the optical absorption line shapes. Our model and formalism provide a starting point for describing dephasing and relaxation in the presence of external coherent fields and multiple quantum dot interactions in electromagnetic reservoirs with radiative memory effects.

  1. Microscopic theory of multiple-phonon-mediated dephasing and relaxation of quantum dots near a photonic band gap

    International Nuclear Information System (INIS)

    Roy, Chiranjeeb; John, Sajeev

    2010-01-01

    We derive a quantum theory of the role of acoustic and optical phonons in modifying the optical absorption line shape, polarization dynamics, and population dynamics of a two-level atom (quantum dot) in the ''colored'' electromagnetic vacuum of a photonic band-gap (PBG) material. This is based on a microscopic Hamiltonian describing both radiative and vibrational processes quantum mechanically. We elucidate the extent to which phonon-assisted decay limits the lifetime of a single photon-atom bound state and derive the modified spontaneous emission dynamics due to coupling to various phonon baths. We demonstrate that coherent interaction with undamped phonons can lead to an enhanced lifetime of a photon-atom bound state in a PBG. This results in reduction of the steady-state atomic polarization but an increase in the fractionalized upper state population in the photon-atom bound state. We demonstrate, on the other hand, that the lifetime of the photon-atom bound state in a PBG is limited by the lifetime of phonons due to lattice anharmonicities (breakup of phonons into lower energy phonons) and purely nonradiative decay. We also derive the modified polarization decay and dephasing rates in the presence of such damping. This leads to a microscopic, quantum theory of the optical absorption line shapes. Our model and formalism provide a starting point for describing dephasing and relaxation in the presence of external coherent fields and multiple quantum dot interactions in electromagnetic reservoirs with radiative memory effects.

  2. Pressure-sensitive paint on a truncated cone in hypersonic flow at incidences

    International Nuclear Information System (INIS)

    Yang, L.; Erdem, E.; Zare-Behtash, H.; Kontis, K.; Saravanan, S.

    2012-01-01

    Highlights: ► Global pressure map over the truncated cone is obtained at various incidence angles in Mach 5 flow. ► Successful application of AA-PSP in hypersonic flow expands operation area of this technique. ► AA-PSP reveals complex three-dimensional pattern which is difficult for transducer to obtain. ► Quantitative data provides strong correlation with colour Schlieren and oil flow results. ► High spatial resolution pressure mappings identify small scale vortices and flow separation. - Abstract: The flow over a truncated cone is a classical and fundamental problem for aerodynamic research due to its three-dimensional and complicated characteristics. The flow is made more complex when examining high angles of incidence. Recently these types of flows have drawn more attention for the purposes of drag reduction in supersonic/hypersonic flows. In the present study the flow over a truncated cone at various incidences was experimentally investigated in a Mach 5 flow with a unit Reynolds number of 13.5 × 10 6 m −1 . The cone semi-apex angle is 15° and the truncation ratio (truncated length/cone length) is 0.5. The incidence of the model varied from −12° to 12° with 3° intervals relative to the freestream direction. The external flow around the truncated cone was visualised by colour Schlieren photography, while the surface flow pattern was revealed using the oil flow method. The surface pressure distribution was measured using the anodized aluminium pressure-sensitive paint (AA-PSP) technique. Both top and sideviews of the pressure distribution on the model surface were acquired at various incidences. AA-PSP showed high pressure sensitivity and captured the complicated flow structures which correlated well with the colour Schlieren and oil flow visualisation results.

  3. Dephasing due to Nuclear Spins in Large-Amplitude Electric Dipole Spin Resonance.

    Science.gov (United States)

    Chesi, Stefano; Yang, Li-Ping; Loss, Daniel

    2016-02-12

    We analyze effects of the hyperfine interaction on electric dipole spin resonance when the amplitude of the quantum-dot motion becomes comparable or larger than the quantum dot's size. Away from the well-known small-drive regime, the important role played by transverse nuclear fluctuations leads to a Gaussian decay with characteristic dependence on drive strength and detuning. A characterization of spin-flip gate fidelity, in the presence of such additional drive-dependent dephasing, shows that vanishingly small errors can still be achieved at sufficiently large amplitudes. Based on our theory, we analyze recent electric dipole spin resonance experiments relying on spin-orbit interactions or the slanting field of a micromagnet. We find that such experiments are already in a regime with significant effects of transverse nuclear fluctuations and the form of decay of the Rabi oscillations can be reproduced well by our theory.

  4. Investment cash flow sensitivity under managerial optimism: new evidence from NYSE panel data firms

    OpenAIRE

    Mohamed, Ezzeddine Ben; Fairchild, Richard; Bouri, Abdelfettah

    2014-01-01

    Investment cash flow sensitivity constitutes one important block of the corporate financial literature. While it is well documented in standard corporate finance, it is still young under behavioral corporate finance. In this paper, we test the investment cash flow sensitivity among panel data of American industrial firms during 1999-2010. Using Q-model of investment (Tobin, 1969), we construct and introduce a proxy of managerial optimism following Malmendier and Tate (2005a) to show the impac...

  5. Shear layer flame stabilization sensitivities in a swirling flow

    Directory of Open Access Journals (Sweden)

    Christopher Foley

    2017-03-01

    Full Text Available A variety of different flame configurations and heat release distributions exist in high swirl, annular flows, due to the existence of inner and outer shear layers as well a vortex breakdown bubble. Each of these different configurations, in turn, has different thermoacoustic sensitivities and influences on combustor emissions, nozzle durability, and liner heating. This paper presents findings on the sensitivities of the outer shear layer- stabilized flames to a range of parameters, including equivalence ratio, bulkhead temperature, flow velocity, and preheat temperature. There is significant hysteresis for flame attachment/detachment from the outer shear layer and this hysteresis is also described. Results are also correlated with extinction stretch rate calculations based on detailed kinetic simulations. In addition, we show that the bulkhead temperature near the flame attachment point has significant impact on outer shear layer detachment. This indicates that understanding the heat transfer between the edge flame stabilized in the shear layer and the nozzle hardware is needed in order to predict shear layer flame stabilization limits. Moreover, it shows that simulations cannot simply assume adiabatic boundary conditions if they are to capture these transitions. We also show that the reference temperature for correlating these transitions is quite different for attachment and local blow off. Finally, these results highlight the deficiencies in current understanding of the influence of fluid mechanic parameters (e.g. velocity, swirl number on shear layer flame attachment. For example, they show that the seemingly simple matter of scaling flame transition points with changes in flow velocities is not understood.

  6. Is Investment-Cash Flow Sensitivity Caused by the Agency Costs or Asymmetric Information? Evidence from the UK

    NARCIS (Netherlands)

    Pawlina, G.; Renneboog, L.D.R.

    2005-01-01

    We investigate the investment-cash flow sensitivity of a large sample of the UK listed firms and confirm that investment is strongly cash flow-sensitive.Is this suboptimal investment policy the result of agency problems when managers with high discretion overinvest, or of asymmetric information when

  7. Robustness analysis of complex networks with power decentralization strategy via flow-sensitive centrality against cascading failures

    Science.gov (United States)

    Guo, Wenzhang; Wang, Hao; Wu, Zhengping

    2018-03-01

    Most existing cascading failure mitigation strategy of power grids based on complex network ignores the impact of electrical characteristics on dynamic performance. In this paper, the robustness of the power grid under a power decentralization strategy is analysed through cascading failure simulation based on AC flow theory. The flow-sensitive (FS) centrality is introduced by integrating topological features and electrical properties to help determine the siting of the generation nodes. The simulation results of the IEEE-bus systems show that the flow-sensitive centrality method is a more stable and accurate approach and can enhance the robustness of the network remarkably. Through the study of the optimal flow-sensitive centrality selection for different networks, we find that the robustness of the network with obvious small-world effect depends more on contribution of the generation nodes detected by community structure, otherwise, contribution of the generation nodes with important influence on power flow is more critical. In addition, community structure plays a significant role in balancing the power flow distribution and further slowing the propagation of failures. These results are useful in power grid planning and cascading failure prevention.

  8. Recombinant VSV G proteins reveal a novel raft-dependent endocytic pathway in resorbing osteoclasts

    International Nuclear Information System (INIS)

    Mulari, Mika T.K.; Nars, Martin; Laitala-Leinonen, Tiina; Kaisto, Tuula; Metsikkoe, Kalervo; Sun Yi; Vaeaenaenen, H. Kalervo

    2008-01-01

    Transcytotic membrane flow delivers degraded bone fragments from the ruffled border to the functional secretory domain, FSD, in bone resorbing osteoclasts. Here we show that there is also a FSD-to-ruffled border trafficking pathway that compensates for the membrane loss during the matrix uptake process and that rafts are essential for this ruffled border-targeted endosomal pathway. Replacing the cytoplasmic tail of the vesicular stomatitis virus G protein with that of CD4 resulted in partial insolubility in Triton X-100 and retargeting from the peripheral non-bone facing plasma membrane to the FSD. Recombinant G proteins were subsequently endosytosed and delivered from the FSD to the peripheral fusion zone of the ruffled border, which were both rich in lipid rafts as suggested by viral protein transport analysis and visualizing the rafts with fluorescent recombinant cholera toxin. Cholesterol depletion by methyl-β-cyclodextrin impaired the ruffled border-targeted vesicle trafficking pathway and inhibited bone resorption dose-dependently as quantified by measuring the CTX and TRACP 5b secreted to the culture medium and by measuring the resorbed area visualized with a bi-phasic labeling method using sulpho-NHS-biotin and WGA-lectin. Thus, rafts are vital for membrane recycling from the FSD to the late endosomal/lysosomal ruffled border and bone resorption

  9. Transient simulation and sensitivity analysis for transport of radionuclides in a saturated-unsaturated groundwater flow system

    International Nuclear Information System (INIS)

    Chen, H.H.

    1980-01-01

    Radionuclide transport by groundwater flow is an important pathway in the assessment of the environmental impact of radioactive waste disposal to the biosphere. A numerical model was developed to simulate radionuclide transport by groundwater flow and predict the radionuclide discharge rate to the biosphere. A sensitivity analysis methodology was developed to address the sensitivity of the input parameters of the radionuclide transport equation to the specified response of interest

  10. Integrated Cantilever-Based Flow Sensors with Tunable Sensitivity for In-Line Monitoring of Flow Fluctuations in Microfluidic Systems

    Directory of Open Access Journals (Sweden)

    Nadine Noeth

    2013-12-01

    Full Text Available For devices such as bio-/chemical sensors in microfluidic systems, flow fluctuations result in noise in the sensor output. Here, we demonstrate in-line monitoring of flow fluctuations with a cantilever-like sensor integrated in a microfluidic channel. The cantilevers are fabricated in different materials (SU-8 and SiN and with different thicknesses. The integration of arrays of holes with different hole size and number of holes allows the modification of device sensitivity, theoretical detection limit and measurement range. For an average flow in the microliter range, the cantilever deflection is directly proportional to the flow rate fluctuations in the microfluidic channel. The SiN cantilevers show a detection limit below 1 nL/min and the thinnest SU-8 cantilevers a detection limit below 5 nL/min. Finally, the sensor is applied for in-line monitoring of flow fluctuations generated by external pumps connected to the microfluidic system.

  11. Binding energy and dephasing of biexcitons in In0.18Ga0.82As/GaAs single quantum wells

    DEFF Research Database (Denmark)

    Borri, Paola; Langbein, Wolfgang Werner; Hvam, Jørn Märcher

    1999-01-01

    Biexciton binding energies and biexciton dephasing in In0.18Ga0.82As/GaAs single quantum wells have been measured by time-integrated and spectrally resolved four-wave mixing. The biexciton binding energy increases from 1.5 to 2.6 meV for well widths increasing from 1 to 4 nm. The ratio between...... exciton and biexciton binding energy changes from 0.23 to 0.3 with increasing inhomogeneous broadening, corresponding to increasing well width. From the temperature dependence of the exciton and biexciton four-wave mixing signal decay, we have deduced the acoustic-phonon scattering of the exciton...

  12. Improved Diffuse Fluorescence Flow Cytometer Prototype for High Sensitivity Detection of Rare Circulating Cells In Vivo

    Science.gov (United States)

    Pestana, Noah Benjamin

    Accurate quantification of circulating cell populations is important in many areas of pre-clinical and clinical biomedical research, for example, in the study of cancer metastasis or the immune response following tissue and organ transplants. Normally this is done "ex-vivo" by drawing and purifying a small volume of blood and then analyzing it with flow cytometry, hemocytometry or microfludic devices, but the sensitivity of these techniques are poor and the process of handling samples has been shown to affect cell viability and behavior. More recently "in vivo flow cytometry" (IVFC) techniques have been developed where fluorescently-labeled cells flowing in a small blood vessel in the ear or retina are analyzed, but the sensitivity is generally poor due to the small sampling volume. To address this, our group recently developed a method known as "Diffuse Fluorescence Flow Cytometry" (DFFC) that allows detection and counting of rare circulating cells with diffuse photons, offering extremely high single cell counting sensitivity. In this thesis, an improved DFFC prototype was designed and validated. The chief improvements were three-fold, i) improved optical collection efficiency, ii) improved detection electronics, and iii) development of a method to mitigate motion artifacts during in vivo measurements. In combination, these improvements yielded an overall instrument detection sensitivity better than 1 cell/mL in vivo, which is the most sensitive IVFC system reported to date. Second, development and validation of a low-cost microfluidic device reader for analysis of ocular fluids is described. We demonstrate that this device has equivalent or better sensitivity and accuracy compared a fluorescence microscope, but at an order-of-magnitude reduced cost with simplified operation. Future improvements to both instruments are also discussed.

  13. Artificial sensory hairs based on the flow sensitive receptor hairs of crickets

    NARCIS (Netherlands)

    Dijkstra, Marcel; van Baar, J.J.J.; Wiegerink, Remco J.; Lammerink, Theodorus S.J.; de Boer, J.H.; Krijnen, Gijsbertus J.M.

    2005-01-01

    This paper presents the modelling, design, fabrication and characterization of flow sensors based on the wind-receptor hairs of crickets. Cricket sensory hairs are highly sensitive to drag-forces exerted on the hair shaft. Artificial sensory hairs have been realized in SU-8 on suspended SixNy

  14. Dephasing rates for weak localization and universal conductance fluctuations in two dimensional Si:P and Ge:P δ-layers.

    Science.gov (United States)

    Shamim, Saquib; Mahapatra, S; Scappucci, G; Klesse, W M; Simmons, M Y; Ghosh, Arindam

    2017-05-04

    We report quantum transport measurements on two dimensional (2D) Si:P and Ge:P δ-layers and compare the inelastic scattering rates relevant for weak localization (WL) and universal conductance fluctuations (UCF) for devices of various doping densities (0.3-2.5 × 10 18 m -2 ) at low temperatures (0.3-4.2 K). The phase breaking rate extracted experimentally from measurements of WL correction to conductivity and UCF agree well with each other within the entire temperature range. This establishes that WL and UCF, being the outcome of quantum interference phenomena, are governed by the same dephasing rate.

  15. Simultaneous velocity and pressure quantification using pressure-sensitive flow tracers in air

    Science.gov (United States)

    Zhang, Peng; Peterson, Sean; Porfiri, Maurizio

    2017-11-01

    Particle-based measurement techniques for assessing the velocity field of a fluid have advanced rapidly over the past two decades. Full-field pressure measurement techniques have remained elusive, however. In this work, we aim to demonstrate the possibility of direct simultaneous planar velocity and pressure measurement of a high speed aerodynamic flow by employing novel pressure-sensitive tracer particles for particle image velocimetry (PIV). Specifically, the velocity and pressure variations of an airflow through a converging-diverging channel are studied. Polystyrene microparticles embedded with a pressure-sensitive phosphorescent dye-platinum octaethylporphyrin (PtOEP)-are used as seeding particles. Due to the oxygen quenching effect, the emission lifetime of PtOEP is highly sensitive to the oxygen concentration, that is, the partial pressure of oxygen, in the air. Since the partial pressure of oxygen is linearly proportional to the air pressure, we can determine the air pressure through the phosphorescence emission lifetime of the dye. The velocity field is instead obtained using traditional PIV methods. The particles have a pressure resolution on the order of 1 kPa, which may be improved by optimizing the particle size and dye concentration to suit specific flow scenarios. This work was supported by the National Science Foundation under Grant Number CBET-1332204.

  16. Improving sensitivity in micro-free flow electrophoresis using signal averaging

    Science.gov (United States)

    Turgeon, Ryan T.; Bowser, Michael T.

    2009-01-01

    Microfluidic free-flow electrophoresis (μFFE) is a separation technique that separates continuous streams of analytes as they travel through an electric field in a planar flow channel. The continuous nature of the μFFE separation suggests that approaches more commonly applied in spectroscopy and imaging may be effective in improving sensitivity. The current paper describes the S/N improvements that can be achieved by simply averaging multiple images of a μFFE separation; 20–24-fold improvements in S/N were observed by averaging the signal from 500 images recorded for over 2 min. Up to an 80-fold improvement in S/N was observed by averaging 6500 images. Detection limits as low as 14 pM were achieved for fluorescein, which is impressive considering the non-ideal optical set-up used in these experiments. The limitation to this signal averaging approach was the stability of the μFFE separation. At separation times longer than 20 min bubbles began to form at the electrodes, which disrupted the flow profile through the device, giving rise to erratic peak positions. PMID:19319908

  17. Real-Time and In-Flow Sensing Using a High Sensitivity Porous Silicon Microcavity-Based Sensor.

    Science.gov (United States)

    Caroselli, Raffaele; Martín Sánchez, David; Ponce Alcántara, Salvador; Prats Quilez, Francisco; Torrijos Morán, Luis; García-Rupérez, Jaime

    2017-12-05

    Porous silicon seems to be an appropriate material platform for the development of high-sensitivity and low-cost optical sensors, as their porous nature increases the interaction with the target substances, and their fabrication process is very simple and inexpensive. In this paper, we present the experimental development of a porous silicon microcavity sensor and its use for real-time in-flow sensing application. A high-sensitivity configuration was designed and then fabricated, by electrochemically etching a silicon wafer. Refractive index sensing experiments were realized by flowing several dilutions with decreasing refractive indices, and measuring the spectral shift in real-time. The porous silicon microcavity sensor showed a very linear response over a wide refractive index range, with a sensitivity around 1000 nm/refractive index unit (RIU), which allowed us to directly detect refractive index variations in the 10 -7 RIU range.

  18. Orbital hyperfine interaction and qubit dephasing in carbon nanotube quantum dots

    Science.gov (United States)

    Palyi, Andras; Csiszar, Gabor

    2015-03-01

    Hyperfine interaction (HF) is of key importance for the functionality of solid-state quantum information processing, as it affects qubit coherence and enables nuclear-spin quantum memories. In this work, we complete the theory of the basic hyperfine interaction mechanisms (Fermi contact, dipolar, orbital) in carbon nanotube quantum dots by providing a theoretical description of the orbital HF. We find that orbital HF induces an interaction between the nuclear spins of the nanotube lattice and the valley degree of freedom of the electrons confined in the quantum dot. We show that the resulting nuclear-spin-electron-valley interaction (i) is approximately of Ising type, (ii) is essentially local, in the sense that an effective atomic interaction strength can be defined, and (iii) has a strength that is comparable to the combined strength of Fermi contact and dipolar interactions. We argue that orbital HF provides a new decoherence mechanism for single-electron valley qubits and spin-valley qubits in a range of multi-valley materials. We explicitly evaluate the corresponding inhomogeneous dephasing time T2* for a nanotube-based valley qubit. We acknowledge funding from the EU Marie Curie CIG-293834, OTKA Grant PD 100373, and EU ERC Starting Grant CooPairEnt 258789. AP is supported by the Janos Bolyai Scholarship of the Hungarian Academy of Sciences.

  19. Size-sensitive particle trajectories in three-dimensional micro-bubble acoustic streaming flows

    Science.gov (United States)

    Volk, Andreas; Rossi, Massimiliano; Hilgenfeldt, Sascha; Rallabandi, Bhargav; Kähler, Christian; Marin, Alvaro

    2015-11-01

    Oscillating microbubbles generate steady streaming flows with interesting features and promising applications for microparticle manipulation. The flow around oscillating semi-cylindrical bubbles has been typically assumed to be independent of the axial coordinate. However, it has been recently revealed that particle motion is strongly three-dimensional: Small tracer particles follow vortical trajectories with pronounced axial displacements near the bubble, weaving a toroidal stream-surface. A well-known consequence of bubble streaming flows is size-dependent particle migration, which can be exploited for sorting and trapping of microparticles in microfluidic devices. In this talk, we will show how the three-dimensional toroidal topology found for small tracer particles is modified as the particle size increases up to 1/3 of the bubble radius. Our results show size-sensitive particle positioning along the axis of the semi-cylindrical bubble. In order to analyze the three-dimensional sorting and trapping capabilities of the system, experiments with an imposed flow and polydisperse particle solutions are also shown.

  20. Childhood sexual abuse, selective attention for sexual cues and the effects of testosterone with or without Vardenafil on physiological sexual arousal in women with sexual dysfunction: a pilot study

    NARCIS (Netherlands)

    van der Made, F.; Bloemers, J.; van Ham, D.; El Yassem, W.; Kleiverda, G.; Everaerd, W.; Olivier, B.; Tuiten, A.

    2009-01-01

    INTRODUCTION: Female sexual dysfunction (FSD) may be associated with reduced central sensitivity for sexual cues. A single dose of testosterone might induce an increase in sensitivity for sexual stimuli, which in turn allows a PDE5 inhibitor to be effective in boosting the physiological sexual

  1. Real-Time and In-Flow Sensing Using a High Sensitivity Porous Silicon Microcavity-Based Sensor

    Directory of Open Access Journals (Sweden)

    Raffaele Caroselli

    2017-12-01

    Full Text Available Porous silicon seems to be an appropriate material platform for the development of high-sensitivity and low-cost optical sensors, as their porous nature increases the interaction with the target substances, and their fabrication process is very simple and inexpensive. In this paper, we present the experimental development of a porous silicon microcavity sensor and its use for real-time in-flow sensing application. A high-sensitivity configuration was designed and then fabricated, by electrochemically etching a silicon wafer. Refractive index sensing experiments were realized by flowing several dilutions with decreasing refractive indices, and measuring the spectral shift in real-time. The porous silicon microcavity sensor showed a very linear response over a wide refractive index range, with a sensitivity around 1000 nm/refractive index unit (RIU, which allowed us to directly detect refractive index variations in the 10−7 RIU range.

  2. Hierarchical Nanogold Labels to Improve the Sensitivity of Lateral Flow Immunoassay

    Science.gov (United States)

    Serebrennikova, Kseniya; Samsonova, Jeanne; Osipov, Alexander

    2018-06-01

    Lateral flow immunoassay (LFIA) is a widely used express method and offers advantages such as a short analysis time, simplicity of testing and result evaluation. However, an LFIA based on gold nanospheres lacks the desired sensitivity, thereby limiting its wide applications. In this study, spherical nanogold labels along with new types of nanogold labels such as gold nanopopcorns and nanostars were prepared, characterized, and applied for LFIA of model protein antigen procalcitonin. It was found that the label with a structure close to spherical provided more uniform distribution of specific antibodies on its surface, indicative of its suitability for this type of analysis. LFIA using gold nanopopcorns as a label allowed procalcitonin detection over a linear range of 0.5-10 ng mL-1 with the limit of detection of 0.1 ng mL-1, which was fivefold higher than the sensitivity of the assay with gold nanospheres. Another approach to improve the sensitivity of the assay included the silver enhancement method, which was used to compare the amplification of LFIA for procalcitonin detection. The sensitivity of procalcitonin determination by this method was 10 times better the sensitivity of the conventional LFIA with gold nanosphere as a label. The proposed approach of LFIA based on gold nanopopcorns improved the detection sensitivity without additional steps and prevented the increased consumption of specific reagents (antibodies).

  3. On the origins of the weak folding cooperativity of a designed ββα ultrafast protein FSD-1.

    Science.gov (United States)

    Wu, Chun; Shea, Joan-Emma

    2010-11-18

    FSD-1, a designed small ultrafast folder with a ββα fold, has been actively studied in the last few years as a model system for studying protein folding mechanisms and for testing of the accuracy of computational models. The suitability of this protein to describe the folding of naturally occurring α/β proteins has recently been challenged based on the observation that the melting transition is very broad, with ill-resolved baselines. Using molecular dynamics simulations with the AMBER protein force field (ff96) coupled with the implicit solvent model (IGB = 5), we shed new light into the nature of this transition and resolve the experimental controversies. We show that the melting transition corresponds to the melting of the protein as a whole, and not solely to the helix-coil transition. The breadth of the folding transition arises from the spread in the melting temperatures (from ∼325 K to ∼302 K) of the individual transitions: formation of the hydrophobic core, β-hairpin and tertiary fold, with the helix formed earlier. Our simulations initiated from an extended chain accurately predict the native structure, provide a reasonable estimate of the transition barrier height, and explicitly demonstrate the existence of multiple pathways and multiple transition states for folding. Our exhaustive sampling enables us to assess the quality of the Amber ff96/igb5 combination and reveals that while this force field can predict the correct native fold, it nonetheless overstabilizes the α-helix portion of the protein (Tm = ∼387K) as well as the denatured structures.

  4. Quasi-laminar stability and sensitivity analyses for turbulent flows: Prediction of low-frequency unsteadiness and passive control

    Science.gov (United States)

    Mettot, Clément; Sipp, Denis; Bézard, Hervé

    2014-04-01

    This article presents a quasi-laminar stability approach to identify in high-Reynolds number flows the dominant low-frequencies and to design passive control means to shift these frequencies. The approach is based on a global linear stability analysis of mean-flows, which correspond to the time-average of the unsteady flows. Contrary to the previous work by Meliga et al. ["Sensitivity of 2-D turbulent flow past a D-shaped cylinder using global stability," Phys. Fluids 24, 061701 (2012)], we use the linearized Navier-Stokes equations based solely on the molecular viscosity (leaving aside any turbulence model and any eddy viscosity) to extract the least stable direct and adjoint global modes of the flow. Then, we compute the frequency sensitivity maps of these modes, so as to predict before hand where a small control cylinder optimally shifts the frequency of the flow. In the case of the D-shaped cylinder studied by Parezanović and Cadot [J. Fluid Mech. 693, 115 (2012)], we show that the present approach well captures the frequency of the flow and recovers accurately the frequency control maps obtained experimentally. The results are close to those already obtained by Meliga et al., who used a more complex approach in which turbulence models played a central role. The present approach is simpler and may be applied to a broader range of flows since it is tractable as soon as mean-flows — which can be obtained either numerically from simulations (Direct Numerical Simulation (DNS), Large Eddy Simulation (LES), unsteady Reynolds-Averaged-Navier-Stokes (RANS), steady RANS) or from experimental measurements (Particle Image Velocimetry - PIV) — are available. We also discuss how the influence of the control cylinder on the mean-flow may be more accurately predicted by determining an eddy-viscosity from numerical simulations or experimental measurements. From a technical point of view, we finally show how an existing compressible numerical simulation code may be used in

  5. Flow Visualization at Cryogenic Conditions Using a Modified Pressure Sensitive Paint Approach

    Science.gov (United States)

    Watkins, A. Neal; Goad, William K.; Obara, Clifford J.; Sprinkle, Danny R.; Campbell, Richard L.; Carter, Melissa B.; Pendergraft, Odis C., Jr.; Bell, James H.; Ingram, JoAnne L.; Oglesby, Donald M.

    2005-01-01

    A modification to the Pressure Sensitive Paint (PSP) method was used to visualize streamlines on a Blended Wing Body (BWB) model at full-scale flight Reynolds numbers. In order to achieve these conditions, the tests were carried out in the National Transonic Facility operating under cryogenic conditions in a nitrogen environment. Oxygen is required for conventional PSP measurements, and several tests have been successfully completed in nitrogen environments by injecting small amounts (typically < 3000 ppm) of oxygen into the flow. A similar technique was employed here, except that air was purged through pressure tap orifices already existent on the model surface, resulting in changes in the PSP wherever oxygen was present. The results agree quite well with predicted results obtained through computational fluid dynamics analysis (CFD), which show this to be a viable technique for visualizing flows without resorting to more invasive procedures such as oil flow or minitufts.

  6. Stability and sensitivity analysis of hypersonic flow past a blunt cone

    Science.gov (United States)

    Nichols, Joseph W.; Cook, David; Brock, Joseph M.; Candler, Graham V.

    2017-11-01

    We investigate the effects of nosetip bluntness and low-level distributed roughness on instabilities leading to transition on a 7 degree half-angle blunt cone at Mach 10. To study the sensitivity of boundary layer instabilities to bluntness and roughness, we numerically extract Jacobian matrices directly from the unstructured hypersonic flow solver US3D. These matrices govern the dynamics of small perturbations about otherwise laminar base flows. We consider the frequency response of the resulting linearized dynamical system between different input and output locations along the cone, including close to the nosetip. Using adjoints, our method faithfully captures effects of complex geometry such as strong curvature and roughness that lead to flow acceleration and localized heating in this region. These effects violate the assumption of a slowly-varying base flow that underpins traditional linear stability analyses. We compare our results, which do not rely upon this assumption, to experimental measurements of a Mach 10 blunt cone taken at the AEDC Hypervelocity Ballistic Range G facility. In particular, we assess whether effects of complex geometry can explain discrepancies previously noted between traditional stability analysis and observations. This work is supported by the Office of Naval Research through Grant Number N00014-17-1-2496.

  7. Three-dimensional stability, receptivity and sensitivity of non-Newtonian flows inside open cavities

    International Nuclear Information System (INIS)

    Citro, Vincenzo; Giannetti, Flavio; Pralits, Jan O

    2015-01-01

    We investigate the stability properties of flows over an open square cavity for fluids with shear-dependent viscosity. Analysis is carried out in context of the linear theory using a normal-mode decomposition. The incompressible Cauchy equations, with a Carreau viscosity model, are discretized with a finite-element method. The characteristics of direct and adjoint eigenmodes are analyzed and discussed in order to understand the receptivity features of the flow. Furthermore, we identify the regions of the flow that are more sensitive to spatially localized feedback by building a spatial map obtained from the product between the direct and adjoint eigenfunctions. Analysis shows that the first global linear instability of the steady flow is a steady or unsteady three-dimensionl bifurcation depending on the value of the power-law index n. The instability mechanism is always located inside the cavity and the linear stability results suggest a strong connection with the classical lid-driven cavity problem. (paper)

  8. Novel approach based on one-tube nested PCR and a lateral flow strip for highly sensitive diagnosis of tuberculous meningitis.

    Science.gov (United States)

    Sun, Yajuan; Chen, Jiajun; Li, Jia; Xu, Yawei; Jin, Hui; Xu, Na; Yin, Rui; Hu, Guohua

    2017-01-01

    Rapid and sensitive detection of Mycobacterium tuberculosis (M. Tb) in cerebrospinal fluid is crucial in the diagnosis of tuberculous meningitis (TBM), but conventional diagnostic technologies have limited sensitivity and specificity or are time-consuming. In this work, a novel, highly sensitive molecular diagnostic method, one-tube nested PCR-lateral flow strip test (OTNPCR-LFST), was developed for detecting M. tuberculosis. This one-tube nested PCR maintains the sensitivity of conventional two-step nested PCR and reduces both the chance of cross-contamination and the time required for analysis. The PCR product was detected by a lateral flow strip assay, which provided a basis for migration of the test to a point-of-care (POC) microfluidic format. The developed assay had an improved sensitivity compared with traditional PCR, and the limit of detection was up to 1 fg DNA isolated from M. tuberculosis. The assay was also specific for M. tuberculosis, and no cross-reactions were found in other non-target bacteria. The application of this technique to clinical samples was successfully evaluated, and OTNPCR-LFST showed 89% overall sensitivity and 100% specificity for TBM patients. This one-tube nested PCR-lateral flow strip assay is useful for detecting M. tuberculosis in TBM due to its rapidity, high sensitivity and simple manipulation.

  9. On the origins of the weak folding cooperativity of a designed ββα ultrafast protein FSD-1.

    Directory of Open Access Journals (Sweden)

    Chun Wu

    Full Text Available FSD-1, a designed small ultrafast folder with a ββα fold, has been actively studied in the last few years as a model system for studying protein folding mechanisms and for testing of the accuracy of computational models. The suitability of this protein to describe the folding of naturally occurring α/β proteins has recently been challenged based on the observation that the melting transition is very broad, with ill-resolved baselines. Using molecular dynamics simulations with the AMBER protein force field (ff96 coupled with the implicit solvent model (IGB = 5, we shed new light into the nature of this transition and resolve the experimental controversies. We show that the melting transition corresponds to the melting of the protein as a whole, and not solely to the helix-coil transition. The breadth of the folding transition arises from the spread in the melting temperatures (from ∼325 K to ∼302 K of the individual transitions: formation of the hydrophobic core, β-hairpin and tertiary fold, with the helix formed earlier. Our simulations initiated from an extended chain accurately predict the native structure, provide a reasonable estimate of the transition barrier height, and explicitly demonstrate the existence of multiple pathways and multiple transition states for folding. Our exhaustive sampling enables us to assess the quality of the Amber ff96/igb5 combination and reveals that while this force field can predict the correct native fold, it nonetheless overstabilizes the α-helix portion of the protein (Tm = ∼387K as well as the denatured structures.

  10. Excited-state structure and electronic dephasing time of Nile blue from absolute resonance Raman intensities

    Science.gov (United States)

    Lawless, Mary K.; Mathies, Richard A.

    1992-06-01

    Absolute resonance Raman cross sections are measured for Nile blue 690 perchlorate dissolved in ethylene glycol with excitation at 514, 531, and 568 nm. These values and the absorption spectrum are modeled using a time-dependent wave packet formalism. The excited-state equilibrium geometry changes are quantitated for 40 resonance Raman active modes, seven of which (590, 1141, 1351, 1429, 1492, 1544, and 1640 cm-1 ) carry 70% of the total resonance Raman intensity. This demonstrates that in addition to the prominent 590 and 1640 cm-1 modes, a large number of vibrational degrees of freedom are Franck-Condon coupled to the electronic transition. After exposure of the explicit vibrational progressions, the residual absorption linewidth is separated into its homogeneous [350 cm-1 half-width at half-maximum (HWHM)] and inhomogeneous (313 cm-1 HWHM) components through an analysis of the absolute Raman cross sections. The value of the electronic dephasing time derived from this study (25 fs) compares well to previously published results. These data should be valuable in multimode modeling of femtosecond experiments on Nile blue.

  11. Slow flow and mural thrombus in aortic diseases: Spin-echo MR findings and their differentiation

    International Nuclear Information System (INIS)

    Chung, Jin Wook; Park, Jae Hyung; Han, Man Chung

    1993-01-01

    In order to evaluate the ability of spin-echo MR imaging to differentiate slow flow from mural thrombus in aortic diseases, we reviewed the spin-echo MR images of 13 patients with intraaortic thrombus documented by CT (N=11) or aortography (N=2). Six patients had aortic aneurysms and seven had aortic dissections. Intraaortic mural thrombi were accompanied by flow-related intraluminal signal of various pattern and extents in all 13 patients. On 10 gated MR studies, slow flow regions showed ever-echo rephasing phenomenon (N=8), interslice variation of signal intensities of the intraluminal signal (N=7) and flow-related ghost artifact (N=2). However, these MR flow phenomena were obscured on two of three non-gated studies. Seven of 13 intraaortic thrombi remained hyperintense on T2-weighted second-echo images. In these circumstance, a hypointense boundary layer between slow flow and mural thrombus, which was caused by either ' boundary layer dephasing phenomenon' of slow flow or 'paramagnetic T2 shortening' of fresh clot at the edge of mural thrombus, was very useful in discriminating the area of slow flow from that of mural thrombus. Proper interpretation of spin-echo MR images may obviate the need for phase display imaging or gradient-echo imaging in differentiating slow flow and mural thrombus

  12. GRASP [GRound-Water Adjunct Sensitivity Program]: A computer code to perform post-SWENT [simulator for water, energy, and nuclide transport] adjoint sensitivity analysis of steady-state ground-water flow: Technical report

    International Nuclear Information System (INIS)

    Wilson, J.L.; RamaRao, B.S.; McNeish, J.A.

    1986-11-01

    GRASP (GRound-Water Adjunct Senstivity Program) computes measures of the behavior of a ground-water system and the system's performance for waste isolation, and estimates the sensitivities of these measures to system parameters. The computed measures are referred to as ''performance measures'' and include weighted squared deviations of computed and observed pressures or heads, local Darcy velocity components and magnitudes, boundary fluxes, and travel distance and time along travel paths. The sensitivities are computed by the adjoint method and are exact derivatives of the performance measures with respect to the parameters for the modeled system, taken about the assumed parameter values. GRASP presumes steady-state, saturated grondwater flow, and post-processes the results of a multidimensional (1-D, 2-D, 3-D) finite-difference flow code. This document describes the mathematical basis for the model, the algorithms and solution techniques used, and the computer code design. The implementation of GRASP is verified with simple one- and two-dimensional flow problems, for which analytical expressions of performance measures and sensitivities are derived. The linkage between GRASP and multidimensional finite-difference flow codes is described. This document also contains a detailed user's manual. The use of GRASP to evaluate nuclear waste disposal issues has been emphasized throughout the report. The performance measures and their sensitivities can be employed to assist in directing data collection programs, expedite model calibration, and objectively determine the sensitivity of projected system performance to parameters

  13. Geostatistical and adjoint sensitivity techniques applied to a conceptual model of ground-water flow in the Paradox Basin, Utah

    International Nuclear Information System (INIS)

    Metcalfe, D.E.; Campbell, J.E.; RamaRao, B.S.; Harper, W.V.; Battelle Project Management Div., Columbus, OH)

    1985-01-01

    Sensitivity and uncertainty analysis are important components of performance assessment activities for potential high-level radioactive waste repositories. The application of geostatistical and adjoint sensitivity techniques to aid in the calibration of an existing conceptual model of ground-water flow is demonstrated for the Leadville Limestone in Paradox Basin, Utah. The geostatistical method called kriging is used to statistically analyze the measured potentiometric data for the Leadville. This analysis consists of identifying anomalous data and data trends and characterizing the correlation structure between data points. Adjoint sensitivity analysis is then performed to aid in the calibration of a conceptual model of ground-water flow to the Leadville measured potentiometric data. Sensitivity derivatives of the fit between the modeled Leadville potentiometric surface and the measured potentiometric data to model parameters and boundary conditions are calculated by the adjoint method. These sensitivity derivatives are used to determine which model parameter and boundary condition values should be modified to most efficiently improve the fit of modeled to measured potentiometric conditions

  14. Visualization and evaluation of flow during water filtration: Parameterization and sensitivity analysis

    Directory of Open Access Journals (Sweden)

    Bílek Petr

    2016-01-01

    Full Text Available This paper deals with visualization and evaluation of flow during filtration of water seeded by artificial microscopic particles. Planar laser induced fluorescence (PLIF is a wide spread method for visualization and non-invasive characterization of flow. However the method uses fluorescent dyes or fluorescent particles in special cases. In this article the flow is seeded by non-fluorescent monodisperse polystyrene particles with the diameter smaller than one micrometer. The monodisperse sub-micron particles are very suitable for testing of textile filtration materials. Nevertheless non-fluorescent particles are not useful for PLIF method. A water filtration setup with an optical access to the place, were a tested filter is mounted, was built and used for the experiments. Concentration of particles in front of and behind the tested filter in a laser light sheet measured is and the local filtration efficiency expressed is. The article describes further progress in the measurement. It was carried out sensitivity analysis, parameterization and performance of the method during several simulations and experiments.

  15. Unified Hall-Petch description of nano-grain nickel hardness, flow stress and strain rate sensitivity measurements

    Science.gov (United States)

    Armstrong, R. W.; Balasubramanian, N.

    2017-08-01

    It is shown that: (i) nano-grain nickel flow stress and hardness data at ambient temperature follow a Hall-Petch (H-P) relation over a wide range of grain size; and (ii) accompanying flow stress and strain rate sensitivity measurements follow an analogous H-P relationship for the reciprocal "activation volume", (1/v*) = (1/A*b) where A* is activation area. Higher temperature flow stress measurements show a greater than expected reduction both in the H-P kɛ and in v*. The results are connected with smaller nano-grain size (tested at very low imposed strain rates.

  16. Sensitivity studies on the multi-sensor conductivity probe measurement technique for two-phase flows

    Energy Technology Data Exchange (ETDEWEB)

    Worosz, Ted [Department of Mechanical and Nuclear Engineering, The Pennsylvania State University, 230 Reber Building, University Park, PA 16802 (United States); Bernard, Matt [The United States Nuclear Regulatory Commission, 11545 Rockville Pike, Rockville, MD 20852 (United States); Kong, Ran; Toptan, Aysenur [Department of Mechanical and Nuclear Engineering, The Pennsylvania State University, 230 Reber Building, University Park, PA 16802 (United States); Kim, Seungjin, E-mail: skim@psu.edu [Department of Mechanical and Nuclear Engineering, The Pennsylvania State University, 230 Reber Building, University Park, PA 16802 (United States); Hoxie, Chris [The United States Nuclear Regulatory Commission, 11545 Rockville Pike, Rockville, MD 20852 (United States)

    2016-12-15

    Highlights: • Revised conductivity probe circuit to eliminate signal “ghosting” among sensors. • Higher sampling frequencies suggested for bubble number frequency and a{sub i} measurements. • Two-phase parameter sensitivity to measurement duration and bubble number investigated. • Sensors parallel to pipe wall recommended for symmetric bubble velocity measurements. • Sensor separation distance ratio (s/d) greater than four minimizes bubble velocity error. - Abstract: The objective of this study is to advance the local multi-sensor conductivity probe measurement technique through systematic investigation into several practical aspects of a conductivity probe measurement system. Firstly, signal “ghosting” among probe sensors is found to cause artificially high bubble velocity measurements and low interfacial area concentration (a{sub i}) measurements that depend on sampling frequency and sensor impedance. A revised electrical circuit is suggested to eliminate this artificial variability. Secondly, the sensitivity of the probe measurements to sampling frequency is investigated in 13 two-phase flow conditions with superficial liquid and gas velocities ranging from 1.00–5.00 m/s and 0.17–2.0 m/s, respectively. With increasing gas flow rate, higher sampling frequencies, greater than 100 kHz in some cases, are required to adequately capture the bubble number frequency and a{sub i} measurements. This trend is due to the increase in gas velocity and the transition to the slug flow regime. Thirdly, the sensitivity of the probe measurements to the measurement duration as well as the sample number is investigated for the same flow conditions. Measurements of both group-I (spherical/distorted) and group-II (cap/slug/churn-turbulent) bubbles are found to be relatively insensitive to both the measurement duration and the number of bubbles, as long as the measurements are made for a duration long enough to capture a collection of samples characteristic to a

  17. Density-based global sensitivity analysis of sheet-flow travel time: Kinematic wave-based formulations

    Science.gov (United States)

    Hosseini, Seiyed Mossa; Ataie-Ashtiani, Behzad; Simmons, Craig T.

    2018-04-01

    Despite advancements in developing physics-based formulations to estimate the sheet-flow travel time (tSHF), the quantification of the relative impacts of influential parameters on tSHF has not previously been considered. In this study, a brief review of the physics-based formulations to estimate tSHF including kinematic wave (K-W) theory in combination with Manning's roughness (K-M) and with Darcy-Weisbach friction formula (K-D) over single and multiple planes is provided. Then, the relative significance of input parameters to the developed approaches is quantified by a density-based global sensitivity analysis (GSA). The performance of K-M considering zero-upstream and uniform flow depth (so-called K-M1 and K-M2), and K-D formulae to estimate the tSHF over single plane surface were assessed using several sets of experimental data collected from the previous studies. The compatibility of the developed models to estimate tSHF over multiple planes considering temporal rainfall distributions of Natural Resources Conservation Service, NRCS (I, Ia, II, and III) are scrutinized by several real-world examples. The results obtained demonstrated that the main controlling parameters of tSHF through K-D and K-M formulae are the length of surface plane (mean sensitivity index T̂i = 0.72) and flow resistance (mean T̂i = 0.52), respectively. Conversely, the flow temperature and initial abstraction ratio of rainfall have the lowest influence on tSHF (mean T̂i is 0.11 and 0.12, respectively). The significant role of the flow regime on the estimation of tSHF over a single and a cascade of planes are also demonstrated. Results reveal that the K-D formulation provides more precise tSHF over the single plane surface with an average percentage of error, APE equal to 9.23% (the APE for K-M1 and K-M2 formulae were 13.8%, and 36.33%, respectively). The superiority of Manning-jointed formulae in estimation of tSHF is due to the incorporation of effects from different flow regimes as

  18. Assessment of intracardiac flow and vorticity in the right heart of patients after repair of tetralogy of Fallot by flow-sensitive 4D MRI.

    Science.gov (United States)

    Hirtler, Daniel; Garcia, Julio; Barker, Alex J; Geiger, Julia

    2016-10-01

    To comprehensively and quantitatively analyse flow and vorticity in the right heart of patients after repair of tetralogy of Fallot (rTOF) compared with healthy volunteers. Time-resolved flow-sensitive 4D MRI was acquired in 24 rTOF patients and 12 volunteers. Qualitative flow evaluation was based on consensus reading of two observers. Quantitative analysis included segmentation of the right atrium (RA) and ventricle (RV) in a four-chamber view to extract volumes and regional haemodynamic information for computation of regional mean and peak vorticity. Right heart intra-atrial, intraventricular and outflow tract flow patterns differed considerably between rTOF patients and volunteers. Peak RA and mean RV vorticity was significantly higher in patients (p = 0.02/0.05). Significant negative correlations were found between patients' maximum and mean RV and RA vorticity and ventricular volumes (p tetralogy of Fallot. • Regurgitant flow in the main pulmonary artery is associated with higher right heart vorticity.

  19. Cardiometabolic Risk and Female Sexuality-Part I. Risk Factors and Potential Pathophysiological Underpinnings for Female Vasculogenic Sexual Dysfunction Syndromes.

    Science.gov (United States)

    Maseroli, Elisa; Scavello, Irene; Vignozzi, Linda

    2018-05-02

    Erectile dysfunction is recognized as an opportunity for preventing cardiovascular (CV) events, and assessing the impairment of penile vascular flow by Doppler ultrasound is an important tool to ascertain CV risk. Conversely, the role of genital vascular impairment in the pathophysiology of female sexual dysfunction (FSD) remains contentious. To focus on the current scientific support for an association between CV risk factors and female sexual health in the 1st part of a 2-part review. A thorough literature search of peer-reviewed publications on the associations between CV risk factors and FSD and their underlying mechanisms was performed using the PubMed database. We present a summary of the evidence from clinical studies and discuss the possible mechanisms providing the pathophysiologic bases of vasculogenic FSD syndromes. The peripheral sexual response in women is a vascular-dependent event, and evidence suggests that cardiometabolic-related perturbations in endothelial function can determine vascular insufficiency in female genital tissues. Although epidemiologic and observational studies demonstrate that the prevalence of FSD is higher in women with diabetes mellitus, a cause-effect relation between these clinical conditions cannot be assumed. Evidence on the effect of obesity, metabolic syndrome, and polycystic ovary syndrome on sexual function in women is controversial. Data on the associations of dyslipidemia and hypertension with FSD are limited. Common cardiometabolic alterations could affect vascular function in the female genital tract. Based on limited data, there is an association between CV risk factors and female sexual health in women; however, this association appears milder than in men. Maseroli E, Scavello I, Vignozzi L. Cardiometabolic Risk and Female Sexuality-Part I. Risk Factors and Potential Pathophysiological Underpinnings for Female Vasculogenic Sexual Dysfunction Syndromes. Sex Med Rev 2018;X:XXX-XXX. Copyright © 2018 International

  20. Validation of diffuse correlation spectroscopy sensitivity to nicotinamide-induced blood flow elevation in the murine hindlimb using the fluorescent microsphere technique

    Science.gov (United States)

    Proctor, Ashley R.; Ramirez, Gabriel A.; Han, Songfeng; Liu, Ziping; Bubel, Tracy M.; Choe, Regine

    2018-03-01

    Nicotinamide has been shown to affect blood flow in both tumor and normal tissues, including skeletal muscle. Intraperitoneal injection of nicotinamide was used as a simple intervention to test the sensitivity of noninvasive diffuse correlation spectroscopy (DCS) to changes in blood flow in the murine left quadriceps femoris skeletal muscle. DCS was then compared with the gold-standard fluorescent microsphere (FM) technique for validation. The nicotinamide dose-response experiment showed that relative blood flow measured by DCS increased following treatment with 500- and 1000-mg / kg nicotinamide. The DCS and FM technique comparison showed that blood flow index measured by DCS was correlated with FM counts quantified by image analysis. The results of this study show that DCS is sensitive to nicotinamide-induced blood flow elevation in the murine left quadriceps femoris. Additionally, the results of the comparison were consistent with similar studies in higher-order animal models, suggesting that mouse models can be effectively employed to investigate the utility of DCS for various blood flow measurement applications.

  1. On conditions and parameters important to model sensitivity for unsaturated flow through layered, fractured tuff

    International Nuclear Information System (INIS)

    Prindle, R.W.; Hopkins, P.L.

    1990-10-01

    The Hydrologic Code Intercomparison Project (HYDROCOIN) was formed to evaluate hydrogeologic models and computer codes and their use in performance assessment for high-level radioactive-waste repositories. This report describes the results of a study for HYDROCOIN of model sensitivity for isothermal, unsaturated flow through layered, fractured tuffs. We investigated both the types of flow behavior that dominate the performance measures and the conditions and model parameters that control flow behavior. We also examined the effect of different conceptual models and modeling approaches on our understanding of system behavior. The analyses included single- and multiple-parameter variations about base cases in one-dimensional steady and transient flow and in two-dimensional steady flow. The flow behavior is complex even for the highly simplified and constrained system modeled here. The response of the performance measures is both nonlinear and nonmonotonic. System behavior is dominated by abrupt transitions from matrix to fracture flow and by lateral diversion of flow. The observed behaviors are strongly influenced by the imposed boundary conditions and model constraints. Applied flux plays a critical role in determining the flow type but interacts strongly with the composite-conductivity curves of individual hydrologic units and with the stratigraphy. One-dimensional modeling yields conservative estimates of distributions of groundwater travel time only under very limited conditions. This study demonstrates that it is wrong to equate the shortest possible water-travel path with the fastest path from the repository to the water table. 20 refs., 234 figs., 10 tabs

  2. Is There a Difference in Credit Constraints Between Private and Listed Companies in Brazil? Empirical Evidence by The Cash Flow Sensitivity Approach

    Directory of Open Access Journals (Sweden)

    Alan Nader Ackel Ghani

    2015-04-01

    Full Text Available This article analyzes the credit constraints, using the cash flow sensitivity approach, of private and listed companies between 2007 and 2010. According to this approach, the econometric results show that the credit constraints are the same for either private or listed companies. This paper seeks to contribute to the literature because the study of credit constraints of private companies based on cash flow sensitivity in Brazil has been rare.

  3. Computing the sensitivity of drag and lift in flow past a circular cylinder: Time-stepping versus self-consistent analysis

    Science.gov (United States)

    Meliga, Philippe

    2017-07-01

    We provide in-depth scrutiny of two methods making use of adjoint-based gradients to compute the sensitivity of drag in the two-dimensional, periodic flow past a circular cylinder (Re≲189 ): first, the time-stepping analysis used in Meliga et al. [Phys. Fluids 26, 104101 (2014), 10.1063/1.4896941] that relies on classical Navier-Stokes modeling and determines the sensitivity to any generic control force from time-dependent adjoint equations marched backwards in time; and, second, a self-consistent approach building on the model of Mantič-Lugo et al. [Phys. Rev. Lett. 113, 084501 (2014), 10.1103/PhysRevLett.113.084501] to compute semilinear approximations of the sensitivity to the mean and fluctuating components of the force. Both approaches are applied to open-loop control by a small secondary cylinder and allow identifying the sensitive regions without knowledge of the controlled states. The theoretical predictions obtained by time-stepping analysis reproduce well the results obtained by direct numerical simulation of the two-cylinder system. So do the predictions obtained by self-consistent analysis, which corroborates the relevance of the approach as a guideline for efficient and systematic control design in the attempt to reduce drag, even though the Reynolds number is not close to the instability threshold and the oscillation amplitude is not small. This is because, unlike simpler approaches relying on linear stability analysis to predict the main features of the flow unsteadiness, the semilinear framework encompasses rigorously the effect of the control on the mean flow, as well as on the finite-amplitude fluctuation that feeds back nonlinearly onto the mean flow via the formation of Reynolds stresses. Such results are especially promising as the self-consistent approach determines the sensitivity from time-independent equations that can be solved iteratively, which makes it generally less computationally demanding. We ultimately discuss the extent to

  4. Assessment of intracardiac flow and vorticity in the right heart of patients after repair of tetralogy of Fallot by flow-sensitive 4D MRI

    Energy Technology Data Exchange (ETDEWEB)

    Hirtler, Daniel [University Hospital Freiburg, Department of Congenital Heart Defects and Pediatric Cardiology (Heart Center, University of Freiburg), Freiburg (Germany); Garcia, Julio; Barker, Alex J. [Northwestern University Feinberg School of Medicine, Department of Radiology, Chicago, IL (United States); Geiger, Julia [University Childrens' Hospital Zurich, Department of Radiology, Zurich (Switzerland)

    2016-10-15

    To comprehensively and quantitatively analyse flow and vorticity in the right heart of patients after repair of tetralogy of Fallot (rTOF) compared with healthy volunteers. Time-resolved flow-sensitive 4D MRI was acquired in 24 rTOF patients and 12 volunteers. Qualitative flow evaluation was based on consensus reading of two observers. Quantitative analysis included segmentation of the right atrium (RA) and ventricle (RV) in a four-chamber view to extract volumes and regional haemodynamic information for computation of regional mean and peak vorticity. Right heart intra-atrial, intraventricular and outflow tract flow patterns differed considerably between rTOF patients and volunteers. Peak RA and mean RV vorticity was significantly higher in patients (p = 0.02/0.05). Significant negative correlations were found between patients' maximum and mean RV and RA vorticity and ventricular volumes (p < 0.05). The main pulmonary artery (MPA) regurgitant flow was associated with higher RA and RV vorticity, which was significant for RA maximum and RV mean vorticity (p = 0.01/0.03). The calculation of vorticity based on 4D flow data is an alternative approach to assess intracardiac flow changes in rTOF patients compared with qualitative flow visualization. Alterations in intracardiac vorticity could be relevant with regard to the development of RV dilation and impaired function. (orig.)

  5. Assessment of intracardiac flow and vorticity in the right heart of patients after repair of tetralogy of Fallot by flow-sensitive 4D MRI

    International Nuclear Information System (INIS)

    Hirtler, Daniel; Garcia, Julio; Barker, Alex J.; Geiger, Julia

    2016-01-01

    To comprehensively and quantitatively analyse flow and vorticity in the right heart of patients after repair of tetralogy of Fallot (rTOF) compared with healthy volunteers. Time-resolved flow-sensitive 4D MRI was acquired in 24 rTOF patients and 12 volunteers. Qualitative flow evaluation was based on consensus reading of two observers. Quantitative analysis included segmentation of the right atrium (RA) and ventricle (RV) in a four-chamber view to extract volumes and regional haemodynamic information for computation of regional mean and peak vorticity. Right heart intra-atrial, intraventricular and outflow tract flow patterns differed considerably between rTOF patients and volunteers. Peak RA and mean RV vorticity was significantly higher in patients (p = 0.02/0.05). Significant negative correlations were found between patients' maximum and mean RV and RA vorticity and ventricular volumes (p < 0.05). The main pulmonary artery (MPA) regurgitant flow was associated with higher RA and RV vorticity, which was significant for RA maximum and RV mean vorticity (p = 0.01/0.03). The calculation of vorticity based on 4D flow data is an alternative approach to assess intracardiac flow changes in rTOF patients compared with qualitative flow visualization. Alterations in intracardiac vorticity could be relevant with regard to the development of RV dilation and impaired function. (orig.)

  6. Self-organized natural roads for predicting traffic flow: a sensitivity study

    International Nuclear Information System (INIS)

    Jiang, Bin; Zhao, Sijian; Yin, Junjun

    2008-01-01

    In this paper, we extended road-based topological analysis to both nationwide and urban road networks, and concentrated on a sensitivity study with respect to the formation of self-organized natural roads based on the Gestalt principle of good continuity. Both annual average daily traffic (AADT) and global positioning system (GPS) data were used to correlate with a series of ranking metrics including five centrality-based metrics and two PageRank metrics. It was found that there exists a tipping point from segment-based to road-based network topology in terms of correlation between ranking metrics and their traffic. To our great surprise, (1) this correlation is significantly improved if a selfish rather than utopian strategy is adopted in forming the self-organized natural roads, and (2) point-based metrics assigned by summation into individual roads tend to have a much better correlation with traffic flow than line-based metrics. These counter-intuitive surprising findings constitute emergent properties of self-organized natural roads, which are intelligent enough for predicting traffic flow, thus shedding substantial light on the understanding of road networks and their traffic from the perspective of complex networks

  7. Field-sensitivity To Rheological Parameters

    Science.gov (United States)

    Freund, Jonathan; Ewoldt, Randy

    2017-11-01

    We ask this question: where in a flow is a quantity of interest Q quantitatively sensitive to the model parameters θ-> describing the rheology of the fluid? This field sensitivity is computed via the numerical solution of the adjoint flow equations, as developed to expose the target sensitivity δQ / δθ-> (x) via the constraint of satisfying the flow equations. Our primary example is a sphere settling in Carbopol, for which we have experimental data. For this Carreau-model configuration, we simultaneously calculate how much a local change in the fluid intrinsic time-scale λ, limit-viscosities ηo and η∞, and exponent n would affect the drag D. Such field sensitivities can show where different fluid physics in the model (time scales, elastic versus viscous components, etc.) are important for the target observable and generally guide model refinement based on predictive goals. In this case, the computational cost of solving the local sensitivity problem is negligible relative to the flow. The Carreau-fluid/sphere example is illustrative; the utility of field sensitivity is in the design and analysis of less intuitive flows, for which we provide some additional examples.

  8. Medicinal plants as alternative treatments for female sexual dysfunction: utopian vision or possible treatment in climacteric women?

    Science.gov (United States)

    Mazaro-Costa, Renata; Andersen, Monica L; Hachul, Helena; Tufik, Sergio

    2010-11-01

    Female sexual dysfunction (FSD) is a complex and multifactorial condition. An increased incidence of FSD is especially associated with the decline of estrogen. Thus, menopause is a critical phase for FSD complaints. In this context, medicinal plants may be a therapeutic option. To identify and describe the popular and clinical uses of medicinal plants for FSD treatment in climacteric women. We highlighted the majority of the plants commonly involved with the female reproductive system including: Angelica sinensis, Cimicifuga racemosa, Ferula hermonis, Ginkgo biloba, Humulus lupulus, Lepidium meyenii, Tribulus terrestris, Trifolium pratense, and Vitex agnus-castus. This study is a narrative review of studies of plants that are possible alternative treatments for FSD. The species described have clinical and popular uses in different cultures as well as medical indications for female reproductive disturbances, mainly in climacteric women. We have also analyzed the evidence level of clinical studies. The main outcome assessed is the efficacy of plants in improving the symptoms of FSD. There is little evidence from the literature to recommend the use of medicinal plants when treating FSD. The majority of studies with a strong level of evidence are associated with the treatment of the vasomotor symptoms of menopause. Ferula hermonis, Angelica sinensis, and Gingko biloba may be suggested for arousal disorder studies. Cimicifuga racemosa, Trifolium pratense, and Vitex agnus-castus may be recommended for several FSD. Humulus lupulus and Tribulus terrestris may help with desire disorder studies. Lepidium meyenii should be studied further. Studies of these plants indicate that they may be useful as a possible alternative and/or complementary approach for studies aimed at the treatment of FSD. At this time, however, this review cannot recommend a plant that has a strong enough level of evidence for treatment of FSD. Thus, there is a need for clinical (double-blinded and

  9. MIZMAS: Modeling the Evolution of Ice Thickness and Floe Size Distributions in the Marginal Ice Zone of the Chukchi and Beaufort Seas

    Science.gov (United States)

    2015-09-30

    ITD theory of Thorndike et al. (1975) in order to explicitly simulate the evolution of FSD and ITD jointly. The FSD theory includes a FSD function and...et al., 2015). 4 RESULTS Modeling: A FSD theory is developed and coupled to the ITD theory of Thorndike et al. (1975) in order to... Thorndike , A.S., D.A. Rothrock, G.A. Maykut, and R. Colony (1975), The thickness distribution of sea ice. J. Geophys. Res., 80, 4501–4513. Zhang

  10. Equivalence principle for quantum systems: dephasing and phase shift of free-falling particles

    Science.gov (United States)

    Anastopoulos, C.; Hu, B. L.

    2018-02-01

    We ask the question of how the (weak) equivalence principle established in classical gravitational physics should be reformulated and interpreted for massive quantum objects that may also have internal degrees of freedom (dof). This inquiry is necessary because even elementary concepts like a classical trajectory are not well defined in quantum physics—trajectories originating from quantum histories become viable entities only under stringent decoherence conditions. From this investigation we posit two logically and operationally distinct statements of the equivalence principle for quantum systems. Version A: the probability distribution of position for a free-falling particle is the same as the probability distribution of a free particle, modulo a mass-independent shift of its mean. Version B: any two particles with the same velocity wave-function behave identically in free fall, irrespective of their masses. Both statements apply to all quantum states, including those without a classical correspondence, and also for composite particles with quantum internal dof. We also investigate the consequences of the interaction between internal and external dof induced by free fall. For a class of initial states, we find dephasing occurs for the translational dof, namely, the suppression of the off-diagonal terms of the density matrix, in the position basis. We also find a gravitational phase shift in the reduced density matrix of the internal dof that does not depend on the particle’s mass. For classical states, the phase shift has a natural classical interpretation in terms of gravitational red-shift and special relativistic time-dilation.

  11. Sexual dysfunction among reproductive-aged Chinese married women in Hong Kong: prevalence, risk factors, and associated consequences.

    Science.gov (United States)

    Zhang, Huiping; Fan, Susan; Yip, Paul S F

    2015-03-01

    Although female sexual dysfunction (FSD) is a serious public health issue endangering women's well-being, systematic research on FSD among reproductive-aged Chinese women in Hong Kong is quite scarce. This study aims to estimate the prevalence, risk factors, and associated consequences of FSD among reproductive-aged Chinese married women in Hong Kong. This study was based on a community-based survey across Hong Kong conducted by the Family Planning Association of Hong Kong in 2012 with 1,518 married women aged 21-49 years. The Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition classification was adopted to assess FSD. It was found that 25.6% of the married women surveyed reported at least one form of sexual dysfunction and that the prevalence of six domains of sexual dysfunction was as follows: 10.6% for lack of interest in sex, 10.5% for not finding sex pleasurable, 9.3% for lubrication difficulties, 8.8% for inability to achieve orgasm, 8.8% for orgasm delay, and 8.4% for physical pain during sex. Multivariate analyses showed that low education and income, average or poor health, lower frequency of sex, abortion history, traditional attitudes toward sex, and marital dissatisfaction are all significant risk factors for different components of FSD. It was also been found that four domains of FSD (the exceptions being orgasm delay and physical pain during sex) have severe consequences for married women's life satisfaction and sexual satisfaction. The prevalence of FSD is lower among reproductive-aged Chinese married women in Hong Kong than among women in the United States and some Asian countries. The risk factors associated with FSD include sociodemographic factors, physical health, sexual experience and attitudes, and relationship factors. FSD has significant consequences for married women's life quality. These findings have great implications for FSD prevention and relevant service delivery. © 2014 International Society for Sexual

  12. Effects of flow rate on crack growth in sensitized type 304 stainless steel in high-temperature aqueous solutions

    International Nuclear Information System (INIS)

    Kwon, H.S.; Wuensche, A.; Macdonald, D.D.

    2000-01-01

    Intergranular stress corrosion cracking (IGSCC) in weld-sensitized, Type 304 (UNS S30400) (1) stainless steel (SS) remains a major threat to the integrity of heat transport circuits (HTC) in boiling water reactors (BWR), in spite of extensive research over the last 30 years. Effects of flow rate on intergranular crack growth in sensitized Type 304 stainless steel (UNS S30400) in distilled water containing 15 ppm or 25 ppm (2.59 x 10 -4 or 4.31 x 10 -4 m) sodium chloride (NaCl) at 250 C were examined using compact tension (CT) specimens under constant loading conditions. On increasing the flow rate, the crack growth rate (CGR) drastically increased, but later decreased to a level that was lower than the initial value. The initial increase in CGR was attributed to an enhanced rate of mass transfer of oxygen to the external surface, where it consumed the current emanating from the crack mouth. However, the subsequent decrease in CGR was attributed to crack flushing, which is a delayed process because of the time required to destroy the aggressive conditions that exist within the crack. Once flushing destroyed the aggressive crack environment, CGR decreased with increasing flow rate. The time over which CGR increased after an increase in the flow rate depended on how fast crack flushing occurred by fluid flow; the higher the flow rate and the greater the crack opening, the faster the crack flushing and the shorter the transition time. Finally, intergranular cracks propagated faster in regions nearer both sides of the Ct specimens, where the oxygen supply to the external surface was enhanced under stirring conditions and where minimal resistance existed to current flow from the crack tip to the external surfaces. This observation provided evidence that the crack's internal and external environments were coupled electrochemically

  13. FLOCK cluster analysis of mast cell event clustering by high-sensitivity flow cytometry predicts systemic mastocytosis.

    Science.gov (United States)

    Dorfman, David M; LaPlante, Charlotte D; Pozdnyakova, Olga; Li, Betty

    2015-11-01

    In our high-sensitivity flow cytometric approach for systemic mastocytosis (SM), we identified mast cell event clustering as a new diagnostic criterion for the disease. To objectively characterize mast cell gated event distributions, we performed cluster analysis using FLOCK, a computational approach to identify cell subsets in multidimensional flow cytometry data in an unbiased, automated fashion. FLOCK identified discrete mast cell populations in most cases of SM (56/75 [75%]) but only a minority of non-SM cases (17/124 [14%]). FLOCK-identified mast cell populations accounted for 2.46% of total cells on average in SM cases and 0.09% of total cells on average in non-SM cases (P < .0001) and were predictive of SM, with a sensitivity of 75%, a specificity of 86%, a positive predictive value of 76%, and a negative predictive value of 85%. FLOCK analysis provides useful diagnostic information for evaluating patients with suspected SM, and may be useful for the analysis of other hematopoietic neoplasms. Copyright© by the American Society for Clinical Pathology.

  14. Sensitivity enhancement of 13C nuclei in 2D J-resolved NMR spectroscopy using a recycled-flow system

    International Nuclear Information System (INIS)

    Ha, S.T.K.; Lee, R.W.K.; Wilkins, C.L.

    1987-01-01

    Recycled-flow nuclear magnetic resonance for sensitivity enhancement in 1/2 spin nuclei has been reported previously, achieving several-fold signal enhancement. The success of the method depends upon premagnetization of nuclei prior to flowing into the detector region, obviating the need for delays following data acquisition to allow spin-lattice relaxation and reduce experiment time. The actual gains of sensitivity enhancement for 13 C- 1 H 2D J-resolved NMR using a recycled-flow method are evaluated. Possible enhancements for two types of J-resolved measurements, namely, one-bond 13 C- 1 H and long range J-resolved spectroscopy, are estimated using a simple Carr-Purcell spin-echo approach to quantify the 13 C signals. The pulse sequence is simply 90 0 -t /sub 1/2/-180 0 -t/sub 1/2/-AT-t/sub d/, where t/sub 1/2/ is half the evolution time, AT is the acquisition time, and t/sub d/ the experiment repetition time. In a static 2D NMR experiment, t/sub d/ usually must be the same order of the longest spin-lattice relaxation time (T 1 ) of nuclei. Quantitative measurements using a recycled-flow system indicate t/dub d/ can be reduced to a fraction of T 1 ; hence significant time savings can be achieved. Time-savings of between 2 and 25 can be anticipated for 2D spectroscopy under flow measurement conditions used in the present study. Other types of 2D NMR spectroscopy (autocorrelation and double quantum NMR) are discussed

  15. A surrogate-based sensitivity quantification and Bayesian inversion of a regional groundwater flow model

    Science.gov (United States)

    Chen, Mingjie; Izady, Azizallah; Abdalla, Osman A.; Amerjeed, Mansoor

    2018-02-01

    Bayesian inference using Markov Chain Monte Carlo (MCMC) provides an explicit framework for stochastic calibration of hydrogeologic models accounting for uncertainties; however, the MCMC sampling entails a large number of model calls, and could easily become computationally unwieldy if the high-fidelity hydrogeologic model simulation is time consuming. This study proposes a surrogate-based Bayesian framework to address this notorious issue, and illustrates the methodology by inverse modeling a regional MODFLOW model. The high-fidelity groundwater model is approximated by a fast statistical model using Bagging Multivariate Adaptive Regression Spline (BMARS) algorithm, and hence the MCMC sampling can be efficiently performed. In this study, the MODFLOW model is developed to simulate the groundwater flow in an arid region of Oman consisting of mountain-coast aquifers, and used to run representative simulations to generate training dataset for BMARS model construction. A BMARS-based Sobol' method is also employed to efficiently calculate input parameter sensitivities, which are used to evaluate and rank their importance for the groundwater flow model system. According to sensitivity analysis, insensitive parameters are screened out of Bayesian inversion of the MODFLOW model, further saving computing efforts. The posterior probability distribution of input parameters is efficiently inferred from the prescribed prior distribution using observed head data, demonstrating that the presented BMARS-based Bayesian framework is an efficient tool to reduce parameter uncertainties of a groundwater system.

  16. Is Investment-Cash flow Sensitivity a Good Measure of Financing Constraints? New Evidence from Indian Business Group Firms

    NARCIS (Netherlands)

    George, R.; Kabir, M.R.; Qian, J.

    2005-01-01

    Several studies use the investment - cash flow sensitivity as a measure of financing constraints while some others disagree.The source of this disparity lies mostly in differences in opinion regarding the segregation of severely financially constrained firms from less constrained ones.We examine

  17. Flow-sensitive type recovery in linear-log time

    DEFF Research Database (Denmark)

    Adams, Michael D.; Keep, Andrew W.; Midtgaard, Jan

    2011-01-01

    The flexibility of dynamically typed languages such as JavaScript, Python, Ruby, and Scheme comes at the cost of run-time type checks. Some of these checks can be eliminated via control-flow analysis. However, traditional control-flow analysis (CFA) is not ideal for this task as it ignores flow...

  18. Adaptive population divergence and directional gene flow across steep elevational gradients in a climate‐sensitive mammal

    Science.gov (United States)

    Waterhouse, Matthew D.; Erb, Liesl P.; Beever, Erik; Russello, Michael A.

    2018-01-01

    The American pika is a thermally sensitive, alpine lagomorph species. Recent climate-associated population extirpations and genetic signatures of reduced population sizes range-wide indicate the viability of this species is sensitive to climate change. To test for potential adaptive responses to climate stress, we sampled pikas along two elevational gradients (each ~470 to 1640 m) and employed three outlier detection methods, BAYESCAN, LFMM, and BAYPASS, to scan for genotype-environment associations in samples genotyped at 30,763 SNP loci. We resolved 173 loci with robust evidence of natural selection detected by either two independent analyses or replicated in both transects. A BLASTN search of these outlier loci revealed several genes associated with metabolic function and oxygen transport, indicating natural selection from thermal stress and hypoxia. We also found evidence of directional gene flow primarily downslope from large high-elevation populations and reduced gene flow at outlier loci, a pattern suggesting potential impediments to the upward elevational movement of adaptive alleles in response to contemporary climate change. Finally, we documented evidence of reduced genetic diversity associated the south-facing transect and an increase in corticosterone stress levels associated with inbreeding. This study suggests the American pika is already undergoing climate-associated natural selection at multiple genomic regions. Further analysis is needed to determine if the rate of climate adaptation in the American pika and other thermally sensitive species will be able to keep pace with rapidly changing climate conditions.

  19. Flow analysis with WaSiM-ETH – model parameter sensitivity at different scales

    Directory of Open Access Journals (Sweden)

    J. Cullmann

    2006-01-01

    Full Text Available WaSiM-ETH (Gurtz et al., 2001, a widely used water balance simulation model, is tested for its suitability to serve for flow analysis in the context of rainfall runoff modelling and flood forecasting. In this paper, special focus is on the resolution of the process domain in space as well as in time. We try to couple model runs with different calculation time steps in order to reduce the effort arising from calculating the whole flow hydrograph at the hourly time step. We aim at modelling on the daily time step for water balance purposes, switching to the hourly time step whenever high-resolution information is necessary (flood forecasting. WaSiM-ETH is used at different grid resolutions, thus we try to become clear about being able to transfer the model in spatial resolution. We further use two different approaches for the overland flow time calculation within the sub-basins of the test watershed to gain insights about the process dynamics portrayed by the model. Our findings indicate that the model is very sensitive to time and space resolution and cannot be transferred across scales without recalibration.

  20. Comparison of increased venous contrast in ischemic stroke using phase-sensitive MR imaging with perfusion changes on flow-sensitive alternating inversion recovery at 3 Tesla

    International Nuclear Information System (INIS)

    Yamashita, Eijiro; Kanasaki, Yoshiko; Fujii, Shinya; Ogawa, Toshihide; Tanaka, Takuro; Hirata, Yoshiharu

    2011-01-01

    Background Increased venous contrast in ischemic stroke using susceptibility-weighted imaging has been widely reported, although few reports have compared increased venous contrast areas with perfusion change areas. Purpose To compare venous contrast on phase-sensitive MR images (PSI) with perfusion change on flow-sensitive alternating inversion recovery (FAIR) images, and to discuss the clinical use of PSI in ischemic stroke. Material and Methods Thirty patients with clinically suspected acute infarction of the middle cerebral artery (MCA) territory within 7 days of onset were evaluated. Phase-sensitive imaging (PSI), flow-sensitive alternating inversion recovery (FAIR), diffusion-weighted imaging (DWI) and magnetic resonance angiography (MRA) were obtained using 3 Tesla scanner. Two neuroradiologists independently reviewed the MR images, as well as the PSI, DWI, and FAIR images. They were blinded to the clinical data and to each other's findings. The abnormal area of each image was ultimately identified after both neuroradiologists reached consensus. We analyzed areas of increased venous contrast on PSI, perfusion changes on FAIR images and signal changes on DWI for each case. Results Venous contrast increased on PSI and hypoperfusion was evident on FAIR images from 22 of the 30 patients (73%). The distribution of the increased venous contrast was the same as that of the hypoperfused areas on FAIR images in 16 of these 22. The extent of these lesions was larger than that of lesions visualized by on DWI in 18 of the 22 patients. Hypointense signals reflecting hemorrhage and no increased venous contrast on PSI and hyperperfusion on FAIR images were found in six of the remaining eight patients (20%). Findings on PSI were normal and hypoperfusion areas were absent on FAIR images of two patients (7%). Conclusion Increased venous contrast on PSI might serve as an index of misery perfusion and provide useful information

  1. Relation of exact Gaussian basis methods to the dephasing representation: Theory and application to time-resolved electronic spectra

    Science.gov (United States)

    Sulc, Miroslav; Hernandez, Henar; Martinez, Todd J.; Vanicek, Jiri

    2014-03-01

    We recently showed that the Dephasing Representation (DR) provides an efficient tool for computing ultrafast electronic spectra and that cellularization yields further acceleration [M. Šulc and J. Vaníček, Mol. Phys. 110, 945 (2012)]. Here we focus on increasing its accuracy by first implementing an exact Gaussian basis method (GBM) combining the accuracy of quantum dynamics and efficiency of classical dynamics. The DR is then derived together with ten other methods for computing time-resolved spectra with intermediate accuracy and efficiency. These include the Gaussian DR (GDR), an exact generalization of the DR, in which trajectories are replaced by communicating frozen Gaussians evolving classically with an average Hamiltonian. The methods are tested numerically on time correlation functions and time-resolved stimulated emission spectra in the harmonic potential, pyrazine S0 /S1 model, and quartic oscillator. Both the GBM and the GDR are shown to increase the accuracy of the DR. Surprisingly, in chaotic systems the GDR can outperform the presumably more accurate GBM, in which the two bases evolve separately. This research was supported by the Swiss NSF Grant No. 200021_124936/1 and NCCR Molecular Ultrafast Science & Technology (MUST), and by the EPFL.

  2. Perceptions of female sexual health and sexual dysfunction in a ...

    African Journals Online (AJOL)

    These respondents further defined FSD as either the inability of a female to respond to sex, a lack of urge to engage in sexual activities, or inability to attain orgasm. About half of the respondents (n=21) did not know that FSD could be managed; however, 70% of them felt comfortable with discussing FSD symptoms with a ...

  3. Sensitivity studies of unsaturated groundwater flow modeling for groundwater travel time calculations at Yucca Mountain, Nevada

    International Nuclear Information System (INIS)

    Altman, S.J.; Ho, C.K.; Arnold, B.W.; McKenna, S.A.

    1995-01-01

    Unsaturated flow has been modeled through four cross-sections at Yucca Mountain, Nevada, for the purpose of determining groundwater particle travel times from the potential repository to the water table. This work will be combined with the results of flow modeling in the saturated zone for the purpose of evaluating the suitability of the potential repository under the criteria of 10CFR960. One criterion states, in part, that the groundwater travel time (GWTT) from the repository to the accessible environment must exceed 1,000 years along the fastest path of likely and significant radionuclide travel. Sensitivity analyses have been conducted for one geostatistical realization of one cross-section for the purpose of (1) evaluating the importance of hydrological parameters having some uncertainty and (2) examining conceptual models of flow by altering the numerical implementation of the conceptual model (dual permeability (DK) and the equivalent continuum model (ECM). Results of comparisons of the ECM and DK model are also presented in Ho et al

  4. Levelized cost of energy and sensitivity analysis for the hydrogen-bromine flow battery

    Science.gov (United States)

    Singh, Nirala; McFarland, Eric W.

    2015-08-01

    The technoeconomics of the hydrogen-bromine flow battery are investigated. Using existing performance data the operating conditions were optimized to minimize the levelized cost of electricity using individual component costs for the flow battery stack and other system units. Several different configurations were evaluated including use of a bromine complexing agent to reduce membrane requirements. Sensitivity analysis of cost is used to identify the system elements most strongly influencing the economics. The stack lifetime and round-trip efficiency of the cell are identified as major factors on the levelized cost of electricity, along with capital components related to hydrogen storage, the bipolar plate, and the membrane. Assuming that an electrocatalyst and membrane with a lifetime of 2000 cycles can be identified, the lowest cost market entry system capital is 220 kWh-1 for a 4 h discharge system and for a charging energy cost of 0.04 kWh-1 the levelized cost of the electricity delivered is 0.40 kWh-1. With systems manufactured at large scales these costs are expected to be lower.

  5. Drifting while stepping in place in old adults: Association of self-motion perception with reference frame reliance and ground optic flow sensitivity.

    Science.gov (United States)

    Agathos, Catherine P; Bernardin, Delphine; Baranton, Konogan; Assaiante, Christine; Isableu, Brice

    2017-04-07

    Optic flow provides visual self-motion information and is shown to modulate gait and provoke postural reactions. We have previously reported an increased reliance on the visual, as opposed to the somatosensory-based egocentric, frame of reference (FoR) for spatial orientation with age. In this study, we evaluated FoR reliance for self-motion perception with respect to the ground surface. We examined how effects of ground optic flow direction on posture may be enhanced by an intermittent podal contact with the ground, and reliance on the visual FoR and aging. Young, middle-aged and old adults stood quietly (QS) or stepped in place (SIP) for 30s under static stimulation, approaching and receding optic flow on the ground and a control condition. We calculated center of pressure (COP) translation and optic flow sensitivity was defined as the ratio of COP translation velocity over absolute optic flow velocity: the visual self-motion quotient (VSQ). COP translation was more influenced by receding flow during QS and by approaching flow during SIP. In addition, old adults drifted forward while SIP without any imposed visual stimulation. Approaching flow limited this natural drift and receding flow enhanced it, as indicated by the VSQ. The VSQ appears to be a motor index of reliance on the visual FoR during SIP and is associated with greater reliance on the visual and reduced reliance on the egocentric FoR. Exploitation of the egocentric FoR for self-motion perception with respect to the ground surface is compromised by age and associated with greater sensitivity to optic flow. Copyright © 2017 IBRO. Published by Elsevier Ltd. All rights reserved.

  6. Experimental Studies of Premixed Flame Structure and Propagation Characteristics in Compressible Flow

    Science.gov (United States)

    2015-07-14

    turbulence levels resulted in higher values for both curvature and flame length . The curvature values shown in Figure 124 are determined first finding the all...and the product the maximum FSD and brush thickness (right). Figure 133: Instantaneous flame length histograms for t = 1.842ms for M = 0.2 (left) and M...0.3 (center). Mean flame length verse time is also shown (right) with error bars for standard deviations. Figure 133 shows the instantaneous flame

  7. A Lateral Flow Protein Microarray for Rapid and Sensitive Antibody Assays

    Directory of Open Access Journals (Sweden)

    Helene Andersson-Svahn

    2011-11-01

    Full Text Available Protein microarrays are useful tools for highly multiplexed determination of presence or levels of clinically relevant biomarkers in human tissues and biofluids. However, such tools have thus far been restricted to laboratory environments. Here, we present a novel 384-plexed easy to use lateral flow protein microarray device capable of sensitive (< 30 ng/mL determination of antigen-specific antibodies in ten minutes of total assay time. Results were developed with gold nanobeads and could be recorded by a cell-phone camera or table top scanner. Excellent accuracy with an area under curve (AUC of 98% was achieved in comparison with an established glass microarray assay for 26 antigen-specific antibodies. We propose that the presented framework could find use in convenient and cost-efficient quality control of antibody production, as well as in providing a platform for multiplexed affinity-based assays in low-resource or mobile settings.

  8. Flows of dioxins and furans in coastal food webs: inverse modeling, sensitivity analysis, and applications of linear system theory.

    Science.gov (United States)

    Saloranta, Tuomo M; Andersen, Tom; Naes, Kristoffer

    2006-01-01

    Rate constant bioaccumulation models are applied to simulate the flow of polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) in the coastal marine food web of Frierfjorden, a contaminated fjord in southern Norway. We apply two different ways to parameterize the rate constants in the model, global sensitivity analysis of the models using Extended Fourier Amplitude Sensitivity Test (Extended FAST) method, as well as results from general linear system theory, in order to obtain a more thorough insight to the system's behavior and to the flow pathways of the PCDD/Fs. We calibrate our models against observed body concentrations of PCDD/Fs in the food web of Frierfjorden. Differences between the predictions from the two models (using the same forcing and parameter values) are of the same magnitude as their individual deviations from observations, and the models can be said to perform about equally well in our case. Sensitivity analysis indicates that the success or failure of the models in predicting the PCDD/F concentrations in the food web organisms highly depends on the adequate estimation of the truly dissolved concentrations in water and sediment pore water. We discuss the pros and cons of such models in understanding and estimating the present and future concentrations and bioaccumulation of persistent organic pollutants in aquatic food webs.

  9. Fenton mediated ultrasonic disintegration of sludge biomass: Biodegradability studies, energetic assessment, and its economic viability.

    Science.gov (United States)

    Kavitha, S; Rajesh Banu, J; IvinShaju, C D; Kaliappan, S; Yeom, Ick Tae

    2016-12-01

    Mechanical disintegration of sludge through ultrasonication demands high energy and cost. Therefore, in the present study, a comprehensive investigation was performed to analyze the potential of a novel method, fenton mediated sonic disintegration (FSD). In FSD process, extracellular polymeric substance (EPS) of sludge was first removed via fenton treatment. It was subsequently disintegrated via ultrasonication. Energetic assessment and economic analysis were then performed using net energy and cost gain (spent) as key factor to evaluate the practical viability of the FSD process. FSD was found to be superior over sonic disintegration based on its higher sludge solubilization (34.4% vs. 23.2%) and methane production potential (0.3gCOD/gCOD vs. 0.2gCOD/gCOD). Both energy analysis and cost assessment of the present study revealed that FSD could reduce the energy demand of ultrasonication considerably with a positive net profit of about 44.93USD/Ton of sludge. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. An inter-laboratory comparison of PNH clone detection by high-sensitivity flow cytometry in a Russian cohort.

    Science.gov (United States)

    Sipol, Alexandra A; Babenko, Elena V; Borisov, Vyacheslav I; Naumova, Elena V; Boyakova, Elena V; Yakunin, Dimitry I; Glazanova, Tatyana V; Chubukina, Zhanna V; Pronkina, Natalya V; Popov, Alexander M; Saveliev, Leonid I; Lugovskaya, Svetlana A; Lisukov, Igor A; Kulagin, Alexander D; Illingworth, Andrea J

    2015-01-01

    Paroxysmal nocturnal hemoglobinuria (PNH) is an acquired clonal stem cell disorder characterized by partial or absolute deficiency of glycophosphatidyl-inositol (GPI) anchor-linked surface proteins on blood cells. A lack of precise diagnostic standards for flow cytometry has hampered useful comparisons of data between laboratories. We report data from the first study evaluating the reproducibility of high-sensitivity flow cytometry for PNH in Russia. PNH clone sizes were determined at diagnosis in PNH patients at a central laboratory and compared with follow-up measurements in six laboratories across the country. Analyses in each laboratory were performed according to recommendations from the International Clinical Cytometry Society (ICCS) and the more recent 'practical guidelines'. Follow-up measurements were compared with each other and with the values determined at diagnosis. PNH clone size measurements were determined in seven diagnosed PNH patients (five females, two males: mean age 37 years); five had a history of aplastic anemia and three (one with and two without aplastic anemia) had severe hemolytic PNH and elevated plasma lactate dehydrogenase. PNH clone sizes at diagnosis were low in patients with less severe clinical symptoms (0.41-9.7% of granulocytes) and high in patients with severe symptoms (58-99%). There were only minimal differences in the follow-up clone size measurement for each patient between the six laboratories, particularly in those with high values at diagnosis. The ICCS-recommended high-sensitivity flow cytometry protocol was effective for detecting major and minor PNH clones in Russian PNH patients, and showed high reproducibility between laboratories.

  11. The Sea-Ice Floe Size Distribution

    Science.gov (United States)

    Stern, H. L., III; Schweiger, A. J. B.; Zhang, J.; Steele, M.

    2017-12-01

    The size distribution of ice floes in the polar seas affects the dynamics and thermodynamics of the ice cover and its interaction with the ocean and atmosphere. Ice-ocean models are now beginning to include the floe size distribution (FSD) in their simulations. In order to characterize seasonal changes of the FSD and provide validation data for our ice-ocean model, we calculated the FSD in the Beaufort and Chukchi seas over two spring-summer-fall seasons (2013 and 2014) using more than 250 cloud-free visible-band scenes from the MODIS sensors on NASA's Terra and Aqua satellites, identifying nearly 250,000 ice floes between 2 and 30 km in diameter. We found that the FSD follows a power-law distribution at all locations, with a seasonally varying exponent that reflects floe break-up in spring, loss of smaller floes in summer, and the return of larger floes after fall freeze-up. We extended the results to floe sizes from 10 m to 2 km at selected time/space locations using more than 50 high-resolution radar and visible-band satellite images. Our analysis used more data and applied greater statistical rigor than any previous study of the FSD. The incorporation of the FSD into our ice-ocean model resulted in reduced sea-ice thickness, mainly in the marginal ice zone, which improved the simulation of sea-ice extent and yielded an earlier ice retreat. We also examined results from 17 previous studies of the FSD, most of which report power-law FSDs but with widely varying exponents. It is difficult to reconcile the range of results due to different study areas, seasons, and methods of analysis. We review the power-law representation of the FSD in these studies and discuss some mathematical details that are important to consider in any future analysis.

  12. Equivalence of qubit-environment entanglement and discord generation via pure dephasing interactions and the resulting consequences

    Science.gov (United States)

    Roszak, Katarzyna; Cywiński, Łukasz

    2018-01-01

    We find that when a qubit initialized in a pure state experiences pure dephasing due to interaction with an environment, separable qubit-environment states generated during the evolution also have zero quantum discord with respect to the environment. What follows is that the set of separable states which can be reached during the evolution has zero volume, and hence, such effects as sudden death of qubit-environment entanglement are very unlikely. In the case of the discord with respect to the qubit, a vast majority of qubit-environment separable states is discordant, but in specific situations zero-discord states are possible. This is conceptually important since there is a connection between the discordance with respect to a given subsystem and the possibility of describing the evolution of this subsystem using completely positive maps. Finally, we use the formalism to find an exemplary evolution of an entangled state of two qubits that is completely positive, and occurs solely due to interaction of only one of the qubits with its environment (so one could guess that it corresponds to a local operation, since it is local in a physical sense), but which nevertheless causes the enhancement of entanglement between the qubits. While this simply means that the considered evolution is completely positive, but does not belong to local operations and classical communication, it shows how much caution has to be exercised when identifying evolution channels that belong to that class.

  13. Sensitive Diagnostics for Chemically Reacting Flows

    KAUST Repository

    Farooq, Aamir

    2015-01-01

    This talk will feature latest diagnostic developments for sensitive detection of gas temperature and important combustion species. Advanced optical strategies, such as intrapulse chirping, wavelength modulation, and cavity ringdown are employed.

  14. Sensitive Diagnostics for Chemically Reacting Flows

    KAUST Repository

    Farooq, Aamir

    2015-11-02

    This talk will feature latest diagnostic developments for sensitive detection of gas temperature and important combustion species. Advanced optical strategies, such as intrapulse chirping, wavelength modulation, and cavity ringdown are employed.

  15. Sodium flow measurement in large pipelines of sodium cooled fast breeder reactors with bypass type flow meters

    International Nuclear Information System (INIS)

    Rajan, K.K.; Jayakumar, T.; Aggarwal, P.K.; Vinod, V.

    2016-01-01

    Highlights: • Bypass type permanent magnet flow meters are more suitable for sodium flow measurement. • A higher sodium velocity through the PMFM sensor will increase its sensitivity and resolution. • By modifying the geometry of bypass line, higher sodium velocity through sensor is achieved. • With optimized geometry the sensitivity of bypass flow meter system was increased by 70%. - Abstract: Liquid sodium flow through the pipelines of sodium cooled fast breeder reactor circuits are measured using electromagnetic flow meters. Bypass type flow meter with a permanent magnet flow meter as sensor in the bypass line is selected for the flow measurement in the 800 NB main secondary pipe line of 500 MWe Prototype Fast Breeder Reactor (PFBR), which is at the advanced stage of construction at Kalpakkam. For increasing the sensitivity of bypass flow meters in future SFRs, alternative bypass geometry was considered. The performance enhancement of the proposed geometry was evaluated by experimental and numerical methods using scaled down models. From the studies it is observed that the new configuration increases the sensitivity of bypass flow meter system by around 70%. Using experimentally validated numerical tools the volumetric flow ratio for the bypass configurations is established for the operating range of Reynolds numbers.

  16. Basic study on an energy conversion system using boiling two-phase flows of temperature-sensitive magnetic fluid. Theoretical analysis based on thermal nonequilibrium model and flow visualization using ultrasonic echo

    International Nuclear Information System (INIS)

    Ishimoto, Jun; Kamiyama, Shinichi; Okubo, Masaaki.

    1995-01-01

    Effects of magnetic field on the characteristics of boiling two-phase pipe flow of temperature-sensitive magnetic fluid are clarified in detail both theoretically and experimentally. Firstly, governing equations of two-phase magnetic fluid flow based on the thermal nonequilibrium two-fluid model are presented and numerically solved considering evaporation and condensation between gas- and liquid-phases. Next, behaviour of vapor bubbles is visualized with ultrasonic echo in the region of nonuniform magnetic field. This is recorded and processed with an image processor. As a result, the distributions of void fraction in the two-phase flow are obtained. Furthermore, detailed characteristics of the two-phase magnetic fluid flow are investigated using a small test loop of the new energy conversion system. From the numerical and experimental results, it is known that the precise control of the boiling two-phase flow and bubble generation is possible by using the nonuniform magnetic field effectively. These fundamental studies on the characteristics of two-phase magnetic fluid flow will contribute to the development of the new energy conversion system using a gas-liquid boiling two-phase flow of magnetic fluid. (author)

  17. Flow visualization

    CERN Document Server

    Merzkirch, Wolfgang

    1974-01-01

    Flow Visualization describes the most widely used methods for visualizing flows. Flow visualization evaluates certain properties of a flow field directly accessible to visual perception. Organized into five chapters, this book first presents the methods that create a visible flow pattern that could be investigated by visual inspection, such as simple dye and density-sensitive visualization methods. It then deals with the application of electron beams and streaming birefringence. Optical methods for compressible flows, hydraulic analogy, and high-speed photography are discussed in other cha

  18. Parametric uncertainty and global sensitivity analysis in a model of the carotid bifurcation: Identification and ranking of most sensitive model parameters.

    Science.gov (United States)

    Gul, R; Bernhard, S

    2015-11-01

    In computational cardiovascular models, parameters are one of major sources of uncertainty, which make the models unreliable and less predictive. In order to achieve predictive models that allow the investigation of the cardiovascular diseases, sensitivity analysis (SA) can be used to quantify and reduce the uncertainty in outputs (pressure and flow) caused by input (electrical and structural) model parameters. In the current study, three variance based global sensitivity analysis (GSA) methods; Sobol, FAST and a sparse grid stochastic collocation technique based on the Smolyak algorithm were applied on a lumped parameter model of carotid bifurcation. Sensitivity analysis was carried out to identify and rank most sensitive parameters as well as to fix less sensitive parameters at their nominal values (factor fixing). In this context, network location and temporal dependent sensitivities were also discussed to identify optimal measurement locations in carotid bifurcation and optimal temporal regions for each parameter in the pressure and flow waves, respectively. Results show that, for both pressure and flow, flow resistance (R), diameter (d) and length of the vessel (l) are sensitive within right common carotid (RCC), right internal carotid (RIC) and right external carotid (REC) arteries, while compliance of the vessels (C) and blood inertia (L) are sensitive only at RCC. Moreover, Young's modulus (E) and wall thickness (h) exhibit less sensitivities on pressure and flow at all locations of carotid bifurcation. Results of network location and temporal variabilities revealed that most of sensitivity was found in common time regions i.e. early systole, peak systole and end systole. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. [Sensitivity and specificity of the cerebral blood flow reactions to acupuncture in the newborn infants presenting with hypoxic ischemic encephalopathy].

    Science.gov (United States)

    Filonenko, A V; Vasilenko, A M; Khan, M A

    2015-01-01

    To evaluate the effects of acupuncture integrated into the standard therapy, the condition of cerebral blood flow, and other syndromes associated with cerebral ischemia in the newborn infants. MATERIAL AND METHODS. A total of 131 pairs of puerperae and newborns with hypoxic ischemic encephalopathy were divided into four treatment groups. 34 children of the first group were given standard therapy (control), in the second group comprised of 33 mothers and children the standard treatment was supplemented by acupuncture, the third group included only 32 mothers given the acupuncture treatment alone, and the fourth group contained only 32 newborn infants treated by acupuncture. Each course of acupuncture treatment consisted of five sessions. Sensitivity and specificity of cerebral blood flow reactions were determined based on the results of the ROC-analysis and the area under the curve before and after the treatment. The treatment with the use of acupuncture greatly improved the cerebrospinal hemodynamics (p newborn babies. The high level of sensitivity (84.4-94.8%) associated with good specificity makes it possible to distinguish between the true positive and true negative cases. Acupuncture integrated into the treatment of "mother-baby" pairs presenting with hypoxic ischemic encephalopathy can be used to improve the initially low level of cerebral blood flow in neonates presenting with this condition.

  20. Consumer price sensitivity in Dutch health insurance

    NARCIS (Netherlands)

    M. van Dijk (Machiel); M. Pomp (Marc); R.C.H.M. Douven (Rudy); T. Laske-Aldershof (Trea); F.T. Schut (Erik); W. de Boer (Willem); A. Boo (Anne)

    2008-01-01

    textabstractAim: To estimate the price sensitivity of consumer choice of health insurance firm. Method: Using paneldata of the flows of insured betweenpairs of Dutch sickness funds during the period 1993-2002, we estimate the sensitivity of these flows to differences in insurance premium. Results:

  1. Rapid and sensitive lateral flow immunoassay method for determining alpha fetoprotein in serum using europium (III) chelate microparticles-based lateral flow test strips

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Rong-Liang; Xu, Xu-Ping; Liu, Tian-Cai; Zhou, Jian-Wei; Wang, Xian-Guo; Ren, Zhi-Qi [Institute of Antibody Engineering, School of Biotechnology, Southern Medical University, Guangzhou 510515, Guangdong (China); Hao, Fen [DaAn Gene Co. Ltd. of Sun Yat-sen University, 19 Xiangshan Road, Guangzhou 510515 (China); Wu, Ying-Song, E-mail: wg@smu.edu.cn [Institute of Antibody Engineering, School of Biotechnology, Southern Medical University, Guangzhou 510515, Guangdong (China)

    2015-09-03

    Alpha-fetoprotein (AFP), a primary marker for many diseases including various cancers, is important in clinical tumor diagnosis and antenatal screening. Most immunoassays provide high sensitivity and accuracy for determining AFP, but they are expensive, often complex, time-consuming procedures. A simple and rapid point-of-care system that integrates Eu (III) chelate microparticles with lateral flow immunoassay (LFIA) has been developed to determine AFP in serum with an assay time of 15 min. The approach is based on a sandwich immunoassay performed on lateral flow test strips. A fluorescence strip reader was used to measure the fluorescence peak heights of the test line (H{sub T}) and the control line (H{sub C}); the H{sub T}/H{sub C} ratio was used for quantitation. The Eu (III) chelate microparticles-based LFIA assay exhibited a wide linear range (1.0–1000 IU mL{sup −1}) for AFP with a low limit of detection (0.1 IU mL{sup −1}) based on 5ul of serum. Satisfactory specificity and accuracy were demonstrated and the intra- and inter-assay coefficients of variation (CV) for AFP were both <10%. Furthermore, in the analysis of human serum samples, excellent correlation (n = 284, r = 0.9860, p < 0.0001) was obtained between the proposed method and a commercially available CLIA kit. Results indicated that the Eu (III) chelate microparticles-based LFIA system provided a rapid, sensitive and reliable method for determining AFP in serum, indicating that it would be suitable for development in point-of-care testing. - Highlights: • Europium (III) chelate microparticles was used as a label for LIFA. • Quantitative detection by using H{sub T}/H{sub C} ratio was achieved. • LIFA for simple and rapid AFP detection in human serum. • The sensitivity and linearity was more excellent compared with QD-based ICTS. • This method could be developed for rapid point-of-care screening.

  2. A Sensitive Photometric Procedure for Cobalt Determination in Water Employing a Compact Multicommuted Flow Analysis System.

    Science.gov (United States)

    da Silva Magalhães, Ticiane; Reis, Boaventura F

    2017-09-01

    In this work, a multicommuted flow analysis procedure is proposed for the spectrophotometric determination of cobalt in fresh water, employing an instrument setup of downsized dimension and improved cost-effectiveness. The method is based on the catalytic effect of Co(II) on the Tiron oxidation by hydrogen peroxide in alkaline medium, forming a complex that absorbs radiation at 425 nm. The photometric detection was accomplished using a homemade light-emitting-diode (LED)-based photometer designed to use a flow cell with an optical path-length of 100 mm to improve sensitivity. After selecting adequate values for the flow system variables, adherence to the Beer-Lambert-Bouguer law was observed for standard solution concentrations in the range of 0.13-1.5 µg L -1 Co(II). Other useful features including a relative standard deviation of 2.0% (n = 11) for a sample with 0.49 µg L -1 Co(II), a detection limit of 0.06 µg L -1 Co(II) (n = 20), an analytical frequency of 42 sample determinations per hour, and waste generation of 1.5 mL per determination were achieved.

  3. Contrast-enhanced MR angiography

    International Nuclear Information System (INIS)

    Bosmans, H.; Marchal, G.

    1996-01-01

    Despite many optimizations, the current limitations of plain MR angiography include: Saturation that impairs the visualization of veins and arteries with slow flow and spin-dephasing signal voids in locations with turbulent flow. Recently, the use of contrast agents has been proposed to cope with these remaining problems. Because of induced shortening of the T1 of the blood, saturation in the blood vessels is overcome. As a result, arteries and veins are visualized with the same signal intensity, which makes the technique less flow-dependent. In combination with short T1-weighted acquisitions, today CE MRA can be obtained while the patient is holding his breath. This last approach is most promising for abdominal applications since the respiratory motion can be frozen. As these acquisitions also use very short echo times, spin dephasing can be reduced. In conclusion, the use of contrast agents has greatly increased the clinical usefulness of MR angiography. (orig.) [de

  4. A sensitivity analysis of the mass balance equation terms in subcooled flow boiling

    International Nuclear Information System (INIS)

    Braz Filho, Francisco A.; Caldeira, Alexandre D.; Borges, Eduardo M.

    2013-01-01

    In a heated vertical channel, the subcooled flow boiling occurs when the fluid temperature reaches the saturation point, actually a small overheating, near the channel wall while the bulk fluid temperature is below this point. In this case, vapor bubbles are generated along the channel resulting in a significant increase in the heat flux between the wall and the fluid. This study is particularly important to the thermal-hydraulics analysis of Pressurized Water Reactors (PWRs). The computational fluid dynamics software FLUENT uses the Eulerian multiphase model to analyze the subcooled flow boiling. In a previous paper, the comparison of the FLUENT results with experimental data for the void fraction presented a good agreement, both at the beginning of boiling as in nucleate boiling at the end of the channel. In the region between these two points the comparison with experimental data was not so good. Thus, a sensitivity analysis of the mass balance equation terms, steam production and condensation, was performed. Factors applied to the terms mentioned above can improve the agreement of the FLUENT results to the experimental data. Void fraction calculations show satisfactory results in relation to the experimental data in pressures values of 15, 30 and 45 bars. (author)

  5. A short TE gradient-echo sequence using asymmetric sampling

    International Nuclear Information System (INIS)

    Fujita, Norihiko; Harada, Kohshi; Sakurai, Kosuke; Nakanishi, Katsuyuki; Kim, Shyogen; Kozuka, Takahiro

    1990-01-01

    We have developed a gradient-echo pulse sequence with a short TE less than 4 msec using a data set of asymmetric off-center sampling with a broad bandwidth. The use of such a short TE significantly reduces T 2 * dephasing effect even in a two-dimensional mode, and by collecting an off-center echo, motion-induced phase dispersion is also considerably decreased. High immunity of this sequence to these dephasing effects permits clear visualization of anatomical details near the skull base where large local field inhomogeneities and rapid blood flow such as in the internal carotid artery are present. (author)

  6. Somatoform and psychoform dissociation among women with orgasmic and sexual pain disorders.

    Science.gov (United States)

    Farina, Benedetto; Mazzotti, Eva; Pasquini, Paolo; Mantione, Maria Giuseppina

    2011-01-01

    Since the 20th century, psychogenic female sexual dysfunctions (FSD), like some somatoform and conversion disorders, have been considered an expression of somatoform dissociation. Several studies have reported dissociative symptoms in different somatoform and conversion disorders, but limited data are available on dissociation among patients with FSD. The aim of this study was to assess somatoform and psychoform dissociation among patients with women's orgasmic disorder, dyspareunia, and vaginismus. A battery of self-administered questionnaires (Somatoform Dissociation Questionnaire, Dissociative Experiences Scale, Hospital Anxiety and Depression Scale, Impact of Event Scale-Revised) was given to 200 gynecological outpatients to assess psychoform and somatoform dissociation and their association with FSD. A strong association between somatoform dissociation and FSD was observed (adjusted odds ratio [OR] = 5.39, 95% confidence interval [CI] = 1.15-25.32), the association between somatoform and psychoform dissociation being estimated by an adjusted OR of 4.83 (95% CI = 1.17-19.91). Our results are compatible with the idea that some forms of FSD could be regarded as somatoform dissociative disorders.

  7. First Significant Digits and the Credit Derivative Market During the Financial Crisis

    Directory of Open Access Journals (Sweden)

    Paul Hofmarcher

    2013-06-01

    Full Text Available The Credit Default Swap (CDS market has both been lauded for its ability to stabilize the financial system through credit risk transfers and been the source of regulatory concern due to its size and lack of transparency. As a decentralized over-the-counter market, detailed information about pricing mechanisms is rather scarce. To investigate reported CDS prices (spreads more closely, we make use of empirical First Significant Digit (FSD distributions and analyze daily CDS prices for European and US entities during the financial crisis starting in 2007. We find that on a time-aggregated level, the European and US markets obey empirical FSD distributions similar to the theoretical ones. Surprising differences are observed in the development of the FSD distributions between the US and European markets. Whereas the FSD distribution of the US derivative market behaves nearly constantly during the last financial crisis, we find huge fluctuations in the FSD distribution of the European market. One reason for these differences might be the possibility of strategic default for US companies due to Chapter 11 and avoided contagion effects.

  8. The effect of thermal de-phasing on the beam quality of a high-power single-pass second harmonic generation

    Science.gov (United States)

    Sadat Hashemi, Somayeh; Ghavami Sabouri, Saeed; Khorsandi, Alireza

    2018-04-01

    We present a theoretical model in order to study the effect of a thermally loaded crystal on the quality of a second-harmonic (SH) beam generated in a high-power pumping regime. The model is provided based on using a particular structure of oven considered for MgO:PPsLT nonlinear crystal to compensate for the thermal de-phasing effect that as the pumping power reaches up to 50 W degrades the conversion efficiency and beam quality of the interacting beams. Hereupon, the quality of fundamental beam is involved in the modeling to investigate the final effect on the beam quality of generated SH beam. Beam quality evaluation is subsequently simulated using Hermite-Gaussian modal decomposition approach for a range of fundamental beam qualities varied from 1 to 3 and for different levels of input powers. To provide a meaningful comparison numerical simulation is correlated with real data deduced from a high-power SH generation (SHG) experimental device. It is found that when using the open-top oven scheme and fixing the fundamental M 2-factor at nearly 1, for a range of input powers changing from 15 to 30 W, the M 2-factor of SHG beam is degraded from 9% to 24%, respectively, confirming very good consistency with the reported experimental results.

  9. Views and Experiences of Malaysian Family Medicine Trainees of Female Sexual Dysfunction.

    Science.gov (United States)

    Lai, Pauline Siew Mei; Tan, Sing Yee; Liew, Su May

    2016-11-01

    Sociocultural factors have been shown to be important influencers of sexual health and sexuality. Hence, the aim of our study was to explore the views and experiences of family medicine trainees regarding female sexual dysfunction (FSD) with a focus on the barriers and facilitators towards the initiation of conversation on this topic. A qualitative study design involving semi-structured focus group discussions (FGDs) was conducted with 19 family medicine trainees in Malaysia. The conceptual framework used was based on the Theory of Planned Behavior. Thematic approach was used to analyze the data. Participants perceived FSD as being uncommon and unimportant. According to our participants, patients often presented with indirect complaints, and doctors were not proactive in asking about FSD. Three main barriers were identified: doctor factors, perceived patient factors, and system factors. Lack of confidence, knowledge, experience, time, and embarrassment were the key barriers identified at the doctors' level. Lack of awareness, among patients regarding FSD, and local cultural and religious norms were the perceived patient barriers. System barriers were lack of time and privacy. Various facilitators, such as continuous medical education and public forums, were suggested as means to encourage family medicine trainees to initiate discussion on sexual matters during consultations. In conclusion, family medicine trainees found it difficult to initiate conversation on FSD with patients. Interventions to encourage conversation on FSD should target this and other identified barriers.

  10. Applying Turbulence Models to Hydroturbine Flows: A Sensitivity Analysis Using the GAMM Francis Turbine

    Science.gov (United States)

    Lewis, Bryan; Cimbala, John; Wouden, Alex

    2011-11-01

    Turbulence models are generally developed to study common academic geometries, such as flat plates and channels. Creating quality computational grids for such geometries is trivial, and allows stringent requirements to be met for boundary layer grid refinement. However, engineering applications, such as flow through hydroturbines, require the analysis of complex, highly curved geometries. To produce body-fitted grids for such geometries, the mesh quality requirements must be relaxed. Relaxing these requirements, along with the complexity of rotating flows, forces turbulence models to be employed beyond their developed scope. This study explores the solution sensitivity to boundary layer grid quality for various turbulence models and boundary conditions currently implemented in OpenFOAM. The following models are resented: k-omega, k-omega SST, k-epsilon, realizable k-epsilon, and RNG k-epsilon. Standard wall functions, adaptive wall functions, and sub-grid integration are compared using various grid refinements. The chosen geometry is the GAMM Francis Turbine because experimental data and comparison computational results are available for this turbine. This research was supported by a grant from the DoE and a National Defense Science and Engineering Graduate Fellowship.

  11. Prevalence and risk factors for female sexual dysfunction in women attending a medical clinic in south India

    Directory of Open Access Journals (Sweden)

    Singh J

    2009-01-01

    Full Text Available Background: Reports from India on the prevalence and determinants of female sexual dysfunction (FSD are scant. Aims: To determine the prevalence and risk factors for FSD. Settings and Design: A cross-sectional survey in a medical outpatient clinic of a tertiary care hospital. Materials and Methods: We administered a Tamil version of the Female Sexual Function Index (FSFI to 149 married women. We evaluated putative risk factors for FSD. We elicited participant′s attributions for their sexual difficulties. Statistical Analysis: We estimated the prevalence of possible FSD and sexual difficulties from published FSFI total and domain cut-off scores. We used logistic regression to identify risk factors for possible FSD. Results: FSFI total scores suggested FSD in two-thirds of the 149 women (73.2%; 95% confidence intervals [CI] 65.5% to 79.6%. FSFI domain scores suggested difficulties with desire in 77.2%; arousal in 91.3%; lubrication in 96.6%; orgasm in 86.6%, satisfaction in 81.2%, and pain in 64.4%. Age above 40 years (odds ratios [OR] 11.7; 95% CI 3.4 to 40.1 and fewer years of education (OR 1.2; 95% CI 1.0 to 1.3 were identified by logistic regression as contributory. Women attributed FSD to physical illness in participant or partner, relationship problems, and cultural taboos but none had sought professional help. Conclusions: Sexual problems suggestive of dysfunction, as suggested by FSFI total and domain scores, are highly prevalent in the clinic setting, particularly among women above 40 and those less educated, but confirmation using locally validated cut-off scores of the FSFI is needed.

  12. Magnetic state dependent transient lateral photovoltaic effect in patterned ferromagnetic metal-oxide-semiconductor films

    Directory of Open Access Journals (Sweden)

    Isidoro Martinez

    2015-11-01

    Full Text Available We investigate the influence of an external magnetic field on the magnitude and dephasing of the transient lateral photovoltaic effect (T-LPE in lithographically patterned Co lines of widths of a few microns grown over naturally passivated p-type Si(100. The T-LPE peak-to-peak magnitude and dephasing, measured by lock-in or through the characteristic time of laser OFF exponential relaxation, exhibit a notable influence of the magnetization direction of the ferromagnetic overlayer. We show experimentally and by numerical simulations that the T-LPE magnitude is determined by the Co anisotropic magnetoresistance. On the other hand, the magnetic field dependence of the dephasing could be described by the influence of the Lorentz force acting perpendiculary to both the Co magnetization and the photocarrier drift directions. Our findings could stimulate the development of fast position sensitive detectors with magnetically tuned magnitude and phase responses.

  13. Sexual dysfunction and relationship stress: how does this association vary for men and women?

    Science.gov (United States)

    McCabe, Marita P; Connaughton, Catherine

    2017-02-01

    This paper examines the association between relationship stress and sexual dysfunction. The results demonstrated a strong association between female sexual dysfunction (FSD) and relationship stress, and between male sexual dysfunction (MSD) and relationship stress among their female partners. No studies examined the association between FSD and relationship stress of male partners. Treatment for MSD was associated with improved relationship stress for female partners, but no studies were located that examined this association for treatment of FSD. These findings suggest that FSD and relationship stress are strongly related, but the association does not seem to be so strong for men. The review highlights the need for further research in this field to inform therapy for both sexual dysfunction and relationship problems. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. An electrode polarization impedance based flow sensor for low water flow measurement

    International Nuclear Information System (INIS)

    Yan, Tinghu; Sabic, Darko

    2013-01-01

    This note describes an electrode polarization impedance based flow sensor for low water flow measurement. It consists of two pairs of stainless steel electrodes set apart and inserted into a non-conductive flow tube with each pair of electrodes placed diametrically at the opposite sides. The flow sensor is modeled as a typical four-electrode system of which two electrodes are current-carrying and the other two serve as output pick ups. The polarization impedances of the two current carrying electrodes are affected by water flows resulting in changes of differential potential between the two pick-up electrodes which are separated by the same fluid. The interrogation of the two excitation electrodes with dc biased ac signals offers significantly higher sensor sensitivities to flow. The prototype flow sensor constructed for a 20 mm diameter pipeline was able to measure water flow rate as low as tested at 1.06 l h −1 and remained sensitive at a flow rate of 25.18 l h −1 when it was driven with a sinusoidal voltage at 1000 Hz with a peak ac amplitude of 2 V and a dc offset of +8 V. The nonlinear characteristics of the sensor response indicate that the sensor is more sensitive at low flows and will not be able to measure at very high flows. Additional experiments are needed to evaluate the influences of impurities, chemical species, ions constituents, conductivity and temperature over a practical range of residential water conditions, the effects of fluctuating ground signals, measurement uncertainty, power consumption, compensation of effects and practical operations. The flow sensor (principle) presented may be used as (in) a secondary sensor in combination with an existing electronic water meter to extend the low end of measurement range in residential water metering. (technical design note)

  15. A multi-pumping flow-based procedure with improved sensitivity for the spectrophotometric determination of acid-dissociable cyanide in natural waters.

    Science.gov (United States)

    Frizzarin, Rejane M; Rocha, Fábio R P

    2013-01-03

    An analytical procedure with improved sensitivity was developed for cyanide determination in natural waters, exploiting the reaction with the complex of Cu(I) with 2,2'-biquinoline 4,4'-dicarboxylic acid (BCA). The flow system was based on the multi-pumping approach and long pathlength spectrophotometry with a flow cell based on a Teflon AF 2400(®) liquid core waveguide was exploited to increase sensitivity. A linear response was achieved from 5 to 200μg L(-1), with coefficient of variation of 1.5% (n=10). The detection limit and the sampling rate were 2μg L(-1) (99.7% confidence level), and 22h(-1), respectively. Per determination, 48ng of Cu(II), 5μg of ascorbic acid and 0.9μg of BCA were consumed. As high as 100mg L(-1) thiocyanate, nitrite or sulfite did not affect cyanide determination. Sulfide did not interfere at concentrations lower than 40 and 200μg L(-1) before or after sample pretreatment with hydrogen peroxide. The results for natural waters samples agreed with those obtained by a fluorimetric flow-based procedure at the 95% confidence level. The proposed procedure is then a reliable, fast and environmentally friendly alternative for cyanide determination in natural waters. Copyright © 2012 Elsevier B.V. All rights reserved.

  16. Vortex dynamics in a pipe T-junction: Recirculation and sensitivity

    Science.gov (United States)

    Chen, Kevin K.; Rowley, Clarence W.; Stone, Howard A.

    2015-03-01

    In the last few years, many researchers have noted that regions of recirculating flow often exhibit particularly high sensitivity to spatially localized feedback. We explore the flow through a T-shaped pipe bifurcation—a simple and ubiquitous, but generally poorly understood flow configuration—and provide a complex example of the relation between recirculation and sensitivity. When Re ≥ 320, a phenomenon resembling vortex breakdown occurs in four locations in the junction, with internal stagnation points appearing on vortex axes and causing flow reversal. The structure of the recirculation is similar to the traditional bubble-type breakdown. These recirculation regions are highly sensitive to spatially localized feedback in the linearized Navier-Stokes operator. The flow separation at the corners of the "T," however, does not exhibit this kind of sensitivity. We focus our analysis on the Reynolds number of 560, near the first Hopf bifurcation of the flow.

  17. Female Sexual Dysfunction

    Science.gov (United States)

    ... all contribute to FSD. Causes of FSD General Physical Health problems: diabetes, heart disease, cancer, arthritis, multiple sclerosis, or alcohol abuse Medicines to treat high blood pressure, depression, pain; oral contraceptives Gynecological Medical conditions such as ...

  18. Flow Cytometry Pulse Width Data Enables Rapid and Sensitive Estimation of Biomass Dry Weight in the Microalgae Chlamydomonas reinhardtii and Chlorella vulgaris

    Science.gov (United States)

    Chioccioli, Maurizio; Hankamer, Ben; Ross, Ian L.

    2014-01-01

    Dry weight biomass is an important parameter in algaculture. Direct measurement requires weighing milligram quantities of dried biomass, which is problematic for small volume systems containing few cells, such as laboratory studies and high throughput assays in microwell plates. In these cases indirect methods must be used, inducing measurement artefacts which vary in severity with the cell type and conditions employed. Here, we utilise flow cytometry pulse width data for the estimation of cell density and biomass, using Chlorella vulgaris and Chlamydomonas reinhardtii as model algae and compare it to optical density methods. Measurement of cell concentration by flow cytometry was shown to be more sensitive than optical density at 750 nm (OD750) for monitoring culture growth. However, neither cell concentration nor optical density correlates well to biomass when growth conditions vary. Compared to the growth of C. vulgaris in TAP (tris-acetate-phosphate) medium, cells grown in TAP + glucose displayed a slowed cell division rate and a 2-fold increased dry biomass accumulation compared to growth without glucose. This was accompanied by increased cellular volume. Laser scattering characteristics during flow cytometry were used to estimate cell diameters and it was shown that an empirical but nonlinear relationship could be shown between flow cytometric pulse width and dry weight biomass per cell. This relationship could be linearised by the use of hypertonic conditions (1 M NaCl) to dehydrate the cells, as shown by density gradient centrifugation. Flow cytometry for biomass estimation is easy to perform, sensitive and offers more comprehensive information than optical density measurements. In addition, periodic flow cytometry measurements can be used to calibrate OD750 measurements for both convenience and accuracy. This approach is particularly useful for small samples and where cellular characteristics, especially cell size, are expected to vary during growth. PMID

  19. Sensitivity and uncertainty analysis

    CERN Document Server

    Cacuci, Dan G; Navon, Ionel Michael

    2005-01-01

    As computer-assisted modeling and analysis of physical processes have continued to grow and diversify, sensitivity and uncertainty analyses have become indispensable scientific tools. Sensitivity and Uncertainty Analysis. Volume I: Theory focused on the mathematical underpinnings of two important methods for such analyses: the Adjoint Sensitivity Analysis Procedure and the Global Adjoint Sensitivity Analysis Procedure. This volume concentrates on the practical aspects of performing these analyses for large-scale systems. The applications addressed include two-phase flow problems, a radiative c

  20. Sexual Dysfunction in Women With Migraine and Overweight/Obesity: Relative Frequency and Association With Migraine Severity.

    Science.gov (United States)

    Bond, Dale S; Pavlović, Jelena M; Lipton, Richard B; Graham Thomas, J; Digre, Kathleen B; Roth, Julie; Rathier, Lucille; O'Leary, Kevin C; Evans, E Whitney; Wing, Rena R

    2017-03-01

    Previous studies suggest that migraine might be associated with female sexual dysfunction (FSD), although this association may be complicated by overweight/obesity. To disentangle relationships of migraine and obesity with FSD, we examined: (1) FSD rates in women who had migraine and obesity with a matched sample of women with obesity who were free of migraine and (2) associations between indices of migraine severity and FSD in a larger sample of participants with migraine and overweight/obesity, controlling for important confounders. Women with migraine and obesity seeking behavioral weight loss treatment to decrease headaches (n = 37) and nonmigraine controls (n = 37) with obesity seeking weight loss via bariatric surgery were matched on age (±5 years), body mass index (BMI; ±3 kg/m 2 ), and reported sexual activity during the past month. Both groups completed the Female Sexual Function Index (FSFI), with a validated FSFI-total cutoff score used to define FSD. In participants with migraine and overweight/obesity (n = 105), separate logistic regression models evaluated associations of migraine attack frequency, intensity, and duration with odds of having FSD, controlling for age, BMI, depression, and anxiety. On average, participants and matched controls had severe obesity (BMI = 42.4 ± 3.8 kg/m 2 ; range = 35-49.9) and were 37.3 ± 7.2 years of age (range = 22-50). FSD rate did not differ between migraine participants and controls (56.8% vs. 54.1%, P = .82). In the larger sample of participants with migraine and overweight/obesity (38.2 ± 7.8 years of age; BMI = 34.8 ± 6.4 [range = 25-50 kg/m 2 ]; 8.0 ± 4.3 migraine days/month, maximum pain intensity = 5.9 ± 1.4 on 0-10 scale; average attack duration = 18.3 ± 9.7 hours), FSD was not associated with attack frequency (P = .31), pain intensity (P = .92), or attack duration (P = .35) but was associated with more severe anxiety

  1. Sensitivity analysis of a coupled hydro-mechanical paleo-climate model of density-dependent groundwater flow in discretely fractured crystalline rock

    International Nuclear Information System (INIS)

    Normani, S.D.; Sykes, J.F.

    2011-01-01

    A high resolution three-dimensional sub-regional scale (104 km 2 ) density-dependent, discretely fractured groundwater flow model with hydro-mechanical coupling and pseudo-permafrost was developed from a larger 5734 km 2 regional-scale groundwater flow model of a Canadian Shield setting. The objective of the work is to determine the sensitivity of modelled groundwater system evolution to the hydro-mechanical parameters. The discrete fracture dual continuum numerical model FRAC3DVS-OPG was used for all simulations. A discrete fracture network model delineated from surface features was superimposed onto an approximate 790 000 element domain mesh with approximately 850 000 nodes. Orthogonal fracture faces (between adjacent finite element grid blocks) were used to best represent the irregular discrete fracture zone network. Interconnectivity of the permeable fracture zones is an important pathway for the possible migration and subsequent reduction in groundwater and contaminant residence times. The crystalline rock matrix between these structural discontinuities was assigned mechanical and flow properties characteristic of those reported for the Canadian Shield. The variation of total dissolved solids with depth was assigned using literature data for the Canadian Shield. Performance measures for the sensitivity analysis include equivalent freshwater heads, environmental heads, linear velocities, and depth of penetration by conservative non-decaying tracers released at the surface. A 121 000 year North American continental scale paleo-climate simulation was applied to the domain with ice-sheet histories estimated by the University of Toronto Glacial Systems Model (UofT GSM). Hydro-mechanical coupling between the rock matrix and the pore fluid, due to the ice sheet normal stress, was included in the simulations. The flow model included the influence of vertical strain and assumed that areal loads were homogeneous. Permafrost depth was applied as a permeability reduction

  2. Developing Sensitivity Indicators for Hydraulic Perturbation

    Directory of Open Access Journals (Sweden)

    M.M. Heidari

    2016-02-01

    Full Text Available Introduction: Determination the hydraulic performance of an irrigation network requires adequate knowledge about the sensitivities of the network structures. Hydraulic sensitivity concept of structures and channel reaches aid network operators in identifying structures with higher sensitivities which will attract more attention both during network operation and maintenance program. Sluice gates are frequently used as regulator and delivery structures in irrigation networks. Usually discharge coefficient of sluice gate is considered constant in the design and operation stage. Investigation of sensitivity of offtakes and cross-regulators has carried out by various researchers and some hydraulic sensitivity indicators have been developed. In the previous researches, these indexes were developed based on constant coefficient of discharge for free flow sluice gates. However, the coefficient of discharge for free flow sluice gates depend on gate opening and the upstream water depth. So, in this research, some hydraulic sensitivity indicators at structure based on variable coefficient of discharge for free flow sluice gates were developed and they were validated by using observed data. Materials and Methods: An experimental setup was constructed to analyses the performance of the some hydraulic sensitivity. The flume was provided with storage reservoir, pumps, electromagnetic flowmeter, entrance tank, feeder canal, delivery canals, offtakes, cross-regulators, collector reservoir, piezometric boards. The flume is 60.5 m long and the depth of that is 0.25 m, of which only a small part close to offtake and Cross-regulators was needed for these tests. Offtakes and Cross-regulators are free-flowing sluice gates type. Offtakes were located at distances 20 m and 42.5 m downstream from the entrance tank, respectively. and, Cross-regulators were located 2 m downstream from each offtakes. The offtakes are 0.21 m and Cross-regulators are 0.29 m wide. The upstream

  3. Factors associated with sexual dysfunction in Jordanian women and their sexual attitudes

    International Nuclear Information System (INIS)

    Ali, Ruba M. Abu; AlHajeri Rabaa M; Khader, Yousef S; Ajlouni, Kamel M

    2009-01-01

    Female sexual dysfunction (FSD) is defined as disorders of libido, arousal, and orgasm, as well as sexual pain, that leads to personal distress or interpersonal difficulties. Social aspects of FSD have been understudied. The aim of this study was to explore the social aspects of FSD and sexual attitudes of Jordanian women. Six hundred thirteen married females were studied between October 2006 and August 2007 at the National Center for Diabetes, Endocrinology and Genetics (NCDEG), Amman, Jordan. Females were interviewed using a special questionnaire that was suitable to our culture and added to the Arabic translation of the Female Sexual Function Index (FSFI) Questionnaire. Older age was associated with a decreased total FSD index and its domain scores. Women with obesity were more likely to have impaired arousability and impaired capability of reaching orgasm. About 58.5% of women reported that they prepared themselves if they had sexual desire and 68.2% reported wearing special attire for this purpose. Only 37.2% of women could ask their husband for a special excitement. FSD is prevalent in Jordan. Its social aspects are understudied and need more research in the future. (author)

  4. Automatic fission source convergence criteria for Monte Carlo criticality calculations

    International Nuclear Information System (INIS)

    Shim, Hyung Jin; Kim, Chang Hyo

    2005-01-01

    The Monte Carlo criticality calculations for the multiplication factor and the power distribution in a nuclear system require knowledge of stationary or fundamental-mode fission source distribution (FSD) in the system. Because it is a priori unknown, so-called inactive cycle Monte Carlo (MC) runs are performed to determine it. The inactive cycle MC runs should be continued until the FSD converges to the stationary FSD. Obviously, if one stops them prematurely, the MC calculation results may have biases because the followup active cycles may be run with the non-stationary FSD. Conversely, if one performs the inactive cycle MC runs more than necessary, one is apt to waste computing time because inactive cycle MC runs are used to elicit the fundamental-mode FSD only. In the absence of suitable criteria for terminating the inactive cycle MC runs, one cannot but rely on empiricism in deciding how many inactive cycles one should conduct for a given problem. Depending on the problem, this may introduce biases into Monte Carlo estimates of the parameters one tries to calculate. The purpose of this paper is to present new fission source convergence criteria designed for the automatic termination of inactive cycle MC runs

  5. Biomimetic micromechanical adaptive flow-sensor arrays

    NARCIS (Netherlands)

    Krijnen, Gijsbertus J.M.; Floris, J.; Dijkstra, Marcel; Lammerink, Theodorus S.J.; Wiegerink, Remco J.

    2007-01-01

    We report current developments in biomimetic flow-sensors based on flow sensitive mechano-sensors of crickets. Crickets have one form of acoustic sensing evolved in the form of mechanoreceptive sensory hairs. These filiform hairs are highly perceptive to low-frequency sound with energy sensitivities

  6. Simultaneous measurements of global vibrational spectra and dephasing times of molecular vibrational modes by broadband time-resolved coherent anti-Stokes Raman scattering spectrography

    International Nuclear Information System (INIS)

    Yin Jun; Yu Ling-Yao; Liu Xing; Wan Hui; Lin Zi-Yang; Niu Han-Ben

    2011-01-01

    In broadband coherent anti-Stokes Raman scattering (CARS) spectroscopy with supercontinuum (SC), the simultaneously detectable spectral coverage is limited by the spectral continuity and the simultaneity of various spectral components of SC in an enough bandwidth. By numerical simulations, the optimal experimental conditions for improving the SC are obtained. The broadband time-resolved CARS spectrography based on the SC with required temporal and spectral distributions is realised. The global molecular vibrational spectrum with well suppressed nonresonant background noise can be obtained in a single measurement. At the same time, the measurements of dephasing times of various molecular vibrational modes can be conveniently achieved from intensities of a sequence of time-resolved CARS signals. It will be more helpful to provide a complete picture of molecular vibrations, and to exhibit a potential to understand not only both the solvent dynamics and the solute-solvent interactions, but also the mechanisms of chemical reactions in the fields of biology, chemistry and material science. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

  7. Mobile Phone Ratiometric Imaging Enables Highly Sensitive Fluorescence Lateral Flow Immunoassays without External Optical Filters.

    Science.gov (United States)

    Shah, Kamal G; Singh, Vidhi; Kauffman, Peter C; Abe, Koji; Yager, Paul

    2018-05-14

    Paper-based diagnostic tests based on the lateral flow immunoassay concept promise low-cost, point-of-care detection of infectious diseases, but such assays suffer from poor limits of detection. One factor that contributes to poor analytical performance is a reliance on low-contrast chromophoric optical labels such as gold nanoparticles. Previous attempts to improve the sensitivity of paper-based diagnostics include replacing chromophoric labels with enzymes, fluorophores, or phosphors at the expense of increased fluidic complexity or the need for device readers with costly optoelectronics. Several groups, including our own, have proposed mobile phones as suitable point-of-care readers due to their low cost, ease of use, and ubiquity. However, extant mobile phone fluorescence readers require costly optical filters and were typically validated with only one camera sensor module, which is inappropriate for potential point-of-care use. In response, we propose to couple low-cost ultraviolet light-emitting diodes with long Stokes-shift quantum dots to enable ratiometric mobile phone fluorescence measurements without optical filters. Ratiometric imaging with unmodified smartphone cameras improves the contrast and attenuates the impact of excitation intensity variability by 15×. Practical application was shown with a lateral flow immunoassay for influenza A with nucleoproteins spiked into simulated nasal matrix. Limits of detection of 1.5 and 2.6 fmol were attained on two mobile phones, which are comparable to a gel imager (1.9 fmol), 10× better than imaging gold nanoparticles on a scanner (18 fmol), and >2 orders of magnitude better than gold nanoparticle-labeled assays imaged with mobile phones. Use of the proposed filter-free mobile phone imaging scheme is a first step toward enabling a new generation of highly sensitive, point-of-care fluorescence assays.

  8. Pressure sensitivity of flow oscillations in postocclusive reactive skin hyperemia.

    Science.gov (United States)

    Strucl, M; Peterec, D; Finderle, Z; Maver, J

    1994-05-01

    Skin blood flow was monitored using a laser-Doppler (LD) flowmeter in 21 healthy volunteers after an occlusion of the digital arteries. The peripheral vascular bed was exposed to occlusion ischemia of varying duration (1, 4, or 8 min) and to a change in digital arterial pressure produced by different positions of the arm above heart level to characterize the pattern of LD flow oscillations in postocclusive reactive hyperemia (PRH) and to elucidate the relevance of metabolic and myogenic mechanisms in governing its fundamental frequency. The descending part of the hyperemic flow was characterized by the appearance of conspicuous periodic oscillations with a mean fundamental frequency of 7.2 +/- 1.5 cycles/min (SD, n = 9), as assessed by a Fourier transform frequency analysis of 50-s sections of flow. The mean respiratory frequency during the periods of flow frequency analysis was 17.0 +/- 2.2 (SD, n = 9), and the PRH oscillations remained during apnea in all tested subjects. The area under the maximum flow curve increased significantly with prolongation of the occlusion (paired t test, P blood pressure in the digital arteries, which suggests the predominant role of a metabolic component in this part of the PRH response. In contrast, the fundamental frequency of PRH oscillations exhibited a significant decrease with a reduction in the estimated digital arterial pressure (linear regression, b = 0.08, P < 0.001; n = 12), but did not change with the prolongation of arterial occlusion despite a significant increase in mean LD flow (paired t test, P < 0.001; n = 9).(ABSTRACT TRUNCATED AT 250 WORDS)

  9. Development of a sexual function questionnaire for clinical trials of female sexual dysfunction

    NARCIS (Netherlands)

    Quirk, Frances H.; Heiman, Julia R.; Rosen, Raymond C.; Laan, Ellen; Smith, Michael D.; Boolell, Mitra

    2002-01-01

    OBJECTIVE: To better evaluate efficacy in clinical trials of drugs as potential treatments for female sexual dysfunctions (FSD), a brief, multidimensional measure of female sexual function was developed. METHODS: Data from semistructured interviews with 82 women with or without FSD, aged 19-65

  10. Female sexual dysfunction

    DEFF Research Database (Denmark)

    Giraldi, Annamaria; Wåhlin-Jacobsen, Sarah

    2016-01-01

    Female sexual dysfunction (FSD) is a controversial condition, which has prompted much debate regarding its aetiology, components, and even its existence. Our inability to work together as clinicians, psychologists, patients, and advocates hinders our understanding of FSD, and we will only improve...

  11. A Flow-Sensitive Analysis of Privacy Properties

    DEFF Research Database (Denmark)

    Nielson, Hanne Riis; Nielson, Flemming

    2007-01-01

    that information I send to some service never is leaked to another service? - unless I give my permission? We shall develop a static program analysis for the pi- calculus and show how it can be used to give privacy guarantees like the ones requested above. The analysis records the explicit information flow...

  12. Development of nanobody-based flow injection chemiluminescence immunoassay for sensitive detection of human prealbumin.

    Science.gov (United States)

    Ma, Lei; Sun, Yanyan; Kang, Xuejun; Wan, Yakun

    2014-11-15

    Nanobodies, derived from camelid heavy-chain antibodies, have novel and impactful applications in clinical diagnostics. Our objective is to develop a nanobody-based chemiluminescence immunoassay for sensitive detection of human prealbumin (PA). In this context, a phage display nanobody library is constructed via immunizing dromedary camel with human prealbumin. Three nanobodies have been identified by five successive bio-panning steps. Based on their high expression level and good affinity, two out of three are chosen for further study. Magnetic beads (MBs) were functionalized with PEI by acylamide bond formed between the carboxyl group on the surface of the MB. Then, an anti-PA nanobody (Nb1) can be effectively immobilized onto the surface of the functionalized MB using glutaradehyde as the link. The modified MBs with Nb1 can specifically capture the target PA and reacted with silica nanoparticles with co-immobilized HRP and anti-PA nanobody (Nb2). The concentration of PA was detected by flow injection chemiluminescence. When using MB/PEI as the carrier of anti-PA Nb1, the CL signal significantly increased to 4-fold compared with the signal using MB without PEI modification. The CL signal was further amplified to 5-fold when Si/Nb2 was used as the signal probe. Under optimized conditions, the present immunoassay exhibited a wide quantitative range from 0.05 to 1000 μg L(-1) with a detection limit of 0.01 μg L(-1). The sensitivity of the proposed immunoassay offers great promises in providing a sensitive, specific, time saving, and potential method for detecting PA in clinical settings. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. Prevalence of and risk factors for sexual dysfunction in young Chinese women according to the Female Sexual Function Index: an internet-based survey.

    Science.gov (United States)

    Du, Juan; Ruan, Xiangyan; Gu, Muqing; Bitzer, Johannes; Mueck, Alfred O

    2016-06-01

    Female sexual dysfunction (FSD) is a very common sexual health problem worldwide. The prevalence of FSD in Chinese women is, however, unknown. This is the first study to investigate a large number of young women throughout China via the internet, to determine the prevalence and types of FSD and to identify the risk factors for FSD. The primary endpoint was the Female Sexual Function Index (FSFI) score, with additional questions on contraception, sexual activity, relationship stability, pregnancy and other factors which may influence sexual function. The online questionnaire was completed by women from 31 of the 34 Chinese provinces. A total of 1618 completed questionnaires were received, and 1010 were included in the analyses after screening (62.4%). The mean age of the respondents was 25.1 ± 4.5 years. The mean total FSFI score was 24.99 ± 4.60. According to FSFI definitions (cut-off score 26.55), 60.2% of women were at risk of FSD. Based on domain scores, 52 were considered at high risk of dysfunction for pain (5.1%), 35 for orgasm (3.5%), 33 for desire (3.3%), 20 for arousal (2.0%), 6 for satisfaction (0.6%) and 2 for lubrication (0.2%). The prevalence of FSFI scores indicating risk of sexual dysfunction was about 60% in Chinese women. An unstable relationship, pressure to become pregnant, non-use of contraception, negative self-evaluation of appearance and increasing age were significantly associated with FSD in young Chinese women.

  14. Sensitive flow-injection spectrophotometric analysis of bromopride

    Science.gov (United States)

    Lima, Liliane Spazzapam; Weinert, Patrícia Los; Pezza, Leonardo; Pezza, Helena Redigolo

    2014-12-01

    A flow injection spectrophotometric procedure employing merging zones is proposed for direct bromopride determination in pharmaceutical formulations and biological fluids. The proposed method is based on the reaction between bromopride and p-dimethylaminocinnamaldehyde (p-DAC) in acid medium, in the presence of sodium dodecyl sulfate (SDS), resulting in formation of a violet product (λmax = 565 nm). Experimental design methodologies were used to optimize the experimental conditions. The Beer-Lambert law was obeyed in a bromopride concentration range of 3.63 × 10-7 to 2.90 × 10-5 mol L-1, with a correlation coefficient (r) of 0.9999. The limits of detection and quantification were 1.07 × 10-7 and 3.57 × 10-7 mol L-1, respectively. The proposed method was successfully applied to the determination of bromopride in pharmaceuticals and human urine, and recoveries of the drug from these media were in the ranges 99.6-101.2% and 98.6-102.1%, respectively. This new flow injection procedure does not require any sample pretreatment steps.

  15. Sensitivity Analysis of Multidisciplinary Rotorcraft Simulations

    Science.gov (United States)

    Wang, Li; Diskin, Boris; Biedron, Robert T.; Nielsen, Eric J.; Bauchau, Olivier A.

    2017-01-01

    A multidisciplinary sensitivity analysis of rotorcraft simulations involving tightly coupled high-fidelity computational fluid dynamics and comprehensive analysis solvers is presented and evaluated. An unstructured sensitivity-enabled Navier-Stokes solver, FUN3D, and a nonlinear flexible multibody dynamics solver, DYMORE, are coupled to predict the aerodynamic loads and structural responses of helicopter rotor blades. A discretely-consistent adjoint-based sensitivity analysis available in FUN3D provides sensitivities arising from unsteady turbulent flows and unstructured dynamic overset meshes, while a complex-variable approach is used to compute DYMORE structural sensitivities with respect to aerodynamic loads. The multidisciplinary sensitivity analysis is conducted through integrating the sensitivity components from each discipline of the coupled system. Numerical results verify accuracy of the FUN3D/DYMORE system by conducting simulations for a benchmark rotorcraft test model and comparing solutions with established analyses and experimental data. Complex-variable implementation of sensitivity analysis of DYMORE and the coupled FUN3D/DYMORE system is verified by comparing with real-valued analysis and sensitivities. Correctness of adjoint formulations for FUN3D/DYMORE interfaces is verified by comparing adjoint-based and complex-variable sensitivities. Finally, sensitivities of the lift and drag functions obtained by complex-variable FUN3D/DYMORE simulations are compared with sensitivities computed by the multidisciplinary sensitivity analysis, which couples adjoint-based flow and grid sensitivities of FUN3D and FUN3D/DYMORE interfaces with complex-variable sensitivities of DYMORE structural responses.

  16. Investigation of the mixture flow rates of oil-water two-phase flow using the turbine flow meter

    International Nuclear Information System (INIS)

    Li Donghui; Feng Feifei; Wu Yingxiang; Xu Jingyu

    2009-01-01

    In this work, the mixture flow rate of oil-water flows was studied using the turbine flow-meter. The research emphasis focuses on the effect of oil viscosity and input fluids flow rates on the precision of the meter. Experiments were conducted to measure the in-situ mixture flow rate in a horizontal pipe with 0.05m diameter using seven different viscosities of white oil and tap water as liquid phases. Results showed that both oil viscosity and input oil fraction exert a remarkable effect on measured results, especially when the viscosity of oil phase remained in the area of high value. In addition, for metering mixture flow rate using turbine flow-meter, the results are not sensitive to two-phase flow pattern according to the experimental data.

  17. Fusion environment sensitive flow and fracture processes

    International Nuclear Information System (INIS)

    1980-01-01

    As a planning activity, the objectives of the workshop were to list, prioritize and milestone the activities necessary to understand, interpret and control the mechanical behavior of candidate fusion reactor alloys. Emphasis was placed on flow and fracture processes which are unique to the fusion environment since the national fusion materials program must evaluate these effects without assistance from other reactor programs

  18. Sea-ice floe-size distribution in the context of spontaneous scaling emergence in stochastic systems

    Science.gov (United States)

    Herman, Agnieszka

    2010-06-01

    Sea-ice floe-size distribution (FSD) in ice-pack covered seas influences many aspects of ocean-atmosphere interactions. However, data concerning FSD in the polar oceans are still sparse and processes shaping the observed FSD properties are poorly understood. Typically, power-law FSDs are assumed although no feasible explanation has been provided neither for this one nor for other properties of the observed distributions. Consequently, no model exists capable of predicting FSD parameters in any particular situation. Here I show that the observed FSDs can be well represented by a truncated Pareto distribution P(x)=x-1-αexp[(1-α)/x] , which is an emergent property of a certain group of multiplicative stochastic systems, described by the generalized Lotka-Volterra (GLV) equation. Building upon this recognition, a possibility of developing a simple agent-based GLV-type sea-ice model is considered. Contrary to simple power-law FSDs, GLV gives consistent estimates of the total floe perimeter, as well as floe-area distribution in agreement with observations.

  19. Flow injection determination of diclofenac sodium based on its sensitizing effect on the chemiluminescent reaction of acidic potassium permanganate-formaldehyde.

    Science.gov (United States)

    Song, Jingjing; Sun, Pulv; Ji, Zhongling; Li, Jianguo

    2015-02-01

    A sensitive and simple chemiluminescent (CL) method for the determination of diclofenac sodium has been developed by combining the flow injection technique and its sensitizing effect on the weak CL reaction between formaldehyde and acidic potassium permanganate. A calibration curve is constructed for diclofenac sodium under optimized experimental parameters over the range 0.040-5.0 µg/mL and the limit of detection is 0.020 µg/mL (3σ). The inter-assay relative standard deviation for 0.040 µg/mL diclofenac sodium (n = 11) is 2.0%. This method is rapid, sensitive, simple, and shows good selectivity and reproducibility. The proposed method has been successfully applied to the determination of the studied diclofenac sodium in pharmaceutical preparations with satisfactory results. Furthermore, the possible mechanism for the CL reaction has been discussed in detail on the basis of UV and CL spectra. Copyright © 2014 John Wiley & Sons, Ltd.

  20. Open reading frame ssr2016 is required for antimycin A-sensitive photosystem I-driven cyclic electron flow in the cyanobacterium Synechocystis sp. PCC 6803

    NARCIS (Netherlands)

    Yeremenko, Nataliya; Jeanjean, Robert; Prommeenate, Peerada; Krasikov, Vladimir; Nixon, Peter J.; Vermaas, Wim F. J.; Havaux, Michel; Matthijs, Hans C. P.

    2005-01-01

    Open reading frame ssr2016 encodes a protein with substantial sequence similarities to PGR5 identified as a component of the antimycin A-sensitive ferredoxin:plastoquinone reductase (FQR) in PSI cyclic photophosphorylation in Arabidopsis thaliana. We studied cyclic electron flow in Synechocystis sp.

  1. Determination of aerodynamic sensitivity coefficients for wings in transonic flow

    Science.gov (United States)

    Carlson, Leland A.; El-Banna, Hesham M.

    1992-01-01

    The quasianalytical approach is applied to the 3-D full potential equation to compute wing aerodynamic sensitivity coefficients in the transonic regime. Symbolic manipulation is used to reduce the effort associated with obtaining the sensitivity equations, and the large sensitivity system is solved using 'state of the art' routines. The quasianalytical approach is believed to be reasonably accurate and computationally efficient for 3-D problems.

  2. Transient flow combustion

    Science.gov (United States)

    Tacina, R. R.

    1984-01-01

    Non-steady combustion problems can result from engine sources such as accelerations, decelerations, nozzle adjustments, augmentor ignition, and air perturbations into and out of the compressor. Also non-steady combustion can be generated internally from combustion instability or self-induced oscillations. A premixed-prevaporized combustor would be particularly sensitive to flow transients because of its susceptability to flashback-autoignition and blowout. An experimental program, the Transient Flow Combustion Study is in progress to study the effects of air and fuel flow transients on a premixed-prevaporized combustor. Preliminary tests performed at an inlet air temperature of 600 K, a reference velocity of 30 m/s, and a pressure of 700 kPa. The airflow was reduced to 1/3 of its original value in a 40 ms ramp before flashback occurred. Ramping the airflow up has shown that blowout is more sensitive than flashback to flow transients. Blowout occurred with a 25 percent increase in airflow (at a constant fuel-air ratio) in a 20 ms ramp. Combustion resonance was found at some conditions and may be important in determining the effects of flow transients.

  3. A Highly Sensitive Multicommuted Flow Analysis Procedure for Photometric Determination of Molybdenum in Plant Materials without a Solvent Extraction Step

    Directory of Open Access Journals (Sweden)

    Felisberto G. Santos

    2017-01-01

    Full Text Available A highly sensitive analytical procedure for photometric determination of molybdenum in plant materials was developed and validated. This procedure is based on the reaction of Mo(V with thiocyanate ions (SCN− in acidic medium to form a compound that can be monitored at 474 nm and was implemented employing a multicommuted flow analysis setup. Photometric detection was performed using an LED-based photometer coupled to a flow cell with a long optical path length (200 mm to achieve high sensitivity, allowing Mo(V determination at a level of μg L−1 without the use of an organic solvent extraction step. After optimization of operational conditions, samples of digested plant materials were analyzed employing the proposed procedure. The accuracy was assessed by comparing the obtained results with those of a reference method, with an agreement observed at 95% confidence level. In addition, a detection limit of 9.1 μg L−1, a linear response (r=0.9969 over the concentration range of 50–500 μg L−1, generation of only 3.75 mL of waste per determination, and a sampling rate of 51 determinations per hour were achieved.

  4. Clinical evaluation of pulmonary perfusion MRI using FAIR (flow-sensitive alternating inversion recovery)-HASTE (Half-Fourier Single-Shot TurboSE) method

    International Nuclear Information System (INIS)

    Togami, Izumi; Sasai, Nobuya; Tsunoda, Masatoshi; Sei, Tetsurou; Sato, Shuhei; Yabuki, Takayuki; Hiraki, Yoshio

    2002-01-01

    The FAIR-HASTE method is a kind of noninvasive perfusion MR imaging obtained without the use of contrast media. By subtracting a flow-insensitive image from a flow-sensitive image, contrast enhancement of inflowing blood achieved. In the present study, we applied pulmonary perfusion FAIR-HASTE sequence for 23 patients with various pulmonary diseases, and compared the findings with those by pulmonary perfusion scintigraphy and Gadolinium perfusion MRI. Pulmonary perfusion imaging with the FAIR-HASTE method was possible in all clinical cases, and the findings corresponded well to those obtained by perfusion MRI using contrast media or pulmonary scintigraphy. The FAIR-HASTE method is a promising method for the evaluation of pulmonary perfusion. (author)

  5. Uncertainty Quantification and Global Sensitivity Analysis of Subsurface Flow Parameters to Gravimetric Variations During Pumping Tests in Unconfined Aquifers

    Science.gov (United States)

    Maina, Fadji Zaouna; Guadagnini, Alberto

    2018-01-01

    We study the contribution of typically uncertain subsurface flow parameters to gravity changes that can be recorded during pumping tests in unconfined aquifers. We do so in the framework of a Global Sensitivity Analysis and quantify the effects of uncertainty of such parameters on the first four statistical moments of the probability distribution of gravimetric variations induced by the operation of the well. System parameters are grouped into two main categories, respectively, governing groundwater flow in the unsaturated and saturated portions of the domain. We ground our work on the three-dimensional analytical model proposed by Mishra and Neuman (2011), which fully takes into account the richness of the physical process taking place across the unsaturated and saturated zones and storage effects in a finite radius pumping well. The relative influence of model parameter uncertainties on drawdown, moisture content, and gravity changes are quantified through (a) the Sobol' indices, derived from a classical decomposition of variance and (b) recently developed indices quantifying the relative contribution of each uncertain model parameter to the (ensemble) mean, skewness, and kurtosis of the model output. Our results document (i) the importance of the effects of the parameters governing the unsaturated flow dynamics on the mean and variance of local drawdown and gravity changes; (ii) the marked sensitivity (as expressed in terms of the statistical moments analyzed) of gravity changes to the employed water retention curve model parameter, specific yield, and storage, and (iii) the influential role of hydraulic conductivity of the unsaturated and saturated zones to the skewness and kurtosis of gravimetric variation distributions. The observed temporal dynamics of the strength of the relative contribution of system parameters to gravimetric variations suggest that gravity data have a clear potential to provide useful information for estimating the key hydraulic

  6. Sensitivity analysis of Immersed Boundary Method simulations of fluid flow in dense polydisperse random grain packings

    Directory of Open Access Journals (Sweden)

    Knight Chris

    2017-01-01

    Full Text Available Polydisperse granular materials are ubiquitous in nature and industry. Despite this, knowledge of the momentum coupling between the fluid and solid phases in dense saturated grain packings comes almost exclusively from empirical correlations [2–4, 8] with monosized media. The Immersed Boundary Method (IBM is a Computational Fluid Dynamics (CFD modelling technique capable of resolving pore scale fluid flow and fluid-particle interaction forces in polydisperse media at the grain scale. Validation of the IBM in the low Reynolds number, high concentration limit was performed by comparing simulations of flow through ordered arrays of spheres with the boundary integral results of Zick and Homsy [10]. Random grain packings were studied with linearly graded particle size distributions with a range of coefficient of uniformity values (Cu = 1.01, 1.50, and 2.00 at a range of concentrations (ϕ ∈ [0.396; 0.681] in order to investigate the influence of polydispersity on drag and permeability. The sensitivity of the IBM results to the choice of radius retraction parameter [1] was investigated and a comparison was made between the predicted forces and the widely used Ergun correlation [3].

  7. colour-flow ultrasound in the detection of penetrating vascular

    African Journals Online (AJOL)

    To determine the sensitivity of colour-flow ultrasound in the detection of penetrating vascular injuries of ... Colour-flow ultrasound is sensitive in detecting vascular injuries and is suitable as a screening .... injury, ultrasound appears to be sensitive in detecting these lesions. However there is a risk of missing more central.

  8. A sensitive flow-batch system for on board determination of ultra-trace ammonium in seawater: Method development and shipboard application.

    Science.gov (United States)

    Zhu, Yong; Yuan, Dongxing; Huang, Yongming; Ma, Jian; Feng, Sichao

    2013-09-10

    Combining fluorescence detection with flow analysis and solid phase extraction (SPE), a highly sensitive and automatic flow system for measurement of ultra-trace ammonium in open ocean water was established. Determination was based on fluorescence detection of a typical product of o-phthaldialdehyde and ammonium. In this study, the fluorescence reaction product could be efficiently extracted onto an SPE cartridge (HLB, hydrophilic-lipophilic balance). The extracted fluorescence compounds were rapidly eluted with ethanol and directed into a flow cell for fluorescence detection. Compared with the common used fluorescence method, the proposed one offered the benefits of improved sensitivity, reduced reagent consumption, negligible salinity effect and lower cost. Experimental parameters were optimized using a univariate experimental design. Calibration curves, ranging from 1.67 to 300nM, were obtained with different reaction times. The recoveries were between 89.5 and 96.5%, and the detection limits in land-based and shipboard laboratories were 0.7 and 1.2nM, respectively. The relative standard deviation was 3.5% (n=5) for an aged seawater sample spiked with 20nM ammonium. Compared with the analytical results obtained using the indophenol blue method coupled to a long-path liquid waveguide capillary cell, the proposed method showed good agreement. The method had been applied on board during a South China Sea cruise in August 2012. A vertical profile of ammonium in the South East Asia Time-Series (SEATS, 18° N, 116° E) station was produced. The distribution of ammonium in the surface seawater of the Qiongdong upwelling in South China Sea is also presented. Copyright © 2013 Elsevier B.V. All rights reserved.

  9. Stable and sensitive flow-through monitoring of phenol using a carbon nanotube based screen printed biosensor

    Energy Technology Data Exchange (ETDEWEB)

    Alarcon, G; Guix, M; Ambrosi, A; Merkoci, A [Nanobioelectronics and Biosensors Group, Catalan Institute of Nanotechnology, Campus UAB, 08193 Bellaterra, Barcelona, Catalonia (Spain); Ramirez Silva, M T [Departamento de Quimica, Universidad Autonoma Metropolitana Iztapalapa, 09340 Mexico Distrito Federal (Mexico); Palomar Pardave, M E, E-mail: arben.merkoci.icn@uab.es [Departamento de Materiales, Universidad Autonoma Metropolitana, Azcapotzalco, 02200 Mexico Distrito Federal (Mexico)

    2010-06-18

    A stable and sensitive biosensor for phenol detection based on a screen printed electrode modified with tyrosinase, multiwall carbon nanotubes and glutaraldehyde is designed and applied in a flow injection analytical system. The proposed carbon nanotube matrix is easy to prepare and ensures a very good entrapment environment for the enzyme, being simpler and cheaper than other reported strategies. In addition, the proposed matrix allows for a very fast operation of the enzyme, that leads to a response time of 15 s. Several parameters such as the working potential, pH of the measuring solution, biosensor response time, detection limit, linear range of response and sensitivity are studied. The obtained detection limit for phenol was 0.14 x 10{sup -6} M. The biosensor keeps its activity during continuous FIA measurements at room temperature, showing a stable response (RSD 5%) within a two week working period at room temperature. The developed biosensor is being applied for phenol detection in seawater samples and seems to be a promising alternative for automatic control of seawater contamination. The developed detection system can be extended to other enzyme biosensors with interest for several other applications.

  10. Stable and sensitive flow-through monitoring of phenol using a carbon nanotube based screen printed biosensor

    International Nuclear Information System (INIS)

    Alarcon, G; Guix, M; Ambrosi, A; Merkoci, A; Ramirez Silva, M T; Palomar Pardave, M E

    2010-01-01

    A stable and sensitive biosensor for phenol detection based on a screen printed electrode modified with tyrosinase, multiwall carbon nanotubes and glutaraldehyde is designed and applied in a flow injection analytical system. The proposed carbon nanotube matrix is easy to prepare and ensures a very good entrapment environment for the enzyme, being simpler and cheaper than other reported strategies. In addition, the proposed matrix allows for a very fast operation of the enzyme, that leads to a response time of 15 s. Several parameters such as the working potential, pH of the measuring solution, biosensor response time, detection limit, linear range of response and sensitivity are studied. The obtained detection limit for phenol was 0.14 x 10 -6 M. The biosensor keeps its activity during continuous FIA measurements at room temperature, showing a stable response (RSD 5%) within a two week working period at room temperature. The developed biosensor is being applied for phenol detection in seawater samples and seems to be a promising alternative for automatic control of seawater contamination. The developed detection system can be extended to other enzyme biosensors with interest for several other applications.

  11. Contested psychiatric ontology and feminist critique

    Science.gov (United States)

    Angel, Katherine

    2012-01-01

    In this article I discuss the emergence of Female Sexual Dysfunction (FSD) within American psychiatry and beyond in the postwar period, setting out what I believe to be important and suggestive questions neglected in existing scholarship. Tracing the nomenclature within successive editions of the American Psychiatric Association’s Diagnostic and Statistical Manual (DSM), I consider the reification of the term ‘FSD’, and the activism and scholarship that the rise of the category has occasioned. I suggest that analysis of FSD benefits from scrutiny of a wider range of sources (especially since the popular and scientific cross-pollinate). I explore the multiplicity of FSD that emerges when one examines this wider range, but I also underscore a reinscribing of anxieties about psychogenic aetiologies. I then argue that what makes the FSD case additionally interesting, over and above other conditions with a contested status, is the historically complex relationship between psychiatry and feminism that is at work in contemporary debates. I suggest that existing literature on FSD has not yet posed some of the most important and salient questions at stake in writing about women’s sexual problems in this period, and can only do this when the relationship between ‘second-wave’ feminism, ‘post-feminism’, psychiatry and psychoanalysis becomes part of the terrain to be analysed, rather than the medium through which analysis is conducted. PMID:23355764

  12. Adaptive population divergence and directional gene flow across steep elevational gradients in a climate-sensitive mammal.

    Science.gov (United States)

    Waterhouse, Matthew D; P Erb, Liesl; Beever, Erik A; Russello, Michael A

    2018-04-25

    The ecological effects of climate change have been shown in most major taxonomic groups; however, the evolutionary consequences are less well-documented. Adaptation to new climatic conditions offers a potential long-term mechanism for species to maintain viability in rapidly changing environments, but mammalian examples remain scarce. The American pika (Ochotona princeps) has been impacted by recent climate-associated extirpations and range-wide reductions in population sizes, establishing it as a sentinel mammalian species for climate change. To investigate evidence for local adaptation and reconstruct patterns of genomic diversity and gene flow across rapidly changing environments, we used a space-for-time design and restriction site-associated DNA sequencing to genotype American pikas along two steep elevational gradients at 30,966 SNPs and employed independent outlier detection methods that scanned for genotype-environment associations. We identified 338 outlier SNPs detected by two separate analyses and/or replicated in both transects, several of which were annotated to genes involved in metabolic function and oxygen transport. Additionally, we found evidence of directional gene flow primarily downslope from high-elevation populations, along with reduced gene flow at outlier loci. If this trend continues, elevational range contractions in American pikas will likely be from local extirpation rather than upward movement of low-elevation individuals; this, in turn, could limit the potential for adaptation within this landscape. These findings are of particular relevance for future conservation and management of American pikas and other elevationally-restricted, thermally-sensitive species. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  13. Professional Networks among Rural School Food Service Directors Implementing the Healthy, Hunger-Free Kids Act

    Science.gov (United States)

    Lubker Cornish, Disa; Askelson, Natoshia M.; Golembiewski, Elizabeth H.

    2015-01-01

    Purpose/Objectives: This study was designed to explore the professional networks of rural school food service directors (FSD), the resources they use for implementing the Healthy, Hunger-free Kids Act of 2010 (HHFKA), and their needs for information and support to continue to implement successfully. Methods: Rural FSD participated in an in-depth…

  14. The Role of Cash Holdings in Reducing Investment-Cash Flow Sensitivity: Evidence from a Financial Crisis Period in an Emerging Market

    OpenAIRE

    Ozgur Arslan; Chrisostomos Florackis; Aydin Ozkan

    2006-01-01

    This paper investigates the relationship between financing constraints and investment-cash flow sensitivities by focusing on cash holdings of firms as the basic classification scheme to separate firms into financially constrained and unconstrained categories. The idea is that high cash reserves increase the ability of firms to undertake profitable investment opportunities. Our classification scheme is based on an optimal cash model, which helps us identify the firms that deviate significantly...

  15. Designing novel nano-immunoassays: antibody orientation versus sensitivity

    Energy Technology Data Exchange (ETDEWEB)

    Puertas, S; Moros, M; Fernandez-Pacheco, R; Ibarra, M R; Grazu, V; De la Fuente, J M, E-mail: vgrazu@unizar.e, E-mail: jmfuente@unizar.e [Instituto de Nanociencia de Aragon (INA), Universidad de Zaragoza, Campus RIo Ebro, EdifIcio I-D, Mariano Esquillor, s/n, 50018 Zaragoza (Spain)

    2010-12-01

    There is a growing interest in the use of magnetic nanoparticles (MNPs) for their application in quantitative and highly sensitive biosensors. Their use as labels of biological recognition events and their detection by means of some magnetic method constitute a very promising strategy for quantitative high-sensitive lateral-flow assays. In this paper, we report the importance of nanoparticle functionalization for the improvement of sensitivity for a lateral-flow immunoassay. More precisely, we have found that immobilization of IgG anti-hCG through its polysaccharide moieties on MNPs allows more successful recognition of the hCG hormone. Although we have used the detection of hCG as a model in this work, the strategy of binding antibodies to MNPs through its sugar chains reported here is applicable to other antibodies. It has huge potential as it will be very useful for the development of quantitative and high-sensitive lateral-flow assays for its use on human and veterinary, medicine, food and beverage manufacturing, pharmaceutical, medical biologics and personal care product production, environmental remediation, etc.

  16. Integrated cantilever-based flow sensors with tunable sensitivity for in-line monitoring of flow fluctuations in microfluidic systems

    DEFF Research Database (Denmark)

    Noeth, Nadine-Nicole; Keller, Stephan Sylvest; Boisen, Anja

    2014-01-01

    For devices such as bio-/chemical sensors in microfluidic systems, flow fluctuations result in noise in the sensor output. Here, we demonstrate in-line monitoring of flow fluctuations with a cantilever-like sensor integrated in a microfluidic channel. The cantilevers are fabricated in different...... is directly proportional to the flow rate fluctuations in the microfluidic channel. The SiN cantilevers show a detection limit below 1 nL/min and the thinnest SU-8 cantilevers a detection limit below 5 nL/min. Finally, the sensor is applied for in-line monitoring of flow fluctuations generated by external...

  17. Female Sexual Dysfunction and its Associated Risk Factors: An Epidemiological Study in the North-East of Iran

    Directory of Open Access Journals (Sweden)

    Reza Jafarzadeh Esfehani

    2016-01-01

    Full Text Available Background & aim: Female sexual function (FSD is a multifactorial phenomenon. Sexual function is influenced by different personal and environmental factors. This study aimed to evaluate FSD and its contributing factors using female sexual function index (FSFI. Methods:This descriptive cross-sectional study was conducted on 264 women referring to 11 health centers of Sabzevar, Iran during October 2012 to January 2013 using a convenience sampling. Data were collected using a validated Persian version of FSFI containing six domains of sexual desire, lubrication, sexual arousal, sexual satisfaction, orgasm and sexual pain as well as demographic questionnaire. A total score of Results: The mean age of women enrolled in this study was 32.2±10.27 years . Considering the cut-off point of sexual dysfunction at 28, 62.1% of the study population had FSD. Highest rate of FSD was estimated at 49.2%, Age was associated with a significant decline in total scores of FSFI (P=0.042. Moreover, a significant correlation was observed between duration of marriage and total scores of FSFI (P

  18. Sea-ice floe-size distribution in the context of spontaneous scaling emergence in stochastic systems.

    Science.gov (United States)

    Herman, Agnieszka

    2010-06-01

    Sea-ice floe-size distribution (FSD) in ice-pack covered seas influences many aspects of ocean-atmosphere interactions. However, data concerning FSD in the polar oceans are still sparse and processes shaping the observed FSD properties are poorly understood. Typically, power-law FSDs are assumed although no feasible explanation has been provided neither for this one nor for other properties of the observed distributions. Consequently, no model exists capable of predicting FSD parameters in any particular situation. Here I show that the observed FSDs can be well represented by a truncated Pareto distribution P(x)=x(-1-α) exp[(1-α)/x] , which is an emergent property of a certain group of multiplicative stochastic systems, described by the generalized Lotka-Volterra (GLV) equation. Building upon this recognition, a possibility of developing a simple agent-based GLV-type sea-ice model is considered. Contrary to simple power-law FSDs, GLV gives consistent estimates of the total floe perimeter, as well as floe-area distribution in agreement with observations.

  19. Meat quality of lamb frozen stored up to 21 months: instrumental analyses on thawed meat during display.

    Science.gov (United States)

    Muela, E; Monge, P; Sañudo, C; Campo, M M; Beltrán, J A

    2015-04-01

    The study analysed the effect of frozen storage duration (FSD: 0, 1, 9, 15 or 21 months) and display duration (DD: 0-24 h post-slaughter-, 3 and 6 days) in modified atmosphere packaging (MAP) on lamb quality. pH, colour, lipid oxidation, water holding capacity and instrumental texture were performed on Longissimus muscle in displayed fresh and thawed meat. FSD affected all the variables showing lower differences between fresh and 1 month storage than among them and longer FSD. Only cooking losses were not affected by DD in thawed meats. It was observed a general decrease in quality (lower redness and water holding capacity; higher yellowness and lipid oxidation) as FSD or DD increased and only texture was improved over DD being thawed meat more tender. In conclusion, lamb storage at -18°C should not exceed 1 month if thawed meat would be later displayed in MAP while meat would have an acceptable quality up to 21 months without subsequent display. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Techniques of Flow Visualization

    Science.gov (United States)

    1987-12-01

    are sensitive. Within the bandwidth of their sensitivity, up to ten color hues may be discriminated by the eye. The visible edge between two colors...can be performed with conven- tional photography or cinematography . Video recording is of advantage for the further pro- cessing of the flow pictures

  1. PAYMENT CAPACITY SENSITIVITY FACTORS

    OpenAIRE

    Daniel BRÎNDESCU – OLARIU

    2014-01-01

    The current study focuses on the sensitivity of the corporate payment capacity. Through the nature of the subject, the research is based on simulating variations of the forecasted cash-flows of the companies included in the sample. The study employs 391 forecasted yearly cash-flows statements collected from 50 companies from Timis County (Romania), as well as the detailed hypotheses of the forecasts. The results of the study facilitate the determination and classification of the main se...

  2. Perceptions of female sexual health and sexual dysfunction in a ...

    African Journals Online (AJOL)

    Questions asked ranged from sexual activity in the preceding 6 months, menopausal status, if they thought they had sexual dysfunction to their willingness to discuss an FSD with a sexual health physician if they had access to one. Results: Over 50% (n=28) of the respondents had an idea about what FSD was before the ...

  3. Surface-acoustic-wave (SAW) flow sensor

    Science.gov (United States)

    Joshi, Shrinivas G.

    1991-03-01

    The use of a surface-acoustic-wave (SAW) device to measure the rate of gas flow is described. A SAW oscillator heated to a suitable temperature above ambient is placed in the path of a flowing gas. Convective cooling caused by the gas flow results in a change in the oscillator frequency. A 73-MHz oscillator fabricated on 128 deg rotated Y-cut lithium niobate substrate and heated to 55 C above ambient shows a frequency variation greater than 142 kHz for flow-rate variation from 0 to 1000 cu cm/min. The output of the sensor can be calibrated to provide a measurement of volume flow rate, pressure differential across channel ports, or mass flow rate. High sensitivity, wide dynamic range, and direct digital output are among the attractive features of this sensor. Theoretical expressions for the sensitivity and response time of the sensor are derived. It is shown that by using ultrasonic Lamb waves propagating in thin membranes, a flow sensor with faster response than a SAW sensor can be realized.

  4. Determination of phenols by flow injection and liquid chromatography with on-line quinine-sensitized photo-oxidation and quenched luminol chemiluminescence detection

    International Nuclear Information System (INIS)

    Zhang Wei; Danielson, Neil D.

    2003-01-01

    An on-line quinine-sensitized photo-oxidation with quenched chemiluminescence (CL) detection method is developed for phenols using flow injection (FI) and liquid chromatography (LC). This detection method is based on the decrease of light emission from the luminol CL reaction due to the photo-oxidation of phenols that scavenge the photogenerated reactive oxygen species (e.g. singlet oxygen ( 1 O 2 ) and superoxide (O 2 · - )). On-line photo-oxidation is achieved using a coil photo-reactor made from fluoroethylene-propylene copolymer tubing (3048 mmx0.25 mm i.d.) coiled around a mercury UV lamp. A buffer of pH 7 and a concentration of 350 μM for quinine sulfate are determined optimum for the sensitized photo-oxidation. Using a carrier system flow rate of 60 μl/min, calibration curves taken by FI for 10 phenolic compounds in aqueous solutions showed this decreasing sensitivity order: 4-chlorophenol, phenol, 4-nitrophenol, 3-hydroxy-L-kynurenine, 2-nitrophenol, salicylate, 3-nitrophenol, catechol, 2,4-dinitrophenol, and 2,4-dichlorophenol. This detection method using two tandem coil photo-reactors is also applied for the LC separation of phenol, 4-nitrophenol and 4-chlorophenol on an octadecyl (C18) silica LC column using acetonitrile-H 2 O (40:60, v/v) as a mobile phase. The quenched CL detection limits (about 1 μM or 20 pmol) for phenol and 4-chlorophenol are comparable to those for UV detection at 254 nm. Some selectivity in the quenched CL detection is evident by no interference in the FI phenol response even when benzaldehyde and phenethanol concentrations are 8 and 15 times that of phenol

  5. Directed transverse flow and its disappearance for asymmetric reactions

    International Nuclear Information System (INIS)

    Lovejot; Gautam, S.

    2014-01-01

    We study the directed transverse flow for mass asymmetry reactions. This is done by keeping the target fixed and varying the projectile mass from 4 He to 131 Xe. We find that directed transverse flow is sensitive to the mass of the projectile. We also study the disappearance of flow at a particular impact parameter called Geometry of Vanishing Flow (GVF) for such mass asymmetry reactions. Our results indicate that GVF is sensitive to the beam energy as well as to the mass of the projectile.

  6. FUSION OF VENTURI AND ULTRASONIC FLOW METER FOR ENHANCED FLOW METER CHARACTERISTICS USING FUZZY LOGIC

    Directory of Open Access Journals (Sweden)

    K.V. Santhosh

    2015-04-01

    Full Text Available This paper proposes a technique for measurement of liquid flow using venturi and ultrasonic flow meter(UFM to have following objectives a to design a multi-sensor data fusion (MSDF architecture for using both the sensors, b improve sensitivity and linearity of venturi and ultrasonic flow meter, and c detect and diagnosis of faults in sensor if any. Fuzzy logic algorithm is used to fuse outputs of both the sensor and train the fuzzy block to produces output which has an improved characteristics in terms of both sensitivity and linearity. For identification of sensor faults a comparative test algorithm is designed. Once trained proposed technique is tested in real life, results show successful implementation of proposed objectives.

  7. Modelling of a micro Coriolis mass flow sensor for sensitivity improvement

    NARCIS (Netherlands)

    Groenesteijn, Jarno; van de Ridder, Bert; Lötters, Joost Conrad; Wiegerink, Remco J.

    2014-01-01

    We have developed a multi-axis flexible body model with which we can investigate the behavior of (micro) Coriolis mass flow sensors with arbitrary channel geometry. The model has been verified by measurements on five different designs of micro Coriolis mass flow sensors. The model predicts the Eigen

  8. Evaluation of flow hood measurements for residential register flows; TOPICAL

    International Nuclear Information System (INIS)

    Walker, I.S.; Wray, C.P.; Dickerhoff, D.J.; Sherman, M.H.

    2001-01-01

    Flow measurement at residential registers using flow hoods is becoming more common. These measurements are used to determine if the HVAC system is providing adequate comfort, appropriate flow over heat exchangers and in estimates of system energy losses. These HVAC system performance metrics are determined by using register measurements to find out if individual rooms are getting the correct airflow, and in estimates of total air handler flow and duct air leakage. The work discussed in this paper shows that commercially available flow hoods are poor at measuring flows in residential systems. There is also evidence in this and other studies that flow hoods can have significant errors even when used on the non-residential systems they were originally developed for. The measurement uncertainties arise from poor calibrations and the sensitivity of exiting flow hoods to non-uniformity of flows entering the device. The errors are usually large-on the order of 20% of measured flow, which is unacceptably high for most applications. Active flow hoods that have flow measurement devices that are insensitive to the entering airflow pattern were found to be clearly superior to commercially available flow hoods. In addition, it is clear that current calibration procedures for flow hoods may not take into account any field application problems and a new flow hood measurement standard should be developed to address this issue

  9. Numerical Evaluation and Optimization of Multiple Hydraulically Fractured Parameters Using a Flow-Stress-Damage Coupled Approach

    Directory of Open Access Journals (Sweden)

    Yu Wang

    2016-04-01

    Full Text Available Multiple-factor analysis and optimization play a critical role in the the ability to maximizethe stimulated reservoir volume (SRV and the success of economic shale gas production. In this paper, taking the typical continental naturally fractured silty laminae shale in China as anexample, response surface methodology (RSM was employed to optimize multiple hydraulic fracturing parameters to maximize the stimulated area in combination with numerical modeling based on the coupled flow-stress-damage (FSD approach. This paper demonstrates hydraulic fracturing effectiveness by defining two indicesnamelythe stimulated reservoir area (SRA and stimulated silty laminae area (SLA. Seven uncertain parameters, such as laminae thickness, spacing, dip angle, cohesion, internal friction angle (IFA, in situ stress difference (SD, and an operational parameter-injection rate (IR with a reasonable range based on silty Laminae Shale, Southeastern Ordos Basin, are used to fit a response of SRA and SLA as the objective function, and finally identity the optimum design under the parameters based on simultaneously maximizingSRA and SLA. In addition, asensitivity analysis of the influential factors is conducted for SRA and SLA. The aim of the study is to improve the artificial ability to control the fracturing network by means of multi-parameteroptimization. This work promises to provide insights into the effective exploitation of unconventional shale gas reservoirs via optimization of the fracturing design for continental shale, Southeastern Ordos Basin, China.

  10. Biomimetic micromechanical adaptive flow-sensor arrays

    Science.gov (United States)

    Krijnen, Gijs; Floris, Arjan; Dijkstra, Marcel; Lammerink, Theo; Wiegerink, Remco

    2007-05-01

    We report current developments in biomimetic flow-sensors based on flow sensitive mechano-sensors of crickets. Crickets have one form of acoustic sensing evolved in the form of mechanoreceptive sensory hairs. These filiform hairs are highly perceptive to low-frequency sound with energy sensitivities close to thermal threshold. In this work we describe hair-sensors fabricated by a combination of sacrificial poly-silicon technology, to form silicon-nitride suspended membranes, and SU8 polymer processing for fabrication of hairs with diameters of about 50 μm and up to 1 mm length. The membranes have thin chromium electrodes on top forming variable capacitors with the substrate that allow for capacitive read-out. Previously these sensors have been shown to exhibit acoustic sensitivity. Like for the crickets, the MEMS hair-sensors are positioned on elongated structures, resembling the cercus of crickets. In this work we present optical measurements on acoustically and electrostatically excited hair-sensors. We present adaptive control of flow-sensitivity and resonance frequency by electrostatic spring stiffness softening. Experimental data and simple analytical models derived from transduction theory are shown to exhibit good correspondence, both confirming theory and the applicability of the presented approach towards adaptation.

  11. Variance reduction techniques for 14 MeV neutron streaming problem in rectangular annular bent duct

    Energy Technology Data Exchange (ETDEWEB)

    Ueki, Kotaro [Ship Research Inst., Mitaka, Tokyo (Japan)

    1998-03-01

    Monte Carlo method is the powerful technique for solving wide range of radiation transport problems. Its features are that it can solve the Boltzmann`s transport equation almost without approximation, and that the complexity of the systems to be treated rarely becomes a problem. However, the Monte Carlo calculation is always accompanied by statistical errors called variance. In shielding calculation, standard deviation or fractional standard deviation (FSD) is used frequently. The expression of the FSD is shown. Radiation shielding problems are roughly divided into transmission through deep layer and streaming problem. In the streaming problem, the large difference in the weight depending on the history of particles makes the FSD of Monte Carlo calculation worse. The streaming experiment in the 14 MeV neutron rectangular annular bent duct, which is the typical streaming bench mark experiment carried out of the OKTAVIAN of Osaka University, was analyzed by MCNP 4B, and the reduction of variance or FSD was attempted. The experimental system is shown. The analysis model by MCNP 4B, the input data and the results of analysis are reported, and the comparison with the experimental results was examined. (K.I.)

  12. Thermal Flow Sensors for Harsh Environments.

    Science.gov (United States)

    Balakrishnan, Vivekananthan; Phan, Hoang-Phuong; Dinh, Toan; Dao, Dzung Viet; Nguyen, Nam-Trung

    2017-09-08

    Flow sensing in hostile environments is of increasing interest for applications in the automotive, aerospace, and chemical and resource industries. There are thermal and non-thermal approaches for high-temperature flow measurement. Compared to their non-thermal counterparts, thermal flow sensors have recently attracted a great deal of interest due to the ease of fabrication, lack of moving parts and higher sensitivity. In recent years, various thermal flow sensors have been developed to operate at temperatures above 500 °C. Microelectronic technologies such as silicon-on-insulator (SOI), and complementary metal-oxide semiconductor (CMOS) have been used to make thermal flow sensors. Thermal sensors with various heating and sensing materials such as metals, semiconductors, polymers and ceramics can be selected according to the targeted working temperature. The performance of these thermal flow sensors is evaluated based on parameters such as thermal response time, flow sensitivity. The data from thermal flow sensors reviewed in this paper indicate that the sensing principle is suitable for the operation under harsh environments. Finally, the paper discusses the packaging of the sensor, which is the most important aspect of any high-temperature sensing application. Other than the conventional wire-bonding, various novel packaging techniques have been developed for high-temperature application.

  13. Thermal Flow Sensors for Harsh Environments

    Directory of Open Access Journals (Sweden)

    Vivekananthan Balakrishnan

    2017-09-01

    Full Text Available Flow sensing in hostile environments is of increasing interest for applications in the automotive, aerospace, and chemical and resource industries. There are thermal and non-thermal approaches for high-temperature flow measurement. Compared to their non-thermal counterparts, thermal flow sensors have recently attracted a great deal of interest due to the ease of fabrication, lack of moving parts and higher sensitivity. In recent years, various thermal flow sensors have been developed to operate at temperatures above 500 °C. Microelectronic technologies such as silicon-on-insulator (SOI, and complementary metal-oxide semiconductor (CMOS have been used to make thermal flow sensors. Thermal sensors with various heating and sensing materials such as metals, semiconductors, polymers and ceramics can be selected according to the targeted working temperature. The performance of these thermal flow sensors is evaluated based on parameters such as thermal response time, flow sensitivity. The data from thermal flow sensors reviewed in this paper indicate that the sensing principle is suitable for the operation under harsh environments. Finally, the paper discusses the packaging of the sensor, which is the most important aspect of any high-temperature sensing application. Other than the conventional wire-bonding, various novel packaging techniques have been developed for high-temperature application.

  14. Nonlocal non-Markovian effects in dephasing environments

    International Nuclear Information System (INIS)

    Xie Dong; Wang An-Min

    2014-01-01

    We study the nonlocal non-Markovian effects through local interactions between two subsystems and the corresponding two environments. It has been found that the initial correlations between two environments can turn a Markovian to a non-Markovian regime with extra control on the local interaction time. We further research the nonlocal non-Markovian effects from two situations: without extra control, the nonlocal non-Markovian effects only appear under the condition that two local dynamics are non-Markovian–non-Markovian (both of the two local dynamics are non-Markovian) or Markovian–non-Markovian, but not under the condition of Markovian–Markovian; with extra control, the nonlocal non-Markovian effects can occur under the condition of Markovian–Markovian. It shows that the function of correlations between two environments has an upper bound, which makes a flow of information from the environment back to the global system beginning finitely earlier than that back to one of the two local systems, not infinitely. Then, we proposed two special ways to distribute classical correlations between two environments without initial correlations. Finally, from numerical solutions in the spin star configuration, we found that the self-correlation (internal correlation) of each environment promotes the nonlocal non-Markovian effects. (general)

  15. Computation of the stability derivatives via CFD and the sensitivity equations

    Science.gov (United States)

    Lei, Guo-Dong; Ren, Yu-Xin

    2011-04-01

    The method to calculate the aerodynamic stability derivates of aircrafts by using the sensitivity equations is extended to flows with shock waves in this paper. Using the newly developed second-order cell-centered finite volume scheme on the unstructured-grid, the unsteady Euler equations and sensitivity equations are solved simultaneously in a non-inertial frame of reference, so that the aerodynamic stability derivatives can be calculated for aircrafts with complex geometries. Based on the numerical results, behavior of the aerodynamic sensitivity parameters near the shock wave is discussed. Furthermore, the stability derivatives are analyzed for supersonic and hypersonic flows. The numerical results of the stability derivatives are found in good agreement with theoretical results for supersonic flows, and variations of the aerodynamic force and moment predicted by the stability derivatives are very close to those obtained by CFD simulation for both supersonic and hypersonic flows.

  16. Androgens and Psychosocial Factors Related to Sexual Dysfunctions in Premenopausal Women∗: ∗2016 ISSM Female Sexual Dysfunction Prize.

    Science.gov (United States)

    Wåhlin-Jacobsen, Sarah; Kristensen, Ellids; Pedersen, Anette Tønnes; Laessøe, Nanna Cassandra; Cohen, Arieh S; Hougaard, David M; Lundqvist, Marika; Giraldi, Annamaria

    2017-03-01

    The female sexual response is complex and influenced by several biological, psychological, and social factors. Testosterone is believed to modulate a woman's sexual response and desire, because low levels are considered a risk factor for impaired sexual function, but previous studies have been inconclusive. To investigate how androgen levels and psychosocial factors are associated with female sexual dysfunction (FSD), including hypoactive sexual desire disorder (HSDD). The cross-sectional study included 428 premenopausal women 19 to 58 years old who completed a questionnaire on psychosocial factors and had blood sampled at days 6 to 10 in their menstrual cycle. Logistic regression models were built to test the association among hormone levels, psychosocial factors, and sexual end points. Five different sexual end points were measured using the Female Sexual Function Index and the Female Sexual Distress Scale: impaired sexual function, sexual distress, FSD, low sexual desire, and HSDD. Serum levels of total and free testosterone, androstenedione, dehydroepiandrosterone sulfate, and androsterone glucuronide were analyzed using mass spectrometry. After adjusting for psychosocial factors, women with low sexual desire had significantly lower mean levels of free testosterone and androstenedione compared with women without low sexual desire. None of the androgens were associated with FSD in general or with HSDD in particular. Relationship duration longer than 2 years and mild depressive symptoms increased the risk of having all the sexual end points, including FSD in general and HSDD in particular in multivariate analyses. In this large cross-sectional study, low sexual desire was significantly associated with levels of free testosterone and androstenedione, but FSD in general and HSDD in particular were not associated with androgen levels. Length of relationship and depression were associated with FSD including HSDD. Wåhlin-Jacobsen S, Kristensen E, Tønnes Pedersen A

  17. Omega-3 fatty acid therapy dose-dependently and significantly decreased triglycerides and improved flow-mediated dilation, however, did not significantly improve insulin sensitivity in patients with hypertriglyceridemia.

    Science.gov (United States)

    Oh, Pyung Chun; Koh, Kwang Kon; Sakuma, Ichiro; Lim, Soo; Lee, Yonghee; Lee, Seungik; Lee, Kyounghoon; Han, Seung Hwan; Shin, Eak Kyun

    2014-10-20

    Experimental studies demonstrate that higher intake of omega-3 fatty acids (n-3 FA) improves insulin sensitivity, however, we reported that n-3 FA 2g therapy, most commonly used dosage did not significantly improve insulin sensitivity despite reducing triglycerides by 21% in patients. Therefore, we investigated the effects of different dosages of n-3 FA in patients with hypertriglyceridemia. This was a randomized, single-blind, placebo-controlled, parallel study. Age, sex, and body mass index were matched among groups. All patients were recommended to maintain a low fat diet. Forty-four patients (about 18 had metabolic syndrome/type 2 diabetes mellitus) in each group were given placebo, n-3 FA 1 (O1), 2 (O2), or 4 g (O4), respectively daily for 2 months. n-3 FA therapy dose-dependently and significantly decreased triglycerides and triglycerides/HDL cholesterol and improved flow-mediated dilation, compared with placebo (by ANOVA). However, each n-3 FA therapy did not significantly decrease high-sensitivity C-reactive protein and fibrinogen, compared with placebo. O1 significantly increased insulin levels and decreased insulin sensitivity (determined by QUICKI) and O2 significantly decreased plasma adiponectin levels relative to baseline measurements. Of note, when compared with placebo, each n-3 FA therapy did not significantly change insulin, glucose, adiponectin, glycated hemoglobin levels and insulin sensitivity (by ANOVA). We observed similar results in a subgroup of patients with the metabolic syndrome. n-3 FA therapy dose-dependently and significantly decreased triglycerides and improved flow-mediated dilation. Nonetheless, n-3 FA therapy did not significantly improve acute-phase reactants and insulin sensitivity in patients with hypertriglyceridemia, regardless of dosages. Copyright © 2014. Published by Elsevier Ireland Ltd.

  18. Silver Nanoparticle-Based Fluorescence-Quenching Lateral Flow Immunoassay for Sensitive Detection of Ochratoxin A in Grape Juice and Wine

    Science.gov (United States)

    Jiang, Hu; Li, Xiangmin; Xiong, Ying; Pei, Ke; Nie, Lijuan; Xiong, Yonghua

    2017-01-01

    A silver nanoparticle (AgNP)-based fluorescence-quenching lateral flow immunoassay with competitive format (cLFIA) was developed for sensitive detection of ochratoxin A (OTA) in grape juice and wine samples in the present study. The Ru(phen)32+-doped silica nanoparticles (RuNPs) were sprayed on the test and control line zones as background fluorescence signals. The AgNPs were designed as the fluorescence quenchers of RuNPs because they can block the exciting light transferring to the RuNP molecules. The proposed method exhibited high sensitivity for OTA detection, with a detection limit of 0.06 µg/L under optimized conditions. The method also exhibited a good linear range for OTA quantitative analysis from 0.08 µg/L to 5.0 µg/L. The reliability of the fluorescence-quenching cLFIA method was evaluated through analysis of the OTA-spiked red grape wine and juice samples. The average recoveries ranged from 88.0% to 110.0% in red grape wine and from 92.0% to 110.0% in grape juice. Meanwhile, less than a 10% coefficient variation indicated an acceptable precision of the cLFIA method. In summary, the new AgNP-based fluorescence-quenching cLFIA is a simple, rapid, sensitive, and accurate method for quantitative detection of OTA in grape juice and wine or other foodstuffs. PMID:28264472

  19. Silver Nanoparticle-Based Fluorescence-Quenching Lateral Flow Immunoassay for Sensitive Detection of Ochratoxin A in Grape Juice and Wine

    Directory of Open Access Journals (Sweden)

    Hu Jiang

    2017-02-01

    Full Text Available A silver nanoparticle (AgNP-based fluorescence-quenching lateral flow immunoassay with competitive format (cLFIA was developed for sensitive detection of ochratoxin A (OTA in grape juice and wine samples in the present study. The Ru(phen 3 2 + -doped silica nanoparticles (RuNPs were sprayed on the test and control line zones as background fluorescence signals. The AgNPs were designed as the fluorescence quenchers of RuNPs because they can block the exciting light transferring to the RuNP molecules. The proposed method exhibited high sensitivity for OTA detection, with a detection limit of 0.06 µg/L under optimized conditions. The method also exhibited a good linear range for OTA quantitative analysis from 0.08 µg/L to 5.0 µg/L. The reliability of the fluorescence-quenching cLFIA method was evaluated through analysis of the OTA-spiked red grape wine and juice samples. The average recoveries ranged from 88.0% to 110.0% in red grape wine and from 92.0% to 110.0% in grape juice. Meanwhile, less than a 10% coefficient variation indicated an acceptable precision of the cLFIA method. In summary, the new AgNP-based fluorescence-quenching cLFIA is a simple, rapid, sensitive, and accurate method for quantitative detection of OTA in grape juice and wine or other foodstuffs.

  20. Water-Sensitivity Characteristics of Briquettes Made from High-Rank Coal

    Directory of Open Access Journals (Sweden)

    Geng Yunguang

    2016-01-01

    Full Text Available In order to study the water sensitivity characteristics of the coalbed methane (CBM reservoir in the southern Qinshui Basin, the scanning electron microscopy, mineral composition and the water sensitivity of main coalbed 3 cores were tested and analyzed. Because CBM reservoirs in this area are characterized by low porosity and low permeability, the common water sensitivity experiment of cores can’t be used, instead, the briquettes were chose for the test to analysis the water sensitivity of CBM reservoirs. Results show that: the degree of water sensitivity in the study area varies from week to moderate. The controlling factors of water sensitivity are clay mineral content and the occurrence type of clay minerals, permeability and liquid flow rate. The water sensitivity damage rate is positively correlated with clay mineral content and liquid flow rate, and is negatively correlated with core permeability. The water sensitivity of CBM reservoir exist two damage mechanisms, including static permeability decline caused by clay mineral hydration dilatation and dynamic permeability decline caused by dispersion/migration of clay minerals.

  1. Recent advances in female sexual dysfunction.

    Science.gov (United States)

    Davis, A R

    2000-06-01

    Female sexuality has received little scientific study. Recently, increased interest in this field has generated new research in the epidemiology, pathophysiology, and pharmacotherapy of female sexual dysfunction (FSD). A new FSD classification system has been proposed. Although sexual difficulties are highly prevalent among women, the degree of associated distress is unknown. Risk factors for FSD are probably both psychologic and physiologic. Aging or menopause is associated with lubrication difficulties, which can be treated with hormone replacement. Hysterectomy seems more likely to result in improvement rather then deterioration of sexual functioning. Depression may be a predictor of sexual dysfunction after hysterectomy. Vasoactive agents are currently being evaluated as treatment for female sexual arousal disorder. The most important advance in the study of female sexual function is the recent surge of interest in this relatively unexplored field.

  2. pH-Sensitive Hydrogel for Micro-Fluidic Valve

    Directory of Open Access Journals (Sweden)

    Zhengzhi Yang

    2012-07-01

    Full Text Available The deformation behavior of a pH-sensitive hydrogel micro-fluidic valve system is investigated using inhomogeneous gel deformation theory, in which the fluid-structure interaction (FSI of the gel solid and fluid flow in the pipe is considered. We use a finite element method with a well adopted hydrogel constitutive equation, which is coded in commercial software, ABAQUS, to simulate the hydrogel valve swelling deformation, while FLUENT is adopted to model the fluid flow in the pipe of the hydrogel valve system. The study demonstrates that FSI significantly affects the gel swelling deformed shapes, fluid flow pressure and velocity patterns. FSI has to be considered in the study on fluid flow regulated by hydrogel microfluidic valve. The study provides a more accurate and adoptable model for future design of new pH-sensitive hydrogel valves, and also gives a useful guideline for further studies on hydrogel fluidic applications.

  3. Modeling and sensitivity analysis on the transport of aluminum oxide nanoparticles in saturated sand: effects of ionic strength, flow rate, and nanoparticle concentration.

    Science.gov (United States)

    Rahman, Tanzina; Millwater, Harry; Shipley, Heather J

    2014-11-15

    Aluminum oxide nanoparticles have been widely used in various consumer products and there are growing concerns regarding their exposure in the environment. This study deals with the modeling, sensitivity analysis and uncertainty quantification of one-dimensional transport of nano-sized (~82 nm) aluminum oxide particles in saturated sand. The transport of aluminum oxide nanoparticles was modeled using a two-kinetic-site model with a blocking function. The modeling was done at different ionic strengths, flow rates, and nanoparticle concentrations. The two sites representing fast and slow attachments along with a blocking term yielded good agreement with the experimental results from the column studies of aluminum oxide nanoparticles. The same model was used to simulate breakthrough curves under different conditions using experimental data and calculated 95% confidence bounds of the generated breakthroughs. The sensitivity analysis results showed that slow attachment was the most sensitive parameter for high influent concentrations (e.g. 150 mg/L Al2O3) and the maximum solid phase retention capacity (related to blocking function) was the most sensitive parameter for low concentrations (e.g. 50 mg/L Al2O3). Copyright © 2014 Elsevier B.V. All rights reserved.

  4. Sensitivity Analysis to Control the Far-Wake Unsteadiness Behind Turbines

    Directory of Open Access Journals (Sweden)

    Esteban Ferrer

    2017-10-01

    Full Text Available We explore the stability of wakes arising from 2D flow actuators based on linear momentum actuator disc theory. We use stability and sensitivity analysis (using adjoints to show that the wake stability is controlled by the Reynolds number and the thrust force (or flow resistance applied through the turbine. First, we report that decreasing the thrust force has a comparable stabilising effect to a decrease in Reynolds numbers (based on the turbine diameter. Second, a discrete sensitivity analysis identifies two regions for suitable placement of flow control forcing, one close to the turbines and one far downstream. Third, we show that adding a localised control force, in the regions identified by the sensitivity analysis, stabilises the wake. Particularly, locating the control forcing close to the turbines results in an enhanced stabilisation such that the wake remains steady for significantly higher Reynolds numbers or turbine thrusts. The analysis of the controlled flow fields confirms that modifying the velocity gradient close to the turbine is more efficient to stabilise the wake than controlling the wake far downstream. The analysis is performed for the first flow bifurcation (at low Reynolds numbers which serves as a foundation of the stabilization technique but the control strategy is tested at higher Reynolds numbers in the final section of the paper, showing enhanced stability for a turbulent flow case.

  5. Biomimetic flow sensors for environmental awareness

    NARCIS (Netherlands)

    Krijnen, Gijsbertus J.M.; Dagamseh, A.M.K.

    Crickets possess hairy organs attached to their abdomen, the so-called cerci. These cerci contain highly flow-sensitive mechanosensors that enable the crickets to monitor the flow-field around them and react to specific stimuli form the environment, e.g. air-movements generated by hunting spiders.

  6. Technical advances in flow cytometry-based diagnosis and monitoring of paroxysmal nocturnal hemoglobinuria

    Science.gov (United States)

    Correia, Rodolfo Patussi; Bento, Laiz Cameirão; Bortolucci, Ana Carolina Apelle; Alexandre, Anderson Marega; Vaz, Andressa da Costa; Schimidell, Daniela; Pedro, Eduardo de Carvalho; Perin, Fabricio Simões; Nozawa, Sonia Tsukasa; Mendes, Cláudio Ernesto Albers; Barroso, Rodrigo de Souza; Bacal, Nydia Strachman

    2016-01-01

    ABSTRACT Objective: To discuss the implementation of technical advances in laboratory diagnosis and monitoring of paroxysmal nocturnal hemoglobinuria for validation of high-sensitivity flow cytometry protocols. Methods: A retrospective study based on analysis of laboratory data from 745 patient samples submitted to flow cytometry for diagnosis and/or monitoring of paroxysmal nocturnal hemoglobinuria. Results: Implementation of technical advances reduced test costs and improved flow cytometry resolution for paroxysmal nocturnal hemoglobinuria clone detection. Conclusion: High-sensitivity flow cytometry allowed more sensitive determination of paroxysmal nocturnal hemoglobinuria clone type and size, particularly in samples with small clones. PMID:27759825

  7. Managerial optimism and the impact of cash flow sensitivity on corporate investment: The case of Greece

    Directory of Open Access Journals (Sweden)

    Dimitrios I. Maditinos

    2015-10-01

    Full Text Available Purpose - The existence of optimism as a personal psychological characteristic of managers is a necessity in contemporary economy and decision making, although the phenomenon of over-optimism may lead to unfavourable outcomes. The purpose of this study is to examine the optimism bias and its impact on the firms' future performance. Especially regarding the recent years where Greece faces increased economic depression, high percentages of unemployment and lack of budgetary discipline, the goal is therefore, to find whether managerial optimism has an impact on corporate investment of Greek firms. Design/methodology/approach - The investment of firms with optimistic managers is more sensitive to cash flow than the investment of firms with managers who are not optimistic. To test the research question a number of fixed effect panel regressions of capital expenditures (capital expenditures divided by lagged assets is the dependent variable is run. In all regressions we analyse cash flow divided by lagged assets and lagged Tobin's Q as the independent variables, for firms whose managers are classified as optimistic and not optimistic. This classification is based on the optimism "dummy" variable, which is equal to 1 when members of the Executive Board and the Supervisory Board (ALL, only the Executive Board (EB, and only CEO are classified as optimistic. The concept of this study is tested for firms which are listed in the Athens Stock Exchange. A total of 243 firms are recorded, for the time period between 2007 and 2012, including firms from 11 different industries; basic materials, chemicals, consumer goods, consumer services, health care, industrials, financials, oil and gas, technology, telecommunications and utilities. Based on the literature and on related methodology aspects, financial firms are excluded. Findings - It was revealed that managerial optimism affects corporate investment in firms with high degree of closely held shares. Moreover

  8. A diffusive thermal phase shifter; Dephaseur thermique diffusif

    Energy Technology Data Exchange (ETDEWEB)

    Lachal, B; Hollmuller, P; Zgraggen, J -M [Universite de Geneve, Centre universitaire d' etude des problemes de l' energie(CUEPE), Geneva (Switzerland)

    2004-07-01

    The investigations carried out in this project show that dephasing a thermal oscillation carried by an air flow by utilizing the heat exchange with a diffusive heat store made of thin layers, is possible without any significant damping of the oscillation. The practical application of this phenomenon, with a time shift of 8 to 12 hours, looks particularly attractive for space cooling of buildings during summertime or in hot climates. The possibilities of dephasing completely a thermal wave (i.e. by a half period) carried by a stream of air have been investigated both theoretically by model calculations and experimentally by building two prototypes. Promising results have been obtained for the case of a daily phase shift. In the case of a summer-winter shift the required volumes and lengths seem too large to enable such a storage system becoming cost effective.

  9. Female sexual dysfunction in patients with endometriosis: Indian scenario

    Directory of Open Access Journals (Sweden)

    Vineet V Mishra

    2016-01-01

    Full Text Available Background: Female sexual dysfunction (FSD in Indian women is often overlooked due to cultural beliefs and considered as social taboos. Sexuality is an important and integral part of life. There are many causes of sexual dysfunction, but the prevalence of FSD in endometriotic patients is still underdiagnosed. Materials and Methods: Study design - Cross-sectional observational study conducted at tertiary care center, from June 2015 to March 2016. Sample size - Fifty-one patients in reproductive age group (18-47 years who were diagnosed with endometriosis on diagnostic laparoscopy were included. Methods - FSD was assessed with a detailed 19-item female sexual function index questionnaire. All six domains of sexual dysfunction, i.e., desire, arousal, lubrication, orgasm, satisfaction, and pain were studied. Exclusion - Patients with other gynecological, medical or surgical history were excluded. Results: Out of 51 patients with endometriosis, 47.06% of patients had sexual dysfunction. With the increase in staging of endometriosis, sexual dysfunction prevalence is also rising. FSD was 100% in patients with severe endometriosis as compared to 33.33% in minimal endometriosis. Conclusion: Every individual deserves good sexual life. The sexual dysfunction associated with endometriosis should also be taken into consideration while managing these patients.

  10. Neutron diffraction potentialities at the IBR-2 pulsed reactor for nondestructive testing of structural materials

    International Nuclear Information System (INIS)

    Balagurov, A.M.; Bokuchava, G.D.; Papushkin, I.V.; Sumin, V.V.; Venter, A.M.

    2010-01-01

    Neutron diffraction is widely used for investigations of residual and applied stresses in bulk materials and components. The most important factor in these investigations is the high penetration depth of neutrons (up to 2 cm for steel). At the IBR-2 pulsed reactor in Dubna the Fourier stress diffractometer (FSD) has been constructed to optimize the internal stress measurements. The FSD design satisfies the requirements of high luminosity, high resolution and specific sample environment. The collimator system guarantees a minimum gauge volume of 2x2x2 mm. A mechanical testing machine allows in-situ tension or compression measurements up to a load of 20 kN and sample temperatures up to 800 deg C. In the paper the current status of FSD is reported and potentialities are demonstrated with several examples of investigations performed

  11. A liquid crystal polymer membrane MEMS sensor for flow rate and flow direction sensing applications

    International Nuclear Information System (INIS)

    Kottapalli, A G P; Tan, C W; Olfatnia, M; Miao, J M; Barbastathis, G; Triantafyllou, M

    2011-01-01

    The paper reports the design, fabrication and experimental results of a liquid crystal polymer (LCP) membrane-based pressure sensor for flow rate and flow direction sensing applications. Elaborate experimental testing results demonstrating the sensors' performance as an airflow sensor have been illustrated and validated with theory. MEMS sensors using LCP as a membrane structural material show higher sensitivity and reliability over silicon counterparts. The developed device is highly robust for harsh environment applications such as atmospheric wind flow monitoring and underwater flow sensing. A simple, low-cost and repeatable fabrication scheme has been developed employing low temperatures. The main features of the sensor developed in this work are a LCP membrane with integrated thin film gold piezoresistors deposited on it. The sensor developed demonstrates a good sensitivity of 3.695 mV (ms −1 ) −1 , large operating range (0.1 to >10 ms −1 ) and good accuracy in measuring airflow with an average error of only 3.6% full-scale in comparison with theory. Various feasible applications of the developed sensor have been demonstrated with experimental results. The sensor was tested for two other applications—in clinical diagnosis for breath rate, breath velocity monitoring, and in underwater applications for object detection by sensing near-field spatial flow pressure

  12. Utilizing High-Performance Computing to Investigate Parameter Sensitivity of an Inversion Model for Vadose Zone Flow and Transport

    Science.gov (United States)

    Fang, Z.; Ward, A. L.; Fang, Y.; Yabusaki, S.

    2011-12-01

    High-resolution geologic models have proven effective in improving the accuracy of subsurface flow and transport predictions. However, many of the parameters in subsurface flow and transport models cannot be determined directly at the scale of interest and must be estimated through inverse modeling. A major challenge, particularly in vadose zone flow and transport, is the inversion of the highly-nonlinear, high-dimensional problem as current methods are not readily scalable for large-scale, multi-process models. In this paper we describe the implementation of a fully automated approach for addressing complex parameter optimization and sensitivity issues on massively parallel multi- and many-core systems. The approach is based on the integration of PNNL's extreme scale Subsurface Transport Over Multiple Phases (eSTOMP) simulator, which uses the Global Array toolkit, with the Beowulf-Cluster inspired parallel nonlinear parameter estimation software, BeoPEST in the MPI mode. In the eSTOMP/BeoPEST implementation, a pre-processor generates all of the PEST input files based on the eSTOMP input file. Simulation results for comparison with observations are extracted automatically at each time step eliminating the need for post-process data extractions. The inversion framework was tested with three different experimental data sets: one-dimensional water flow at Hanford Grass Site; irrigation and infiltration experiment at the Andelfingen Site; and a three-dimensional injection experiment at Hanford's Sisson and Lu Site. Good agreements are achieved in all three applications between observations and simulations in both parameter estimates and water dynamics reproduction. Results show that eSTOMP/BeoPEST approach is highly scalable and can be run efficiently with hundreds or thousands of processors. BeoPEST is fault tolerant and new nodes can be dynamically added and removed. A major advantage of this approach is the ability to use high-resolution geologic models to preserve

  13. Probabilistically modeling lava flows with MOLASSES

    Science.gov (United States)

    Richardson, J. A.; Connor, L.; Connor, C.; Gallant, E.

    2017-12-01

    Modeling lava flows through Cellular Automata methods enables a computationally inexpensive means to quickly forecast lava flow paths and ultimate areal extents. We have developed a lava flow simulator, MOLASSES, that forecasts lava flow inundation over an elevation model from a point source eruption. This modular code can be implemented in a deterministic fashion with given user inputs that will produce a single lava flow simulation. MOLASSES can also be implemented in a probabilistic fashion where given user inputs define parameter distributions that are randomly sampled to create many lava flow simulations. This probabilistic approach enables uncertainty in input data to be expressed in the model results and MOLASSES outputs a probability map of inundation instead of a determined lava flow extent. Since the code is comparatively fast, we use it probabilistically to investigate where potential vents are located that may impact specific sites and areas, as well as the unconditional probability of lava flow inundation of sites or areas from any vent. We have validated the MOLASSES code to community-defined benchmark tests and to the real world lava flows at Tolbachik (2012-2013) and Pico do Fogo (2014-2015). To determine the efficacy of the MOLASSES simulator at accurately and precisely mimicking the inundation area of real flows, we report goodness of fit using both model sensitivity and the Positive Predictive Value, the latter of which is a Bayesian posterior statistic. Model sensitivity is often used in evaluating lava flow simulators, as it describes how much of the lava flow was successfully modeled by the simulation. We argue that the positive predictive value is equally important in determining how good a simulator is, as it describes the percentage of the simulation space that was actually inundated by lava.

  14. Developing the ultimate biomimetic flow-sensor array

    NARCIS (Netherlands)

    Bruinink, C.M.; Jaganatharaja, R.K.; de Boer, Meint J.; Berenschot, Johan W.; Kolster, M.L.; Lammerink, Theodorus S.J.; Wiegerink, Remco J.; Krijnen, Gijsbertus J.M.

    2009-01-01

    This contribution reports on the major developments and achievements in our group on fabricating highly sensitive biomimetic flow-sensor arrays. The mechanoreceptive sensory hairs of crickets are taken as a model system for their ability to perceive flow signals at thermal noise levels and,

  15. Gaseous slip flow analysis of a micromachined flow sensor for ultra small flow applications

    Science.gov (United States)

    Jang, Jaesung; Wereley, Steven T.

    2007-02-01

    The velocity slip of a fluid at a wall is one of the most typical phenomena in microscale gas flows. This paper presents a flow analysis considering the velocity slip in a capacitive micro gas flow sensor based on pressure difference measurements along a microchannel. The tangential momentum accommodation coefficient (TMAC) measurements of a particular channel wall in planar microchannels will be presented while the previous micro gas flow studies have been based on the same TMACs on both walls. The sensors consist of a pair of capacitive pressure sensors, inlet/outlet and a microchannel. The main microchannel is 128.0 µm wide, 4.64 µm deep and 5680 µm long, and operated under nearly atmospheric conditions where the outlet Knudsen number is 0.0137. The sensor was fabricated using silicon wet etching, ultrasonic drilling, deep reactive ion etching (DRIE) and anodic bonding. The capacitance change of the sensor and the mass flow rate of nitrogen were measured as the inlet-to-outlet pressure ratio was varied from 1.00 to 1.24. The measured maximum mass flow rate was 3.86 × 10-10 kg s-1 (0.019 sccm) at the highest pressure ratio tested. As the pressure difference increased, both the capacitance of the differential pressure sensor and the flow rate through the main microchannel increased. The laminar friction constant f sdot Re, an important consideration in sensor design, varied from the incompressible no-slip case and the mass sensitivity and resolution of this sensor were discussed. Using the current slip flow formulae, a microchannel with much smaller mass flow rates can be designed at the same pressure ratios.

  16. Gas magnetometer

    Science.gov (United States)

    Walker, Thad Gilbert; Lancor, Brian Robert; Wyllie, Robert

    2016-05-03

    Measurement of a precessional rate of a gas, such as an alkali gas, in a magnetic field is made by promoting a non-uniform precession of the gas in which substantially no net magnetic field affects the gas during a majority of the precession cycle. This allows sensitive gases that would be subject to spin-exchange collision de-phasing to be effectively used for extremely sensitive measurements in the presence of an environmental magnetic field such as the Earth's magnetic field.

  17. Exciton coherence in semiconductor quantum dots

    International Nuclear Information System (INIS)

    Ishi-Hayase, Junko; Akahane, Kouichi; Yamamoto, Naokatsu; Sasaki, Masahide; Kujiraoka, Mamiko; Ema, Kazuhiro

    2009-01-01

    The coherent dynamics of excitons in InAs quantum dots (QDs) was investigated in the telecommunication wavelength range using a transient four-wave mixing technique. The sample was fabricated on an InP(311)B substrate using strain compensation to control the emission wavelength. This technique also enabled us to fabricate a 150-layer stacked QD structure for obtaining a high S/N in the four-wave mixing measurements, although no high-sensitive heterodyne detection was carried out. The dephasing time and transition dipole moment were precisely estimated from the polarization dependence of signals, taking into account their anisotropic properties. The population lifetimes of the excitons were also measured by using a polarization-dependent pumpprobe technique. A quantitative comparison of these anisotropies demonstrates that in our QDs, non-radiative population relaxation, polarization relaxation and pure dephasing are considerably smaller than the radiative relaxation. A comparison of the results of the four-wave mixing and pump-probe measurements revealed that the pure dephasing could be directly estimated with an accuracy of greater than 0.1 meV by comparing the results of four-wave mixing and pump-probe measurements. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  18. Low-level flow counting of liquid chromatography column eluates

    International Nuclear Information System (INIS)

    Harding, N.G.L.; Farid, Y.; Stewart, M.J.

    1982-01-01

    The principal parameters which determine the operation of a high-resolution, high-sensitivity radioactive flow monitor are described: a) Sample preparation to ensure adequate recovery of radiolabelled sample, metabolites and internal standard. b) The instrument background count rate, when no sample or radiolabel is present in the flow cell, is a function of shielding and a reduction in noise obtained with a coincidence time below one microsecond. c) The minimum detectable amount of label depends upon the machine background, HPLC eluent and scintillator flow, whether or not packed flow cells are used, flow cell geometry, and the scintillator used. d) Three types of flow cell have been designed to cover the majority of HPLC and isotope applications. e) The performance of solid and liquid scintillators. It is shown that an instrument has been designed taking account of these parameters. The resulting design satisfies present high sensitivity counting requirements and maintains the resolution of current HPLC procedures when detection is by simultaneous flow radioassay and by optical methods. (orig.)

  19. Androgens and Psychosocial Factors Related to Sexual Dysfunctions in Premenopausal Women

    DEFF Research Database (Denmark)

    Wåhlin-Jacobsen, Sarah; Kristensen, Ellids; Pedersen, Anette Tønnes

    2017-01-01

    a questionnaire on psychosocial factors and had blood sampled at days 6 to 10 in their menstrual cycle. Logistic regression models were built to test the association among hormone levels, psychosocial factors, and sexual end points. Main Outcome Measures Five different sexual end points were measured using...... duration longer than 2 years and mild depressive symptoms increased the risk of having all the sexual end points, including FSD in general and HSDD in particular in multivariate analyses. Conclusion In this large cross-sectional study, low sexual desire was significantly associated with levels of free...... testosterone and androstenedione, but FSD in general and HSDD in particular were not associated with androgen levels. Length of relationship and depression were associated with FSD including HSDD. Wåhlin-Jacobsen S, Kristensen E, Tønnes Pedersen A, et al. Androgens and Psychosocial Factors Related to Sexual Dysfunctions...

  20. Nocturnal reverse flow in water-in-glass evacuated tube solar water heaters

    International Nuclear Information System (INIS)

    Tang, Runsheng; Yang, Yuqin

    2014-01-01

    Highlights: • Performance of water-in-glass evacuated tube solar water heaters (SWH) at night was studied. • Experimental measurements showed that reverse flow occurred in SWHs at night. • Reverse flow in SWHs was very high but the heat loss due to reverse flow was very low. • Reverse flow seemed not sensitive to atmospheric clearness but sensitive to collector tilt-angle. - Abstract: In this work, the thermal performance of water-in-glass evacuated tube solar water heaters (SWH) at nights was experimentally investigated. Measurements at nights showed that the water temperature in solar tubes was always lower than that in the water tank but higher than the ambient air temperature and T exp , the temperature of water inside tubes predicted in the case of the water in tubes being naturally cooled without reverse flow. This signified that the reverse flow in the system occurred at nights, making the water in solar tubes higher than T exp . It is found that the reverse flow rate in the SWH, estimated based on temperature measurements of water in solar tubes, seemed not sensitive to the atmospheric clearness but sensitive to the collector tilt-angle, the larger the tilt-angle of the collector, the higher the reverse flow rate. Experimental results also showed that, the reverse flow in the SWH was much higher as compared to that in a thermosyphonic domestic solar water heater with flat-plate collectors, but the heat loss from collectors to the air due to reverse flow in SWHs was very small and only took about 8–10% of total heat loss of systems

  1. Development and initial validation of the vaginal penetration cognition questionnaire (VPCQ) in a sample of women with vaginismus and dyspareunia.

    Science.gov (United States)

    Klaassen, Maaike; Ter Kuile, Moniek M

    2009-06-01

    Although the relevance of cognitions has been implicated in the etiology, explanatory models, and treatment of female sexual pain disorders, an instrument that assesses vaginal penetration cognitions is nonexistent. The aim of this study was to develop and to investigate the psychometric properties of the Vaginal Penetration Cognition Questionnaire (VPCQ). The VPCQ was explicitly designed to assess cognitions regarding vaginal penetration in women with vaginismus and dyspareunia. A sample of 247 Dutch women with a female sexual dysfunction (FSD; 122 women with lifelong vaginismus and 125 women with dyspareunia) and 117 women without sexual complaints completed the questionnaire. Factor analyses were only conducted in the sample of women with FSD. Validation measures were conducted in both women with and without FSD. All women completed the VPCQ and several additional questions regarding biographic and complaint characteristics. Conduction of factor analyses yielded five subscales regarding cognitions about vaginal penetration: "control cognitions,"catastrophic and pain cognitions,"self-image cognitions,"positive cognitions," and "genital incompatibility cognitions." Reliability of these five VPCQ subscales ranged from 0.70 to 0.83, and the test-retest correlations were satisfactory. The five VPCQ subscales were reasonably stable across demographic variables and demonstrated good discriminant validity. All five subscales were able to detect significant differences between women with and without FSD. Additionally, the four subscales of the VPCQ concerning negative cognitions demonstrated the ability to differentiate between the two samples of women with FSD. Women with lifelong vaginismus reported lower levels of perceived penetration control and higher levels of catastrophic and pain cognitions, negative self-image cognitions, and genital incompatibility cognitions, when compared with women with dyspareunia. The present study indicates that the VPCQ is a valid and

  2. [Evaluation of production and clinical working time of computer-aided design/computer-aided manufacturing (CAD/CAM) custom trays for complete denture].

    Science.gov (United States)

    Wei, L; Chen, H; Zhou, Y S; Sun, Y C; Pan, S X

    2017-02-18

    To compare the technician fabrication time and clinical working time of custom trays fabricated using two different methods, the three-dimensional printing custom trays and the conventional custom trays, and to prove the feasibility of the computer-aided design/computer-aided manufacturing (CAD/CAM) custom trays in clinical use from the perspective of clinical time cost. Twenty edentulous patients were recruited into this study, which was prospective, single blind, randomized self-control clinical trials. Two custom trays were fabricated for each participant. One of the custom trays was fabricated using functional suitable denture (FSD) system through CAD/CAM process, and the other was manually fabricated using conventional methods. Then the final impressions were taken using both the custom trays, followed by utilizing the final impression to fabricate complete dentures respectively. The technician production time of the custom trays and the clinical working time of taking the final impression was recorded. The average time spent on fabricating the three-dimensional printing custom trays using FSD system and fabricating the conventional custom trays manually were (28.6±2.9) min and (31.1±5.7) min, respectively. The average time spent on making the final impression with the three-dimensional printing custom trays using FSD system and the conventional custom trays fabricated manually were (23.4±11.5) min and (25.4±13.0) min, respectively. There was significant difference in the technician fabrication time and the clinical working time between the three-dimensional printing custom trays using FSD system and the conventional custom trays fabricated manually (Pmanufacture custom trays by three-dimensional printing method, there is no need to pour preliminary cast after taking the primary impression, therefore, it can save the impression material and model material. As to completing denture restoration, manufacturing custom trays using FSD system is worth being

  3. Prevalence and Factors Associated with Female Sexual Dysfunction in Beijing, China.

    Science.gov (United States)

    Lou, Wen-Jia; Chen, Bo; Zhu, Lan; Han, Shao-Mei; Xu, Tao; Lang, Jing-He; Zhang, Lei

    2017-06-20

    Female sexual dysfunction (FSD) is a highly prevalent and often underestimated problem. However, large-scale, population-based epidemiological surveys of FSD are scarce in China. The present study was conducted to evaluate the prevalence and the potential risk factors of FSD across a selection of social groups in Beijing, China, based on the Female Sexual Function Index (FSFI). A cross-sectional study based on the multiple-stage cluster sampling was performed with adult women throughout the Dongcheng and Shunyi districts of Beijing. The Chinese version of FSFI was used, as well as questions on demographic characteristics, the disease-related context, and social relationships. A total of 6000 consecutive women entered this study, with an actual response from 5024 women, corresponding to a response rate of 83.7%. A total of 4697 (78.3%) questionnaires were effective. The prevalence of adult FSD in Beijing was 2973 (63.3%) using a score of 26.55 as the boundary value, whereas the total mean FSFI score was 23.92 ± 6.37. However, 1423 (30.3%) women did not seek help. By multivariate logistic regression analysis, the possible potential risk factors included age (odds ratio [OR] = 1.051), dissatisfaction with the spouse's sexual ability (OR = 3.520), poor marital affection (OR = 2.087), spouse sexual difficulties (OR = 1.720), dissatisfaction with married life (OR = 1.476), living in a rural area (OR = 1.292), chronic pelvic pain (OR = 1.261), chronic disease (OR = 1.534), previous pelvic surgery (OR = 1.605), vaginal delivery (OR = 2.285), lower education (OR = 3.449) and postmenopausal (OR = 3.183). As suggested by the FSFI scores, female sexual problems are highly prevalent in Beijing. Dissatisfaction with the spouse's sexual ability, poor marital affection, sexual difficulties of the spouse, dissatisfaction with the marriage, rural life, CPP, and postmenopausal were conceivable risk factors for FSD in Beijing women.

  4. Time-integrated activity coefficient estimation for radionuclide therapy using PET and a pharmacokinetic model: A simulation study on the effect of sampling schedule and noise

    Energy Technology Data Exchange (ETDEWEB)

    Hardiansyah, Deni [Medical Radiation Physics/Radiation Protection, Medical Faculty Mannheim, Universitätsmedizin Mannheim, Heidelberg University, Mannheim 68167, Germany and Department of Radiation Oncology, Medical Faculty Mannheim, Universitätsmedizin Mannheim, Heidelberg University, Mannheim 68167 (Germany); Guo, Wei; Glatting, Gerhard, E-mail: gerhard.glatting@medma.uni-heidelberg.de [Medical Radiation Physics/Radiation Protection, Medical Faculty Mannheim, Universitätsmedizin Mannheim, Heidelberg University, Mannheim 68167 (Germany); Kletting, Peter [Department of Nuclear Medicine, Ulm University, Ulm 89081 (Germany); Mottaghy, Felix M. [Department of Nuclear Medicine, University Hospital, RWTH Aachen University, Aachen 52074, Germany and Department of Nuclear Medicine, Maastricht University Medical Center MUMC+, Maastricht 6229 (Netherlands)

    2016-09-15

    Purpose: The aim of this study was to investigate the accuracy of PET-based treatment planning for predicting the time-integrated activity coefficients (TIACs). Methods: The parameters of a physiologically based pharmacokinetic (PBPK) model were fitted to the biokinetic data of 15 patients to derive assumed true parameters and were used to construct true mathematical patient phantoms (MPPs). Biokinetics of 150 MBq {sup 68}Ga-DOTATATE-PET was simulated with different noise levels [fractional standard deviation (FSD) 10%, 1%, 0.1%, and 0.01%], and seven combinations of measurements at 30 min, 1 h, and 4 h p.i. PBPK model parameters were fitted to the simulated noisy PET data using population-based Bayesian parameters to construct predicted MPPs. Therapy simulations were performed as 30 min infusion of {sup 90}Y-DOTATATE of 3.3 GBq in both true and predicted MPPs. Prediction accuracy was then calculated as relative variability v{sub organ} between TIACs from both MPPs. Results: Large variability values of one time-point protocols [e.g., FSD = 1%, 240 min p.i., v{sub kidneys} = (9 ± 6)%, and v{sub tumor} = (27 ± 26)%] show inaccurate prediction. Accurate TIAC prediction of the kidneys was obtained for the case of two measurements (1 and 4 h p.i.), e.g., FSD = 1%, v{sub kidneys} = (7 ± 3)%, and v{sub tumor} = (22 ± 10)%, or three measurements, e.g., FSD = 1%, v{sub kidneys} = (7 ± 3)%, and v{sub tumor} = (22 ± 9)%. Conclusions: {sup 68}Ga-DOTATATE-PET measurements could possibly be used to predict the TIACs of {sup 90}Y-DOTATATE when using a PBPK model and population-based Bayesian parameters. The two time-point measurement at 1 and 4 h p.i. with a noise up to FSD = 1% allows an accurate prediction of the TIACs in kidneys.

  5. A sensitive lateral flow biosensor for Escherichia coli O157:H7 detection based on aptamer mediated strand displacement amplification

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Wei [College of Food Science and Engineering, Ocean University of China, Qingdao 266003 (China); Zhao, Shiming [Key Laboratory of Regenerative Biology, South China Institute for Stem Cell Biology and Regenerative Medicine, Guangzhou Institutes of Biomedicine and Health, Chinese Academy of Sciences, Guangzhou 510530 (China); Mao, Yiping [Yueyang Institute for Food and Drug Control, Yueyang 430198 (China); Fang, Zhiyuan [Affiliated Tumor Hospital of Guangzhou Medical University, Guangzhou 510095 (China); Lu, Xuewen [Key Laboratory of Regenerative Biology, South China Institute for Stem Cell Biology and Regenerative Medicine, Guangzhou Institutes of Biomedicine and Health, Chinese Academy of Sciences, Guangzhou 510530 (China); Zeng, Lingwen, E-mail: zeng6@yahoo.com [Key Laboratory of Regenerative Biology, South China Institute for Stem Cell Biology and Regenerative Medicine, Guangzhou Institutes of Biomedicine and Health, Chinese Academy of Sciences, Guangzhou 510530 (China)

    2015-02-25

    Highlights: • Limit of detection as low as 10 CFU mL{sup −1}Escherichia coli O157:H7. • No need of antibodies and substituted with aptamers. • Isothermal strand displacement amplification for signal amplification. • Results observed by the naked eye. • Great potential application in the area of food control. - Abstract: Foodborne diseases caused by pathogens are one of the major problems in food safety. Convenient and sensitive point-of-care rapid diagnostic tests for food-borne pathogens have been a long-felt need of clinicians. Commonly used methods for pathogen detection rely on conventional culture-based tests, antibody-based assays and polymerase chain reaction (PCR)-based techniques. These methods are costly, laborious and time-consuming. Herein, we present a simple and sensitive aptamer based biosensor for rapid detection of Escherichia coli O157:H7 (E. coli O157:H7). In this assay, two different aptamers specific for the outmembrane of E. coli O157:H7 were used. One of the aptamers was used for magnetic bead enrichment, and the other was used as a signal reporter for this pathogen, which was amplified by isothermal strand displacement amplification (SDA) and further detected by a lateral flow biosensor. Only the captured aptamers on cell membrane were amplified, limitations of conventional DNA amplification based method such as false-positive can be largely reduced. The generated signals (red bands on the test zone of a lateral flow strip) can be unambiguously read out by the naked eye. As low as 10 colony forming units (CFU) of E. coli O157:H7 were detected in this study. Without DNA extraction, the reduced handling and simpler equipment requirement render this assay a simple and rapid alternative to conventional methods.

  6. A sensitive lateral flow biosensor for Escherichia coli O157:H7 detection based on aptamer mediated strand displacement amplification

    International Nuclear Information System (INIS)

    Wu, Wei; Zhao, Shiming; Mao, Yiping; Fang, Zhiyuan; Lu, Xuewen; Zeng, Lingwen

    2015-01-01

    Highlights: • Limit of detection as low as 10 CFU mL −1 Escherichia coli O157:H7. • No need of antibodies and substituted with aptamers. • Isothermal strand displacement amplification for signal amplification. • Results observed by the naked eye. • Great potential application in the area of food control. - Abstract: Foodborne diseases caused by pathogens are one of the major problems in food safety. Convenient and sensitive point-of-care rapid diagnostic tests for food-borne pathogens have been a long-felt need of clinicians. Commonly used methods for pathogen detection rely on conventional culture-based tests, antibody-based assays and polymerase chain reaction (PCR)-based techniques. These methods are costly, laborious and time-consuming. Herein, we present a simple and sensitive aptamer based biosensor for rapid detection of Escherichia coli O157:H7 (E. coli O157:H7). In this assay, two different aptamers specific for the outmembrane of E. coli O157:H7 were used. One of the aptamers was used for magnetic bead enrichment, and the other was used as a signal reporter for this pathogen, which was amplified by isothermal strand displacement amplification (SDA) and further detected by a lateral flow biosensor. Only the captured aptamers on cell membrane were amplified, limitations of conventional DNA amplification based method such as false-positive can be largely reduced. The generated signals (red bands on the test zone of a lateral flow strip) can be unambiguously read out by the naked eye. As low as 10 colony forming units (CFU) of E. coli O157:H7 were detected in this study. Without DNA extraction, the reduced handling and simpler equipment requirement render this assay a simple and rapid alternative to conventional methods

  7. Motion-sensitized SPRITE measurements of hydrodynamic cavitation in fast pipe flow.

    Science.gov (United States)

    Adair, Alexander; Mastikhin, Igor V; Newling, Benedict

    2018-06-01

    The pressure variations experienced by a liquid flowing through a pipe constriction can, in some cases, result in the formation of a bubble cloud (i.e., hydrodynamic cavitation). Due to the nature of the bubble cloud, it is ideally measured through the use of non-optical and non-invasive techniques; therefore, it is well-suited for study by magnetic resonance imaging. This paper demonstrates the use of Conical SPRITE (a 3D, centric-scan, pure phase-encoding pulse sequence) to acquire time-averaged void fraction and velocity information about hydrodynamic cavitation for water flowing through a pipe constriction. Copyright © 2018 Elsevier Inc. All rights reserved.

  8. Well-width dependence of exciton-phonon scattering in InxGa1 - xAs/GaAs single quantum wells

    DEFF Research Database (Denmark)

    Borri, Paola; Langbein, Wolfgang Werner; Hvam, Jørn Märcher

    1999-01-01

    The temperature and density dependencies of the exciton dephasing time in In0.18Ga0.82As/GaAs single quantum wells with different thicknesses have been measured by degenerate four-wave mixing; The exciton-phonon scattering contribution to the dephasing is isolated by extrapolating the dephasing r...

  9. Compact Mass Flow Meter Based on a Micro Coriolis Flow Sensor

    Directory of Open Access Journals (Sweden)

    Remco Wiegerink

    2013-03-01

    Full Text Available In this paper we demonstrate a compact ready-to-use micro Coriolis mass flow meter. The full scale flow is 1 g/h (for water at a pressure drop < 1 bar. It has a zero stability of 2 mg/h and an accuracy of 0.5% reading for both liquids and gases. The temperature drift between 10 and 50 °C is below 1 mg/h/°C. The meter is robust, has standard fluidic connections and can be read out by means of a PC or laptop via USB. Its performance was tested for several common gases (hydrogen, helium, nitrogen, argon and air and liquids (water and isopropanol. As in all Coriolis mass flow meters, the meter is also able to measure the actual density of the medium flowing through the tube. The sensitivity of the measured density is ~1 Hz.m3/kg.

  10. Timescales of Coherent Dynamics in the Light Harvesting Complex 2 (LH2) of Rhodobacter sphaeroides.

    Science.gov (United States)

    Fidler, Andrew F; Singh, Ved P; Long, Phillip D; Dahlberg, Peter D; Engel, Gregory S

    2013-05-02

    The initial dynamics of energy transfer in the light harvesting complex 2 from Rhodobacter sphaeroides were investigated with polarization controlled two-dimensional spectroscopy. This method allows only the coherent electronic motions to be observed revealing the timescale of dephasing among the excited states. We observe persistent coherence among all states and assign ensemble dephasing rates for the various coherences. A simple model is utilized to connect the spectroscopic transitions to the molecular structure, allowing us to distinguish coherences between the two rings of chromophores and coherences within the rings. We also compare dephasing rates between excited states to dephasing rates between the ground and excited states, revealing that the coherences between excited states dephase on a slower timescale than coherences between the ground and excited states.

  11. SPATIOTEMPORAL CONTRAST SENSITIVITY OF EARLY VISION

    NARCIS (Netherlands)

    Hateren, J.H. van

    Based on the spatial and temporal statistics of natural images, a theory is developed that specifies spatiotemporal filters that maximize the flow of information through noisy channels of limited dynamic range. Sensitivities resulting from these spatiotemporal filters are very similar to the human

  12. Effect of training on insulin sensitivity of glucose uptake and lipolysis in human adipose tissue

    DEFF Research Database (Denmark)

    Stallknecht, B; Larsen, J J; Mikines, K J

    2000-01-01

    Training increases insulin sensitivity of both whole body and muscle in humans. To investigate whether training also increases insulin sensitivity of adipose tissue, we performed a three-step hyperinsulinemic, euglycemic clamp in eight endurance-trained (T) and eight sedentary (S) young men...... (glucose only). Adipose tissue blood flow was measured by (133)Xe washout. In the basal state, adipose tissue blood flow tended to be higher in T compared with S subjects, and in both groups blood flow was constant during the clamp. The change from basal in arterial-interstitial glucose concentration......-time: T, 44 +/- 9 min (n = 7); S, 102 +/- 23 min (n = 5); P training enhances insulin sensitivity of glucose uptake in subcutaneous adipose tissue and in skeletal muscle. Furthermore, interstitial glycerol data suggest that training also increases insulin sensitivity of lipolysis...

  13. Sexual dysfunction in premenopausal women could be related to hormonal profile.

    Science.gov (United States)

    Vale, Fabiene Bernardes Castro; Coimbra, Bruna Barbosa; Lopes, Gerson Pereira; Geber, Selmo

    2017-02-01

    Female sexual dysfunction (FSD) is a public health problem that affects women's quality of life. Although the relationship between some hormones and the FSD has been described, it is not well established for all hormones. Therefore, the aim of our study was to evaluate the association between hormonal dysfunction and sexual dysfunction in premenopausal women. We performed a cross-sectional study with 60 patients with regular menstrual cycles, with age ranging from 18 to 44 years, with previous diagnosis of FSD. All patients were evaluated using the female sexual function index (FSFI) questionnaire and had the levels of total testosterone, prolactin (PRL), thyroid-releasing hormone and free testosterone index measured. Among the 60 patients, 43 (71.7%) were diagnosed with hypoactive sexual desire disorder (HSDD), 9 (15%) had anorgasmy and 8 (3.3%) had sexual pain dysfunction. Hormonal evaluation, demonstrated that 79.1% of patients with HSDD, 78.4% of patients with anorgasmy and 50% of patients with sexual pain dysfunction had female androgen insensitivity. We can conclude that there is an important association between low levels of total and free testosterone and FSD. This finding offers a new alternative for diagnosis and treatment of HSDD. Moreover, given the potential role of androgens in sexual function, randomized controlled trials with adequate long-term follow-up are essential to confirm its possible effect.

  14. Assessment of sexually related personal distress accompanying premenopausal sexual dysfunction with an Arabic version of the Female Sexual Distress Scale.

    Science.gov (United States)

    Ahmed, Magdy R; Shaaban, Mohamed M; Meky, Heba K

    2017-10-01

    To assess sexually related personal distress among premenopausal women with female sexual dysfunction (FSD) via a validated Arabic version of the Female Sexual Distress Scale (FSDS). A cross-sectional study was conducted among women attending Suez Canal University Hospital, Egypt, between May 2015 and July 2016. In a pilot study to evaluate test-retest reliability and internal consistency, 42 sexually active premenopausal women (aged ≥20 years) completed the Arabic FSDS at recruitment and 2 weeks later. Subsequently, premenopausal sexually active women (aged 20-45 years) were asked to complete the female sexual function index (FSFI) questionnaire; those with FSD (FSFI score ≤26.55) were invited to return to complete the validated version of the Arabic FSDS. The Arabic FSDS showed good test-retest reliability (Pearson correlation coefficient 0.93-0.98) and internal consistency (Cronbach α 0.83-0.92). Overall, 140 (58.1%) of 241 women who completed the FSFI had sexual dysfunction, of whom 51 (36.4%) had sexually related personal distress. Marriage duration was significantly increased among women with FSD (P<0.001). All FSFI sexual domains except lubrication were negatively correlated with FSDS. FSD and sexually related personal distress were highly interrelated and prevalent. An Arabic version of the FSDS was found to be valid and reliable for evaluation of sexually related personal distress. © 2017 International Federation of Gynecology and Obstetrics.

  15. Model dependence of isospin sensitive observables at high densities

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Wen-Mei [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); School of Science, Huzhou Teachers College, Huzhou 313000 (China); Yong, Gao-Chan, E-mail: yonggaochan@impcas.ac.cn [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); State Key Laboratory of Theoretical Physics, Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100190 (China); Wang, Yongjia [School of Science, Huzhou Teachers College, Huzhou 313000 (China); School of Nuclear Science and Technology, Lanzhou University, Lanzhou 730000 (China); Li, Qingfeng [School of Science, Huzhou Teachers College, Huzhou 313000 (China); Zhang, Hongfei [School of Nuclear Science and Technology, Lanzhou University, Lanzhou 730000 (China); State Key Laboratory of Theoretical Physics, Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100190 (China); Zuo, Wei [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); State Key Laboratory of Theoretical Physics, Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100190 (China)

    2013-10-07

    Within two different frameworks of isospin-dependent transport model, i.e., Boltzmann–Uehling–Uhlenbeck (IBUU04) and Ultrarelativistic Quantum Molecular Dynamics (UrQMD) transport models, sensitive probes of nuclear symmetry energy are simulated and compared. It is shown that neutron to proton ratio of free nucleons, π{sup −}/π{sup +} ratio as well as isospin-sensitive transverse and elliptic flows given by the two transport models with their “best settings”, all have obvious differences. Discrepancy of numerical value of isospin-sensitive n/p ratio of free nucleon from the two models mainly originates from different symmetry potentials used and discrepancies of numerical value of charged π{sup −}/π{sup +} ratio and isospin-sensitive flows mainly originate from different isospin-dependent nucleon–nucleon cross sections. These demonstrations call for more detailed studies on the model inputs (i.e., the density- and momentum-dependent symmetry potential and the isospin-dependent nucleon–nucleon cross section in medium) of isospin-dependent transport model used. The studies of model dependence of isospin sensitive observables can help nuclear physicists to pin down the density dependence of nuclear symmetry energy through comparison between experiments and theoretical simulations scientifically.

  16. Rapid quantification of live/dead lactic acid bacteria in probiotic products using high-sensitivity flow cytometry

    Science.gov (United States)

    He, Shengbin; Hong, Xinyi; Huang, Tianxun; Zhang, Wenqiang; Zhou, Yingxing; Wu, Lina; Yan, Xiaomei

    2017-06-01

    A laboratory-built high-sensitivity flow cytometer (HSFCM) was employed for the rapid and accurate detection of lactic acid bacteria (LAB) and their viability in probiotic products. LAB were stained with both the cell membrane-permeable SYTO 9 green-fluorescent nucleic acid stain and the red-fluorescent nucleic acid stain, propidium iodide, which penetrates only bacteria with compromised membranes. The side scatter and dual-color fluorescence signals of single bacteria were detected simultaneously by the HSFCM. Ultra-high temperature processing milk and skim milk spiked with Lactobacillus casei were used as the model systems for the optimization of sample pretreatment and staining. The viable LAB counts measured by the HSFCM were in good agreement with those of the plate count method, and the measured ratios between the live and dead LAB matched well with the theoretical ratios. The established method was successfully applied to the rapid quantification of live/dead LAB in yogurts and fermented milk beverages of different brands. Moreover, the concentration and viability status of LAB in ambient yogurt, a relatively new yet popular milk product in China, are also reported.

  17. Enhanced quantum coherence in graphene caused by Pd cluster deposition

    International Nuclear Information System (INIS)

    Qin, Yuyuan; Han, Junhao; Du, Yongping; Li, Zhaoguo; Wan, Xiangang; Han, Min; Song, Fengqi; Guo, Guoping; Song, You; Pi, Li; Wang, Xuefeng

    2015-01-01

    We report on the unexpected increase in the dephasing lengths of a graphene sheet caused by the deposition of Pd nanoclusters, as demonstrated by weak localization measurements. The dephasing lengths reached saturated values at low temperatures. Theoretical calculations indicate the p-type charge transfer from the Pd clusters, which contributes more carriers. The saturated values of dephasing lengths often depend on both the carrier concentration and mean free path. Although some impurities are increased as revealed by decreased mobilities, the intense charge transfer leads to the improved saturated values and subsequent improved dephasing lengths

  18. High-resolution flow imaging of the carotid arteries

    International Nuclear Information System (INIS)

    Masaryk, T.J.; Modic, M.T.; Haacke, E.M.; Lenz, G.W.; Ross, J.S.

    1986-01-01

    Recently, high-contrast vascular images have been demonstrated using short TEs, gating and subtraction. However, to obtain short TE values, large gradients are required. This potentially limits the field of view, signal-to-noise- ratio, and resolution. Furthermore, gating in different parts of the cardiac cycle can lead to pixel misregistration. In this study, additional refocusing gradients were applied so that no velocity-dependent dephasing occurs at the echo restoring signal from moving blood. Two cardiac-gated sequences using the same trigger delay and one acquisition were obtained. Preliminary results indicate that good quality vascular images of the carotid bifurcation can be obtained with modifications of the spin-echo technique of with short TEs utilizing a gradient echo technique

  19. Interplay between Dephasing and Geometry and Directed Heat Flow in Exciton Transfer Complexes

    OpenAIRE

    Dubi, Yonatan

    2015-01-01

    The striking efficiency of energy transfer in natural photosynthetic systems and the recent evidence of long-lived quantum coherence in biological light harvesting complexes has triggered much excitement, due to the evocative possibility that these systems - essential to practically all life on earth -- use quantum mechanical effects to achieve optimal functionality. A large body of theoretical work has addressed the role of local environments in determining the transport properties of excito...

  20. Uncertainty analysis of power monitoring transit time ultrasonic flow meters

    International Nuclear Information System (INIS)

    Orosz, A.; Miller, D. W.; Christensen, R. N.; Arndt, S.

    2006-01-01

    A general uncertainty analysis is applied to chordal, transit time ultrasonic flow meters that are used in nuclear power plant feedwater loops. This investigation focuses on relationships between the major parameters of the flow measurement. For this study, mass flow rate is divided into three components, profile factor, density, and a form of volumetric flow rate. All system parameters are used to calculate values for these three components. Uncertainty is analyzed using a perturbation method. Sensitivity coefficients for major system parameters are shown, and these coefficients are applicable to a range of ultrasonic flow meters used in similar applications. Also shown is the uncertainty to be expected for density along with its relationship to other system uncertainties. One other conclusion is that pipe diameter sensitivity coefficients may be a function of the calibration technique used. (authors)

  1. First-Principle Characterization for Singlet Fission Couplings.

    Science.gov (United States)

    Yang, Chou-Hsun; Hsu, Chao-Ping

    2015-05-21

    The electronic coupling for singlet fission, an important parameter for determining the rate, has been found to be too small unless charge-transfer (CT) components were introduced in the diabatic states, mostly through perturbation or a model Hamiltonian. In the present work, the fragment spin difference (FSD) scheme was generalized to calculate the singlet fission coupling. The largest coupling strength obtained was 14.8 meV for two pentacenes in a crystal structure, or 33.7 meV for a transition-state structure, which yielded a singlet fission lifetime of 239 or 37 fs, generally consistent with experimental results (80 fs). Test results with other polyacene molecules are similar. We found that the charge on one fragment in the S1 diabatic state correlates well with FSD coupling, indicating the importance of the CT component. The FSD approach is a useful first-principle method for singlet fission coupling, without the need to include the CT component explicitly.

  2. Chemical decontamination for decommissioning - the Jose Cabrera (Zorita) NPP

    International Nuclear Information System (INIS)

    Madrid Garcia, F.; Holgado, A.; Pomar, C.; Gammon, Th.; Bradbury, D.

    2008-01-01

    The Jose Cabrera (Zorita) NPP is located in the Guadalajara province of Spain approximately 66 km northeast of Madrid. It is a single loop Westinghouse Pressurized Water Reactor (PWR) design cooled by the waters of the River Tajo. The plant was synchronized to the grid in 1968 and was permanently shutdown on April 30, 2006. UNION FENOSA Generacion has been the owner and operator of the plant and will hand over decommissioning activities to Empresa Nacional de Residuous Radiactivos, S.A. (ENRESA) in approximately two years. During the fall and winter of 2006, Westinghouse Electric Company performed a Full System Decontamination (FSD) in preparation for decommissioning activities. The FSD was performed on the Reactor Coolant System (RCS) including the Residual Heat Removal System (RHRS) and the Chemical Volume and Control System (CVCS). The FSD was performed to facilitate decommissioning activities by reducing general area dose rates and lowering contamination levels to reduce disposal costs. (authors)

  3. Seasonal evolution of the Arctic marginal ice zone and its power-law obeying floe size distribution

    Science.gov (United States)

    Zhang, J.; Stern, H. L., III; Schweiger, A. J. B.; Steele, M.; Hwang, P. B.

    2017-12-01

    A thickness, floe size, and enthalpy distribution (TFED) sea ice model, implemented numerically into the Pan-arctic Ice-Ocean Modeling and Assimilation System (PIOMAS), is used to investigate the seasonal evolution of the Arctic marginal ice zone (MIZ) and its floe size distribution. The TFED sea ice model, by coupling the Zhang et al. [2015] sea ice floe size distribution (FSD) theory with the Thorndike et al. [1975] ice thickness distribution (ITD) theory, simulates 12-category FSD and ITD explicitly and jointly. A range of ice thickness and floe size observations were used for model calibration and validation. The model creates FSDs that generally obey a power law or upper truncated power law, as observed by satellites and aerial surveys. In this study, we will examine the role of ice fragmentation and lateral melting in altering FSDs in the Arctic MIZ. We will also investigate how changes in FSD impact the seasonal evolution of the MIZ by modifying the thermodynamic processes.

  4. Sensitivity study of poisson corruption in tomographic measurements for air-water flows

    International Nuclear Information System (INIS)

    Munshi, P.; Vaidya, M.S.

    1993-01-01

    An application of computerized tomography (CT) for measuring void fraction profiles in two-phase air-water flows was reported earlier. Those attempts involved some special radial methods for tomographic reconstruction and the popular convolution backprojection (CBP) method. The CBP method is capable of reconstructing void profiles for nonsymmetric flows also. In this paper, we investigate the effect of corrupted CT data for gamma-ray sources and aCBP algorithm. The corruption in such a case is due to the statistical (Poisson) nature of the source

  5. Sensitivity/uncertainty analysis of a borehole scenario comparing Latin Hypercube Sampling and deterministic sensitivity approaches

    International Nuclear Information System (INIS)

    Harper, W.V.; Gupta, S.K.

    1983-10-01

    A computer code was used to study steady-state flow for a hypothetical borehole scenario. The model consists of three coupled equations with only eight parameters and three dependent variables. This study focused on steady-state flow as the performance measure of interest. Two different approaches to sensitivity/uncertainty analysis were used on this code. One approach, based on Latin Hypercube Sampling (LHS), is a statistical sampling method, whereas, the second approach is based on the deterministic evaluation of sensitivities. The LHS technique is easy to apply and should work well for codes with a moderate number of parameters. Of deterministic techniques, the direct method is preferred when there are many performance measures of interest and a moderate number of parameters. The adjoint method is recommended when there are a limited number of performance measures and an unlimited number of parameters. This unlimited number of parameters capability can be extremely useful for finite element or finite difference codes with a large number of grid blocks. The Office of Nuclear Waste Isolation will use the technique most appropriate for an individual situation. For example, the adjoint method may be used to reduce the scope to a size that can be readily handled by a technique such as LHS. Other techniques for sensitivity/uncertainty analysis, e.g., kriging followed by conditional simulation, will be used also. 15 references, 4 figures, 9 tables

  6. The average-shadowing property and topological ergodicity for flows

    International Nuclear Information System (INIS)

    Gu Rongbao; Guo Wenjing

    2005-01-01

    In this paper, the transitive property for a flow without sensitive dependence on initial conditions is studied and it is shown that a Lyapunov stable flow with the average-shadowing property on a compact metric space is topologically ergodic

  7. Site scale groundwater flow in Olkiluoto - complementary simulations

    International Nuclear Information System (INIS)

    Loefman, J.

    2000-06-01

    This work comprises of the complementary simulations to the previous groundwater flow analysis at the Olkiluoto site. The objective is to study the effects of flow porosity, conceptual model for solute transport, fracture zones, land uplift and initial conditions on the results. The numerical simulations are carried out up to 10000 years into the future employing the same modelling approach and site-specific flow and transport model as in the previous work except for the differences in the case descriptions. The result quantities considered are the salinity and the driving force in the vicinity of the repository. The salinity field and the driving force are sensitive to the flow porosity and the conceptual model for solute transport. Ten-fold flow porosity and the dual-porosity approach retard the transport of solutes in the bedrock resulting in brackish groundwater conditions at the repository at 10000 years A.P. (in the previous work the groundwater in the repository turned into fresh). The higher driving forces can be attributed to the higher concentration gradients resulting from the opposite effects of the land uplift, which pushes fresh water deeper and deeper into the bedrock, and the higher flow porosity and the dual-porosity model, which retard the transport of solutes. The cases computed (unrealistically) without fracture zones and postglacial land uplift show that they both have effect on the results and can not be ignored in the coupled and transient groundwater flow analyses. The salinity field and the driving force are also sensitive to the initial salinity field especially at the beginning during the first 500 years A.P. The sensitivity will, however, diminish as soon as fresh water dilutes brackish and saline water and decreases the concentration gradients. Fresh water conditions result in also a steady state for the driving force in the repository area. (orig.)

  8. Descriptive analysis of the masticatory and salivary functions and gustatory sensitivity in healthy children.

    Science.gov (United States)

    Marquezin, Maria Carolina Salomé; Pedroni-Pereira, Aline; Araujo, Darlle Santos; Rosar, João Vicente; Barbosa, Taís S; Castelo, Paula Midori

    2016-08-01

    The objective of this study is to better understand salivary and masticatory characteristics, this study evaluated the relationship among salivary parameters, bite force (BF), masticatory performance (MP) and gustatory sensitivity in healthy children. The secondary outcome was to evaluate possible gender differences. One hundred and sixteen eutrophic subjects aged 7-11 years old were evaluated, caries-free and with no definite need of orthodontic treatment. Salivary flow rate and pH, total protein (TP), alpha-amylase (AMY), calcium (CA) and phosphate (PHO) concentrations were determined in stimulated (SS) and unstimulated saliva (US). BF and MP were evaluated using digital gnathodynamometer and fractional sieving method, respectively. Gustatory sensitivity was determined by detecting the four primary tastes (sweet, salty, sour and bitter) in three different concentrations. Data were evaluated using descriptive statistics, Mann-Whitney/t-test, Spearman correlation and multiple regression analysis, considering α = 0.05. Significant positive correlation between taste and age was observed. CA and PHO concentrations correlated negatively with salivary flow and pH; sweet taste scores correlated with AMY concentrations and bitter taste sensitivity correlated with US flow rate (p salivary, masticatory characteristics and gustatory sensitivity was observed. The regression analysis showed a weak relationship between the distribution of chewed particles among the different sieves and BF. The concentration of some analytes was influenced by salivary flow and pH. Age, saliva flow and AMY concentrations influenced gustatory sensitivity. In addition, salivary, masticatory and taste characteristics did not differ between genders, and only a weak relation between MP and BF was observed.

  9. A screen-printed flexible flow sensor

    International Nuclear Information System (INIS)

    Moschos, A; Kaltsas, G; Syrovy, T; Syrova, L

    2017-01-01

    A thermal flow sensor was printed on a flexible plastic substrate using exclusively screen-printing techniques. The presented device was implemented with custom made screen-printed thermistors, which allows simple, cost-efficient production on a variety of flexible substrates while maintaining the typical advantages of thermal flow sensors. Evaluation was performed for both static (zero flow) and dynamic conditions using a combination of electrical measurements and IR imaging techniques in order to determine important characteristics, such as temperature response, output repeatability, etc. The flow sensor was characterized utilizing the hot-wire and calorimetric principles of operation, while the preliminary results appear to be very promising, since the sensor was successfully evaluated and displayed adequate sensitivity in a relatively wide flow range. (paper)

  10. Sensitivity and Nonlinearity of Thermoacoustic Oscillations

    Science.gov (United States)

    Juniper, Matthew P.; Sujith, R. I.

    2018-01-01

    Nine decades of rocket engine and gas turbine development have shown that thermoacoustic oscillations are difficult to predict but can usually be eliminated with relatively small ad hoc design changes. These changes can, however, be ruinously expensive to devise. This review explains why linear and nonlinear thermoacoustic behavior is so sensitive to parameters such as operating point, fuel composition, and injector geometry. It shows how nonperiodic behavior arises in experiments and simulations and discusses how fluctuations in thermoacoustic systems with turbulent reacting flow, which are usually filtered or averaged out as noise, can reveal useful information. Finally, it proposes tools to exploit this sensitivity in the future: adjoint-based sensitivity analysis to optimize passive control designs and complex systems theory to warn of impending thermoacoustic oscillations and to identify the most sensitive elements of a thermoacoustic system.

  11. Numerical 3D flow simulation of attached cavitation structures at ultrasonic horn tips and statistical evaluation of flow aggressiveness via load collectives

    Science.gov (United States)

    Mottyll, S.; Skoda, R.

    2015-12-01

    A compressible inviscid flow solver with barotropic cavitation model is applied to two different ultrasonic horn set-ups and compared to hydrophone, shadowgraphy as well as erosion test data. The statistical analysis of single collapse events in wall-adjacent flow regions allows the determination of the flow aggressiveness via load collectives (cumulative event rate vs collapse pressure), which show an exponential decrease in agreement to studies on hydrodynamic cavitation [1]. A post-processing projection of event rate and collapse pressure on a reference grid reduces the grid dependency significantly. In order to evaluate the erosion-sensitive areas a statistical analysis of transient wall loads is utilised. Predicted erosion sensitive areas as well as temporal pressure and vapour volume evolution are in good agreement to the experimental data.

  12. Entropy feature extraction on flow pattern of gas/liquid two-phase flow based on cross-section measurement

    International Nuclear Information System (INIS)

    Han, J; Dong, F; Xu, Y Y

    2009-01-01

    This paper introduces the fundamental of cross-section measurement system based on Electrical Resistance Tomography (ERT). The measured data of four flow regimes of the gas/liquid two-phase flow in horizontal pipe flow are obtained by an ERT system. For the measured data, five entropies are extracted to analyze the experimental data according to the different flow regimes, and the analysis method is examined and compared in three different perspectives. The results indicate that three different perspectives of entropy-based feature extraction are sensitive to the flow pattern transition in gas/liquid two-phase flow. By analyzing the results of three different perspectives with the changes of gas/liquid two-phase flow parameters, the dynamic structures of gas/liquid two-phase flow is obtained, and they also provide an efficient supplementary to reveal the flow pattern transition mechanism of gas/liquid two-phase flow. Comparison of the three different methods of feature extraction shows that the appropriate entropy should be used for the identification and prediction of flow regimes.

  13. Flip-flop method: A new T1-weighted flow-MRI for plants studies.

    Science.gov (United States)

    Buy, Simon; Le Floch, Simon; Tang, Ning; Sidiboulenouar, Rahima; Zanca, Michel; Canadas, Patrick; Nativel, Eric; Cardoso, Maida; Alibert, Eric; Dupont, Guillaume; Ambard, Dominique; Maurel, Christophe; Verdeil, Jean-Luc; Bertin, Nadia; Goze-Bac, Christophe; Coillot, Christophe

    2018-01-01

    The climate warming implies an increase of stress of plants (drought and torrential rainfall). The understanding of plant behavior, in this context, takes a major importance and sap flow measurement in plants remains a key issue for plant understanding. Magnetic Resonance Imaging (MRI) which is well known to be a powerful tool to access water quantity can be used to measure moving water. We describe a novel flow-MRI method which takes advantage of inflow slice sensitivity. The method involves the slice selectivity in the context of multi slice spin echo sequence. Two sequences such as a given slice is consecutively inflow and outflow sensitive are performed, offering the possiblility to perform slow flow sensitive imaging in a quite straigthforward way. The method potential is demonstrated by imaging both a slow flow measurement on a test bench (as low as 10 μm.s-1) and the Poiseuille's profile of xylemian sap flow velocity in the xylematic tissues of a tomato plant stem.

  14. Uncertainty and sensitivity analysis for two-phase flow in the vicinity of the repository in the 1996 performance assessment for the Waste Isolation Pilot Plant: Disturbed conditions

    International Nuclear Information System (INIS)

    HELTON, JON CRAIG; BEAN, J.E.; ECONOMY, K.; GARNER, J.W.; MACKINNON, ROBERT J.; MILLER, JOEL D.; SCHREIBER, J.D.; VAUGHN, PALMER

    2000-01-01

    Uncertainty and sensitivity analysis results obtained in the 1996 performance assessment (PA) for the Waste Isolation Pilot Plant (WIPP) are presented for two-phase flow in the vicinity of the repository under disturbed conditions resulting from drilling intrusions. Techniques based on Latin hypercube sampling, examination of scatterplots, stepwise regression analysis, partial correlation analysis and rank transformations are used to investigate brine inflow, gas generation repository pressure, brine saturation and brine and gas outflow. Of the variables under study, repository pressure and brine flow from the repository to the Culebra Dolomite are potentially the most important in PA for the WIPP. Subsequent to a drilling intrusion repository pressure was dominated by borehole permeability and generally below the level (i.e., 8 MPa) that could potentially produce spallings and direct brine releases. Brine flow from the repository to the Culebra Dolomite tended to be small or nonexistent with its occurrence and size also dominated by borehole permeability

  15. The Dynamics of the Impact of Past Performance on Mutual Fund Flows

    NARCIS (Netherlands)

    Goriaev, A.P.; Nijman, T.E.; Werker, B.J.M.

    2002-01-01

    This study reconsiders the determinants of flows into US growth funds, focusing in particular on the dynamics of the impact of past performance on flows.We model the flow-performance relationship at the monthly frequency, allowing for dependence of the sensitivity of flows to past performance on

  16. Hole spin coherence in a Ge/Si heterostructure nanowire

    DEFF Research Database (Denmark)

    Higginbotham, Andrew P; Larsen, Thorvald Wadum; Yao, Jun

    2014-01-01

    Relaxation and dephasing of hole spins are measured in a gate-defined Ge/Si nanowire double quantum dot using a fast pulsed-gate method and dispersive readout. An inhomogeneous dephasing time T2(*)≈ 0.18 μs exceeds corresponding measurements in III-V semiconductors by more than an order of magnit......Relaxation and dephasing of hole spins are measured in a gate-defined Ge/Si nanowire double quantum dot using a fast pulsed-gate method and dispersive readout. An inhomogeneous dephasing time T2(*)≈ 0.18 μs exceeds corresponding measurements in III-V semiconductors by more than an order...

  17. Battery operated preconcentration-assisted lateral flow assay.

    Science.gov (United States)

    Kim, Cheonjung; Yoo, Yong Kyoung; Han, Sung Il; Lee, Junwoo; Lee, Dohwan; Lee, Kyungjae; Hwang, Kyo Seon; Lee, Kyu Hyoung; Chung, Seok; Lee, Jeong Hoon

    2017-07-11

    Paper-based analytical devices (e.g. lateral flow assays) are highly advantageous as portable diagnostic systems owing to their low costs and ease of use. Because of their low sensitivity and detection limits for biomolecules, these devices have several limitations in applications for real-field diagnosis. Here, we demonstrate a paper-based preconcentration enhanced lateral flow assay using a commercial β-hCG-based test. Utilizing a simple 9 V battery operation with a low power consumption of approximately 81 μW, we acquire a 25-fold preconcentration factor, demonstrating a clear sensitivity enhancement in the colorimetric lateral flow assay; consequently, clear colors are observed in a rapid kit test line, which cannot be monitored without preconcentration. This device can also facilitate a semi-quantitative platform using the saturation value and/or color intensity in both paper-based colorimetric assays and smartphone-based diagnostics.

  18. Effects of Turbulent Reynolds Number on the Displacement Speed Statistics in the Thin Reaction Zones Regime of Turbulent Premixed Combustion

    Directory of Open Access Journals (Sweden)

    Nilanjan Chakraborty

    2011-01-01

    nature of the correlations remains unaffected. The dependence of displacement speed on strain rate and curvature is found to weaken with increasing turbulent Reynolds number when either Damköhler or Karlovitz number is held constant, but the qualitative nature of the correlation remains unaltered. The implications of turbulent Reynolds number effects in the context of Flame Surface Density (FSD modelling have also been addressed, with emphasis on the influence of displacement speed on the curvature and propagation terms in the FSD balance equation.

  19. A new method of measuring the thermal flow

    Directory of Open Access Journals (Sweden)

    Grexová Slávka

    2001-03-01

    Full Text Available The subject of this article is the measurement of thermal flow under laboratory conditions. We can define thermal flow as the amount of heat transmitted through the surface of rock over a certain period of time.According to the Atlas of Geothermal Energy the thermal flow ranges from 40 to 120 mW/m2; it is not possible to measure directly on the surface of the rock. The conventional method of measurement is the use of “separation bar” thermic conduction measurement system or to measure the temperature of the rock in two different places at selected underground depth intervals.The method of measurement suggested by us combines these two techniques. The measurement is based on a sample of processed store from the Slovak Academy of Science. This sample represents the rock massiv:The complex model includes:- a heating system to imitate the thermal flow,- an isolation box to maintain stable conditions,- temperature stabilizing components (thermostat, bulbs, electric conductors,- a heat accumulator including a temperature sensor.A special computer program to measure the thermal flow was created using the Borland Delphi 3.0 programming language. The role of the program is to process extensive data quickly. The results of the measured temperatures and modelled thermal flow are displayed graphically in this article. As seen from the graph, the course of measurement thermal flow is linear. In our geographical location this value is cca 120 m W.m-2. This value proves, that at the projection physical model we are approximating to the reality in areas of sensitive elements. Another fact is that Joule heat which rose into a heater system of transformer straps under muster would thermal flow 2,25 W.m-2. From the present results that by follow the sensitivity measurement scanners it is needed to measure a minimum threefold during a longer time or to improve the sensitivity measurement chains.These measurements and analyses are not sufficient to make a final

  20. Which Food Security Determinants Predict Adequate Vegetable Consumption among Rural Western Australian Children?

    Science.gov (United States)

    Godrich, Stephanie L; Lo, Johnny; Davies, Christina R; Darby, Jill; Devine, Amanda

    2017-01-03

    Improving the suboptimal vegetable consumption among the majority of Australian children is imperative in reducing chronic disease risk. The objective of this research was to determine whether there was a relationship between food security determinants (FSD) (i.e., food availability, access, and utilisation dimensions) and adequate vegetable consumption among children living in regional and remote Western Australia (WA). Caregiver-child dyads ( n = 256) living in non-metropolitan/rural WA completed cross-sectional surveys that included questions on FSD, demographics and usual vegetable intake. A total of 187 dyads were included in analyses, which included descriptive and logistic regression analyses via IBM SPSS (version 23). A total of 13.4% of children in this sample had adequate vegetable intake. FSD that met inclusion criteria ( p ≤ 0.20) for multivariable regression analyses included price; promotion; quality; location of food outlets; variety of vegetable types; financial resources; and transport to outlets. After adjustment for potential demographic confounders, the FSD that predicted adequate vegetable consumption were, variety of vegetable types consumed ( p = 0.007), promotion ( p = 0.017), location of food outlets ( p = 0.027), and price ( p = 0.043). Food retail outlets should ensure that adequate varieties of vegetable types (i.e., fresh, frozen, tinned) are available, vegetable messages should be promoted through food retail outlets and in community settings, towns should include a range of vegetable purchasing options, increase their reliance on a local food supply and increase transport options to enable affordable vegetable purchasing.

  1. Which Food Security Determinants Predict Adequate Vegetable Consumption among Rural Western Australian Children?

    Directory of Open Access Journals (Sweden)

    Stephanie L. Godrich

    2017-01-01

    Full Text Available Improving the suboptimal vegetable consumption among the majority of Australian children is imperative in reducing chronic disease risk. The objective of this research was to determine whether there was a relationship between food security determinants (FSD (i.e., food availability, access, and utilisation dimensions and adequate vegetable consumption among children living in regional and remote Western Australia (WA. Caregiver-child dyads (n = 256 living in non-metropolitan/rural WA completed cross-sectional surveys that included questions on FSD, demographics and usual vegetable intake. A total of 187 dyads were included in analyses, which included descriptive and logistic regression analyses via IBM SPSS (version 23. A total of 13.4% of children in this sample had adequate vegetable intake. FSD that met inclusion criteria (p ≤ 0.20 for multivariable regression analyses included price; promotion; quality; location of food outlets; variety of vegetable types; financial resources; and transport to outlets. After adjustment for potential demographic confounders, the FSD that predicted adequate vegetable consumption were, variety of vegetable types consumed (p = 0.007, promotion (p = 0.017, location of food outlets (p = 0.027, and price (p = 0.043. Food retail outlets should ensure that adequate varieties of vegetable types (i.e., fresh, frozen, tinned are available, vegetable messages should be promoted through food retail outlets and in community settings, towns should include a range of vegetable purchasing options, increase their reliance on a local food supply and increase transport options to enable affordable vegetable purchasing.

  2. Highly sensitive determination of diclofenac based on resin beads and a novel polyclonal antibody by using flow injection chemiluminescence competitive immunoassay

    Science.gov (United States)

    Shi, Jing; Xu, Mingxia; Tang, Qinghui; Zhao, Kang; Deng, Anping; Li, Jianguo

    2018-02-01

    A novel flow injection chemiluminescence immunoassay for simple, sensitive and low-cost detection of diclofenac was established based on specific binding of antigen and antibody. Carboxylic resin beads used as solid phase carrier materials provided good biocompatibility and large surface-to-volume ratio for modifying more coating antigen. There was a competitive process between the diclofenac in solution and the immobilized coating antigen to react with the limited binding sites of the polyclonal antibody to form the immunocomplex. The second antibody labelled with horseradish peroxidase was introduced into the immunosensor and trapped by captured polyclonal antibody against diclofenac, which could effectively amplify chemiluminescence signals of luminol-PIP-H2O2. Under optimal conditions, the diclofenac could be detected quantitatively. The chemiluminescence intensity decreased linearly with the logarithm of the diclofenac concentration in the range of 0.1-100 ng mL- 1 with a detection limit of 0.05 ng mL- 1 at a signal-to-noise ratio of 3. The immunosensor exhibited high sensitivity, specificity and acceptable stability. This easy-operated and cost-effective analytical method could be valuable for the diclofenac determination in real water samples.

  3. Hair flow sensors: from bio-inspiration to bio-mimicking—a review

    International Nuclear Information System (INIS)

    Tao, Junliang; Yu, Xiong

    2012-01-01

    A great many living beings, such as aquatics and arthropods, are equipped with highly sensitive flow sensors to help them survive in challenging environments. These sensors are excellent sources of inspiration for developing application-driven artificial flow sensors with high sensitivity and performance. This paper reviews the bio-inspirations on flow sensing in nature and the bio-mimicking efforts to emulate such sensing mechanisms in recent years. The natural flow sensing systems in aquatics and arthropods are reviewed to highlight inspirations at multiple levels such as morphology, sensing mechanism and information processing. Biomimetic hair flow sensors based on different sensing mechanisms and fabrication technologies are also reviewed to capture the recent accomplishments and to point out areas where further progress is necessary. Biomimetic flow sensors are still in their early stages. Further efforts are required to unveil the sensing mechanisms in the natural biological systems and to achieve multi-level bio-mimicking of the natural system to develop their artificial counterparts. (topical review)

  4. Fish and invertebrate flow-biology relationships to support the determination of ecological flows for North Carolina

    Science.gov (United States)

    Phelan, Jennifer; Cuffney, Thomas F.; Patterson, Lauren A.; Eddy, Michele; Dykes, Robert; Pearsall, Sam; Goudreau, Chris; Mead, Jim; Tarver, Fred

    2017-01-01

    A method was developed to characterize fish and invertebrate responses to flow alteration in the state of North Carolina. This method involved using 80th percentile linear quantile regressions to relate six flow metrics to the diversity of riffle-run fish and benthic Ephemeroptera, Plecoptera, and Trichoptera (EPT) richness. All twelve flow-biology relationships were found to be significant, with both benthos and fish showing negative responses to ecodeficits and reductions in flow. The responses of benthic richness to reduced flows were consistent and generally greater than that of fish diversity. However, the riffle-run fish guild showed the greatest reductions in diversity in response to summer ecodeficits. The directional consistency and differential seasonal sensitivities of fish and invertebrates to reductions in flow highlight the need to consider seasonality when managing flows. In addition, all relationships were linear, and therefore do not provide clear thresholds to support ecological flow determinations and flow prescriptions to prevent the degradation of fish and invertebrate communities in North Carolina rivers and streams. A method of setting ecological flows based on the magnitude of change in biological condition that is acceptable to society is explored.

  5. Model Driven Development of Data Sensitive Systems

    DEFF Research Database (Denmark)

    Olsen, Petur

    2014-01-01

    storage systems, where the actual values of the data is not relevant for the behavior of the system. For many systems the values are important. For instance the control flow of the system can be dependent on the input values. We call this type of system data sensitive, as the execution is sensitive...... to the values of variables. This theses strives to improve model-driven development of such data-sensitive systems. This is done by addressing three research questions. In the first we combine state-based modeling and abstract interpretation, in order to ease modeling of data-sensitive systems, while allowing...... efficient model-checking and model-based testing. In the second we develop automatic abstraction learning used together with model learning, in order to allow fully automatic learning of data-sensitive systems to allow learning of larger systems. In the third we develop an approach for modeling and model-based...

  6. DRAMAtic transforms in magic angle spinning recoupling NMR: The Bessel function pathway.

    Science.gov (United States)

    Goodman, Russell; Hancock, Jason; Siemens, Mark; Jarrell, Harold; Siminovitch, David

    2005-07-01

    In magic angle spinning (MAS) NMR recoupling experiments, the extraction of multiple couplings or a coupling distribution from the observed dephasing signals remains a challenging problem. At least for REDOR experiments, the REDOR transform solves this problem, enabling the simultaneous measurement of multiple dipolar couplings. Focusing on the quadrupolar dephasing observed in QUADRAMA experiments as a representative example, we demonstrate that the same analytical form used for the mathematical description of REDOR dephasing also describes the dephasing observed in a wide variety of MAS NMR recoupling experiments. This fact immediately extends REDOR transform techniques to a much broader suite of recoupling experiments than had previously been realized, including those of DRAMA, MELODRAMA and QUADRAMA. As an illustration, we use the DRAMAtic transform to provide the first inversion of a QUADRAMA dephasing signal to extract the quadrupole coupling distribution. Using a complete elliptic integral of the first kind, we further develop a novel expression for the Pake-spun powder patterns of the corresponding recoupled lineshapes. Our methods and results reinforce the central role that Bessel functions can play in simplifying the integrals that define both the dephasing signals in the time domain, and their Fourier transforms in the frequency domain.

  7. Continuous flow nitration in miniaturized devices

    Directory of Open Access Journals (Sweden)

    Amol A. Kulkarni

    2014-02-01

    Full Text Available This review highlights the state of the art in the field of continuous flow nitration with miniaturized devices. Although nitration has been one of the oldest and most important unit reactions, the advent of miniaturized devices has paved the way for new opportunities to reconsider the conventional approach for exothermic and selectivity sensitive nitration reactions. Four different approaches to flow nitration with microreactors are presented herein and discussed in view of their advantages, limitations and applicability of the information towards scale-up. Selected recent patents that disclose scale-up methodologies for continuous flow nitration are also briefly reviewed.

  8. Cricket inspired flow-sensor arrays

    NARCIS (Netherlands)

    Krijnen, Gijsbertus J.M.; Lammerink, Theodorus S.J.; Wiegerink, Remco J.; Casas, J.

    2007-01-01

    We report current developments in biomimetic flow-sensors based on mechanoreceptive sensory hairs of crickets. These filiform hairs are highly perceptive to lowfrequency sound with energy sensitivities close to thermal threshold. In this work we describe hair-sensors fabricated by a combination of

  9. Gene flow analysis method, the D-statistic, is robust in a wide parameter space.

    Science.gov (United States)

    Zheng, Yichen; Janke, Axel

    2018-01-08

    We evaluated the sensitivity of the D-statistic, a parsimony-like method widely used to detect gene flow between closely related species. This method has been applied to a variety of taxa with a wide range of divergence times. However, its parameter space and thus its applicability to a wide taxonomic range has not been systematically studied. Divergence time, population size, time of gene flow, distance of outgroup and number of loci were examined in a sensitivity analysis. The sensitivity study shows that the primary determinant of the D-statistic is the relative population size, i.e. the population size scaled by the number of generations since divergence. This is consistent with the fact that the main confounding factor in gene flow detection is incomplete lineage sorting by diluting the signal. The sensitivity of the D-statistic is also affected by the direction of gene flow, size and number of loci. In addition, we examined the ability of the f-statistics, [Formula: see text] and [Formula: see text], to estimate the fraction of a genome affected by gene flow; while these statistics are difficult to implement to practical questions in biology due to lack of knowledge of when the gene flow happened, they can be used to compare datasets with identical or similar demographic background. The D-statistic, as a method to detect gene flow, is robust against a wide range of genetic distances (divergence times) but it is sensitive to population size. The D-statistic should only be applied with critical reservation to taxa where population sizes are large relative to branch lengths in generations.

  10. Analysis of mixed traffic flow with human-driving and autonomous cars based on car-following model

    Science.gov (United States)

    Zhu, Wen-Xing; Zhang, H. M.

    2018-04-01

    We investigated the mixed traffic flow with human-driving and autonomous cars. A new mathematical model with adjustable sensitivity and smooth factor was proposed to describe the autonomous car's moving behavior in which smooth factor is used to balance the front and back headway in a flow. A lemma and a theorem were proved to support the stability criteria in traffic flow. A series of simulations were carried out to analyze the mixed traffic flow. The fundamental diagrams were obtained from the numerical simulation results. The varying sensitivity and smooth factor of autonomous cars affect traffic flux, which exhibits opposite varying tendency with increasing parameters before and after the critical density. Moreover, the sensitivity of sensors and smooth factors play an important role in stabilizing the mixed traffic flow and suppressing the traffic jam.

  11. The iFlow modelling framework v2.4: a modular idealized process-based model for flow and transport in estuaries

    Science.gov (United States)

    Dijkstra, Yoeri M.; Brouwer, Ronald L.; Schuttelaars, Henk M.; Schramkowski, George P.

    2017-07-01

    The iFlow modelling framework is a width-averaged model for the systematic analysis of the water motion and sediment transport processes in estuaries and tidal rivers. The distinctive solution method, a mathematical perturbation method, used in the model allows for identification of the effect of individual physical processes on the water motion and sediment transport and study of the sensitivity of these processes to model parameters. This distinction between processes provides a unique tool for interpreting and explaining hydrodynamic interactions and sediment trapping. iFlow also includes a large number of options to configure the model geometry and multiple choices of turbulence and salinity models. Additionally, the model contains auxiliary components, including one that facilitates easy and fast sensitivity studies. iFlow has a modular structure, which makes it easy to include, exclude or change individual model components, called modules. Depending on the required functionality for the application at hand, modules can be selected to construct anything from very simple quasi-linear models to rather complex models involving multiple non-linear interactions. This way, the model complexity can be adjusted to the application. Once the modules containing the required functionality are selected, the underlying model structure automatically ensures modules are called in the correct order. The model inserts iteration loops over groups of modules that are mutually dependent. iFlow also ensures a smooth coupling of modules using analytical and numerical solution methods. This way the model combines the speed and accuracy of analytical solutions with the versatility of numerical solution methods. In this paper we present the modular structure, solution method and two examples of the use of iFlow. In the examples we present two case studies, of the Yangtze and Scheldt rivers, demonstrating how iFlow facilitates the analysis of model results, the understanding of the

  12. Benchmarking NNWSI flow and transport codes: COVE 1 results

    International Nuclear Information System (INIS)

    Hayden, N.K.

    1985-06-01

    The code verification (COVE) activity of the Nevada Nuclear Waste Storage Investigations (NNWSI) Project is the first step in certification of flow and transport codes used for NNWSI performance assessments of a geologic repository for disposing of high-level radioactive wastes. The goals of the COVE activity are (1) to demonstrate and compare the numerical accuracy and sensitivity of certain codes, (2) to identify and resolve problems in running typical NNWSI performance assessment calculations, and (3) to evaluate computer requirements for running the codes. This report describes the work done for COVE 1, the first step in benchmarking some of the codes. Isothermal calculations for the COVE 1 benchmarking have been completed using the hydrologic flow codes SAGUARO, TRUST, and GWVIP; the radionuclide transport codes FEMTRAN and TRUMP; and the coupled flow and transport code TRACR3D. This report presents the results of three cases of the benchmarking problem solved for COVE 1, a comparison of the results, questions raised regarding sensitivities to modeling techniques, and conclusions drawn regarding the status and numerical sensitivities of the codes. 30 refs

  13. Parametric amplification in a micro Coriolis mass flow sensor

    NARCIS (Netherlands)

    Groenesteijn, Jarno; Droogendijk, H.; Wiegerink, Remco J.; Lammerink, Theodorus S.J.; Lötters, Joost Conrad; Sanders, Remco G.P.; Krijnen, Gijsbertus J.M.

    2014-01-01

    We report on the application of parametric amplification to a micro Coriolis mass flow sensor. We demonstrate that this mechanism allows for reduction of the system's power dissipation while retaining sensitivity to flow. By reducing this power dissipation, less heat will be transferred to the fluid

  14. Effects of non-uniform core flow on peak cladding temperature: MOXY/SCORE sensitivity calculations

    Energy Technology Data Exchange (ETDEWEB)

    Chang, S.C.

    1979-08-15

    The MOXY/SCORE computer program is used to evaluate the potential effect on peak cladding temperature of selective cooling that may result from a nonuniform mass flux at the core boundaries during the blowdown phase of the LOFT L2-4 test. The results of this study indicate that the effect of the flow nonuniformity at the core boundaries will be neutralized by a strong radial flow redistribution in the neighborhood of core boundaries. The implication is that the flow nonuniformity at the core boundaries has no significant effect on the thermal-hydraulic behavior and cladding temperature at the hot plane.

  15. Effects of non-uniform core flow on peak cladding temperature: MOXY/SCORE sensitivity calculations

    International Nuclear Information System (INIS)

    Chang, S.C.

    1979-01-01

    The MOXY/SCORE computer program is used to evaluate the potential effect on peak cladding temperature of selective cooling that may result from a nonuniform mass flux at the core boundaries during the blowdown phase of the LOFT L2-4 test. The results of this study indicate that the effect of the flow nonuniformity at the core boundaries will be neutralized by a strong radial flow redistribution in the neighborhood of core boundaries. The implication is that the flow nonuniformity at the core boundaries has no significant effect on the thermal-hydraulic behavior and cladding temperature at the hot plane

  16. Investment sensitivity and managerial decision making behaviour of Indian firms

    Directory of Open Access Journals (Sweden)

    Pankaj Kumar Gupta

    2013-01-01

    Full Text Available Contemporary models of the financial theory support the proposition that the stock prices should be fundamentally a reflection of the discounted value of earnings. Accordingly the investors and analysts should base their expectations on the expected future cash flows that are logically correlated or have a carry over effect vis-ŕ-vis present stream of cash flows. This logically implies that the managers would have an incentive to manipulate investor’s expectation of future cash flows. The zeal to maximize the firm’s value based on market capitalization is expected to have a detrimental effect on the investment decisions leading to sub optimality. Given the imperfect information structure and market pressures, the Indian firms suffer from mispricing and as such the conventional robust theoretical models of agency conflicts cannot be refuted. This motivates us to examine the interrelation ship between the concerns for valuation and investment sensitivity. We use a sample statistics of selected listed firms that represent the CNX Nifty Index and test for the dependence of the investment behavior of the firm, on the sensitivity of the firms’ share prices to its current cash flow represented by surprise earings. We use the earnings response coefficient (ERC framework proposed by Ball and Brown (1968 for 11 key industries in India. We find that the surpise in accounting earnings announcements is negatively associated with abnormal stock returns and the investment decisions taken by the firms are negatively sensitive to changes in investment opportunities.

  17. Information transmission and signal permutation in active flow networks

    Science.gov (United States)

    Woodhouse, Francis G.; Fawcett, Joanna B.; Dunkel, Jörn

    2018-03-01

    Recent experiments show that both natural and artificial microswimmers in narrow channel-like geometries will self-organise to form steady, directed flows. This suggests that networks of flowing active matter could function as novel autonomous microfluidic devices. However, little is known about how information propagates through these far-from-equilibrium systems. Through a mathematical analogy with spin-ice vertex models, we investigate here the input–output characteristics of generic incompressible active flow networks (AFNs). Our analysis shows that information transport through an AFN is inherently different from conventional pressure or voltage driven networks. Active flows on hexagonal arrays preserve input information over longer distances than their passive counterparts and are highly sensitive to bulk topological defects, whose presence can be inferred from marginal input–output distributions alone. This sensitivity further allows controlled permutations on parallel inputs, revealing an unexpected link between active matter and group theory that can guide new microfluidic mixing strategies facilitated by active matter and aid the design of generic autonomous information transport networks.

  18. The p300 event-related potential technique for libido assessment in women with hypoactive sexual desire disorder.

    Science.gov (United States)

    Vardi, Yoram; Sprecher, Elliot; Gruenwald, Ilan; Yarnitsky, David; Gartman, Irena; Granovsky, Yelena

    2009-06-01

    There is a need for an objective technique to assess the degree of hypoactive sexual desire disorder (HSDD). Recently, we described such a methodology (event-related potential technique [ERP]) based on recording of p300 electroencephalography (EEG) waves elicited by auditory stimuli during synchronous exposure to erotic films. To compare sexual interest of sexually healthy women to females with sexual dysfunction (FSD) using ERP, and to explore whether FSD women with and without HSDD would respond differently to two different types of erotic stimuli-films containing (I) or not containing (NI) sexual intercourse scenes. Twenty-two women with FSD, of which nine had HSDD only, and 30 sexually healthy women were assessed by the Female Sexual Functioning Index. ERP methodology was performed applying erotic NI or I films. Significant differences in percent of auditory p300 amplitude reduction (PR) in response to erotic stimuli within and between all three groups for each film type. PRs to each film type were similar in sexually healthy women (60.6% +/- 40.3 (NI) and 51.7% +/- 32.3 [I]), while in women with FSD, reduction was greater when viewing the NI vs. I erotic films (71.4% +/- 41.0 vs. 37.7% +/- 45.7; P = 0.0099). This difference was mainly due to the greater PR of the subgroup with HSDD in response to NI vs. I films (77.7% +/- 46.7 vs. 17.0% +/- 50.3) than in the FSD women without HSDD group or the sexually healthy women (67.5% +/- 38.7 vs. 50.4% +/- 39.4 respectively), P = 0.0084. For comparisons, we used the mixed-model one-way analysis of variance. Differences in neurophysiological response patterns between sexually healthy vs. sexually dysfunctional females may point to a specific inverse discrimination ability for sexually relevant information in the subgroup of women with HSDD. These findings suggest that the p300 ERP technique could be used as an objective quantitative tool for libido assessment in sexually dysfunctional women.

  19. Sensitive analysis of low-flow parameters using the hourly hydrological model for two mountainous basins in Japan

    Science.gov (United States)

    Fujimura, Kazumasa; Iseri, Yoshihiko; Kanae, Shinjiro; Murakami, Masahiro

    2014-05-01

    Accurate estimation of low flow can contribute to better water resources management and also lead to more reliable evaluation of climate change impacts on water resources. In the early study, the nonlinearity of low flow related to the storage in the basin was suggested by Horton (1937) as the exponential function of Q=KSN, where Q is the discharge, S is the storage, K is a constant and N is the exponent value. In the recent study by Ding (2011) showed the general storage-discharge equation of Q = KNSN. Since the constant K is defined as the fractional recession constant and symbolized as Au by Ando et al. (1983), in this study, we rewrite this equation as Qg=AuNSgN, where Qg is the groundwater runoff and Sg is the groundwater storage. Although this equation was applied to a short-term runoff event of less than 14 hours using the unit hydrograph method by Ding, it was not yet applied for a long-term runoff event including low flow more than 10 years. This study performed a sensitive analysis of two parameters of the constant Au and exponent value N by using the hourly hydrological model for two mountainous basins in Japan. The hourly hydrological model used in this study was presented by Fujimura et al. (2012), which comprise the Diskin-Nazimov infiltration model, groundwater recharge and groundwater runoff calculations, and a direct runoff component. The study basins are the Sameura Dam basin (SAME basin) (472 km2) located in the western Japan which has variability of rainfall, and the Shirakawa Dam basin (SIRA basin) (205km2) located in a region of heavy snowfall in the eastern Japan, that are different conditions of climate and geology. The period of available hourly data for the SAME basin is 20 years from 1 January 1991 to 31 December 2010, and for the SIRA basin is 10 years from 1 October 2003 to 30 September 2013. In the sensitive analysis, we prepared 19900 sets of the two parameters of Au and N, the Au value ranges from 0.0001 to 0.0100 in steps of 0

  20. A critical comparison of constant and pulsed flow systems exploiting gas diffusion.

    Science.gov (United States)

    Silva, Claudineia Rodrigues; Henriquez, Camelia; Frizzarin, Rejane Mara; Zagatto, Elias Ayres Guidetti; Cerda, Victor

    2016-02-01

    Considering the beneficial aspects arising from the implementation of pulsed flows in flow analysis, and the relevance of in-line gas diffusion as an analyte separation/concentration step, influence of flow pattern in flow systems with in-line gas diffusion was critically investigated. To this end, constant or pulsed flows delivered by syringe or solenoid pumps were exploited. For each flow pattern, two variants involving different interaction times of the donor with the acceptor streams were studied. In the first one, both the acceptor and donor streams were continuously flowing, whereas in the second one, the acceptor was stopped during the gas diffusion step. Four different volatile species (ammonia, ethanol, carbon dioxide and hydrogen sulfide) were selected as models. For the flow patterns and variants studied, the efficiencies of mass transport in the gas diffusion process were compared, and sensitivity, repeatability, sampling frequency and recorded peak shape were evaluated. Analysis of the results revealed that sensitivity is strongly dependent on the implemented variant, and that flow pattern is an important feature in flow systems with in-line gas diffusion. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Analysis of the cavitating flow induced by an ultrasonic horn – Numerical 3D simulation for the analysis of vapour structures and the assessment of erosion-sensitive areas

    Directory of Open Access Journals (Sweden)

    Mottyll Stephan

    2014-03-01

    Full Text Available This paper reports the outcome of a numerical study of ultrasonic cavitation using a CFD flow algorithm based on a compressible density-based finite volume method with a low-Machnumber consistent flux function and an explicit time integration [15; 18] in combination with an erosion-detecting flow analysis procedure. The model is validated against erosion data of an ultrasonic horn for different gap widths between the horn tip and a counter sample which has been intensively investigated in previous material studies at the Ruhr University Bochum [23] as well as on first optical in-house flow measurement data which is presented in a companion paper [13]. Flow features such as subharmonic cavitation oscillation frequencies as well as constricted vapour cloud structures can also be observed by the vapour regions predicted in our simulation as well as by the detected collapse event field (collapse detector [12]. With a statistical analysis of transient wall loads we can determine the erosion sensitive areas qualitatively. Our simulation method can reproduce the influence of the gap width on vapour structure and on location of cavitation erosion.

  2. Forced-flow chromatography of rare earths using sensitive spectrophometry

    International Nuclear Information System (INIS)

    Matsui, Masakazu; Aoki, Toru; Kumagai, Tetsu.

    1981-01-01

    The sensitive spectrophotometric method for the rare earth elements with xylenol orange in the presence of cetylpyridinium bromide was applied to the continuous detection system of liquid chromatography. Fourteen rare earth elements were completely separated within 130 min cation-exchange chromatography using 2-hydroxy-iso-butylic acid. The eluted ions were determined with absorption maxima of their complexes at around 610 nm. A linear relationship between the peak height and the amounts of rare earth elements was also obtained over the range 0.04 to 0.5 MU g. (author)

  3. Uncertainty and Sensitivity Analysis of Afterbody Radiative Heating Predictions for Earth Entry

    Science.gov (United States)

    West, Thomas K., IV; Johnston, Christopher O.; Hosder, Serhat

    2016-01-01

    The objective of this work was to perform sensitivity analysis and uncertainty quantification for afterbody radiative heating predictions of Stardust capsule during Earth entry at peak afterbody radiation conditions. The radiation environment in the afterbody region poses significant challenges for accurate uncertainty quantification and sensitivity analysis due to the complexity of the flow physics, computational cost, and large number of un-certain variables. In this study, first a sparse collocation non-intrusive polynomial chaos approach along with global non-linear sensitivity analysis was used to identify the most significant uncertain variables and reduce the dimensions of the stochastic problem. Then, a total order stochastic expansion was constructed over only the important parameters for an efficient and accurate estimate of the uncertainty in radiation. Based on previous work, 388 uncertain parameters were considered in the radiation model, which came from the thermodynamics, flow field chemistry, and radiation modeling. The sensitivity analysis showed that only four of these variables contributed significantly to afterbody radiation uncertainty, accounting for almost 95% of the uncertainty. These included the electronic- impact excitation rate for N between level 2 and level 5 and rates of three chemical reactions in uencing N, N(+), O, and O(+) number densities in the flow field.

  4. Decoherence of coupled Josephson charge qubits due to partially correlated low-frequency noise

    International Nuclear Information System (INIS)

    Hu, Yong; Zhou, Zheng-Wei; Cai, Jian-Ming; Guo, Guang-Can

    2007-01-01

    Josephson charge qubits are promising candidates for scalable quantum computing. However, their performances are strongly degraded by decoherence due to low-frequency background noise, typically with a 1/f spectrum. In this paper, we investigate the decoherence process of two Cooper pair boxes (CPBs) coupled via a capacitor. Going beyond the common and uncorrelated noise models and the Bloch-Redfield formalism of previous works, we study the coupled system's quadratic dephasing under the condition of partially correlated noise sources. Based on reported experiments and generally accepted noise mechanisms, we introduce a reasonable assumption for the noise correlation, with which the calculation of multiqubit decoherence can be simplified to a problem on the single-qubit level. For the conventional Gaussian 1/f noise case, our results demonstrate that the quadratic dephasing rates are not very sensitive to the spatial correlation of the noises. Furthermore, we discuss the feasibility and efficiency of dynamical decoupling in the coupled CPBs

  5. Nominal Range Sensitivity Analysis of peak radionuclide concentrations in randomly heterogeneous aquifers

    International Nuclear Information System (INIS)

    Cadini, F.; De Sanctis, J.; Cherubini, A.; Zio, E.; Riva, M.; Guadagnini, A.

    2012-01-01

    Highlights: ► Uncertainty quantification problem associated with the radionuclide migration. ► Groundwater transport processes simulated within a randomly heterogeneous aquifer. ► Development of an automatic sensitivity analysis for flow and transport parameters. ► Proposal of a Nominal Range Sensitivity Analysis approach. ► Analysis applied to the performance assessment of a nuclear waste repository. - Abstract: We consider the problem of quantification of uncertainty associated with radionuclide transport processes within a randomly heterogeneous aquifer system in the context of performance assessment of a near-surface radioactive waste repository. Radionuclide migration is simulated at the repository scale through a Monte Carlo scheme. The saturated groundwater flow and transport equations are then solved at the aquifer scale for the assessment of the expected radionuclide peak concentration at a location of interest. A procedure is presented to perform the sensitivity analysis of this target environmental variable to key parameters that characterize flow and transport processes in the subsurface. The proposed procedure is exemplified through an application to a realistic case study.

  6. Development of EMab-51, a Sensitive and Specific Anti-Epidermal Growth Factor Receptor Monoclonal Antibody in Flow Cytometry, Western Blot, and Immunohistochemistry.

    Science.gov (United States)

    Itai, Shunsuke; Kaneko, Mika K; Fujii, Yuki; Yamada, Shinji; Nakamura, Takuro; Yanaka, Miyuki; Saidoh, Noriko; Handa, Saori; Chang, Yao-Wen; Suzuki, Hiroyoshi; Harada, Hiroyuki; Kato, Yukinari

    2017-10-01

    The epidermal growth factor receptor (EGFR) is a member of the human epidermal growth factor receptor (HER) family of receptor tyrosine kinases and is involved in cell growth and differentiation. EGFR homodimers or heterodimers with other HER members, such as HER2 and HER3, activate downstream signaling cascades in many cancers. In this study, we developed novel anti-EGFR monoclonal antibodies (mAbs) and characterized their efficacy in flow cytometry, Western blot, and immunohistochemical analyses. First, we expressed the full-length or ectodomain of EGFR in LN229 glioblastoma cells and then immunized mice with LN229/EGFR or ectodomain of EGFR, and performed the first screening using enzyme-linked immunosorbent assays. Subsequently, we selected mAbs according to their efficacy in flow cytometry (second screening), Western blot (third screening), and immunohistochemical (fourth screening) analyses. Among 100 mAbs, only one clone EMab-51 (IgG 1 , kappa) reacted with EGFR in Western blot analysis. Finally, immunohistochemical analyses with EMab-51 showed sensitive and specific reactions against oral cancer cells, warranting the use of EMab-51 to detect EGFR in pathological analyses of EGFR-expressing cancers.

  7. The iFlow modelling framework v2.4: a modular idealized process-based model for flow and transport in estuaries

    Directory of Open Access Journals (Sweden)

    Y. M. Dijkstra

    2017-07-01

    Full Text Available The iFlow modelling framework is a width-averaged model for the systematic analysis of the water motion and sediment transport processes in estuaries and tidal rivers. The distinctive solution method, a mathematical perturbation method, used in the model allows for identification of the effect of individual physical processes on the water motion and sediment transport and study of the sensitivity of these processes to model parameters. This distinction between processes provides a unique tool for interpreting and explaining hydrodynamic interactions and sediment trapping. iFlow also includes a large number of options to configure the model geometry and multiple choices of turbulence and salinity models. Additionally, the model contains auxiliary components, including one that facilitates easy and fast sensitivity studies. iFlow has a modular structure, which makes it easy to include, exclude or change individual model components, called modules. Depending on the required functionality for the application at hand, modules can be selected to construct anything from very simple quasi-linear models to rather complex models involving multiple non-linear interactions. This way, the model complexity can be adjusted to the application. Once the modules containing the required functionality are selected, the underlying model structure automatically ensures modules are called in the correct order. The model inserts iteration loops over groups of modules that are mutually dependent. iFlow also ensures a smooth coupling of modules using analytical and numerical solution methods. This way the model combines the speed and accuracy of analytical solutions with the versatility of numerical solution methods. In this paper we present the modular structure, solution method and two examples of the use of iFlow. In the examples we present two case studies, of the Yangtze and Scheldt rivers, demonstrating how iFlow facilitates the analysis of model results, the

  8. Laminar flow resistance in short microtubes

    Energy Technology Data Exchange (ETDEWEB)

    Phares, D.J. [Texas A and M University, College Station, TX (United States). Dept. of Mechanical Engineering; Smedley, G.T.; Zhou, J. [Glaukos Corp., Laguna Hills, CA (United States). Dept. of Research and Development

    2005-06-01

    We have measured the pressure drop for the flow of liquid through a series of short microtubes ranging from 80 to 150 {mu}m in diameter with aspect ratios between L/D = 2 and L/D = 5. These dimensions were selected to resemble lumens of implantable microstents that are under consideration for the treatment of glaucoma. For physiologically relevant pressure drops and flow rates, we have determined that a fully-developed laminar pipe flow may be assumed throughout the microtube when (L/D) > 0.20Re, where Re is the Reynolds number based on the diameter, D, and L is the length of the tube. We have examined flow rates between 0.1 and 10 {mu}L/s, corresponding to Reynolds numbers between 1 and 150. For smooth microtubes, no difference from macroscopic flow is observed for the tube sizes considered. However, flow resistance is found to be sensitive to the relative surface roughness of the tube walls. (author)

  9. Prevalence and degree of sexual dysfunction in a sample of women seeking bariatric surgery.

    Science.gov (United States)

    Bond, Dale S; Vithiananthan, Siva; Leahey, Tricia M; Thomas, J Graham; Sax, Harry C; Pohl, Dieter; Ryder, Beth A; Roye, G Dean; Giovanni, Jeannine; Wing, Rena R

    2009-01-01

    Sexual functioning has been shown to be impaired in women who are obese, particularly those seeking bariatric surgery. However, most previous studies evaluating sexual function in these populations have not used validated measures. We used the validated Female Sexual Function Index (FSFI) to assess the prevalence of female sexual dysfunction (FSD) in a sample of >100 women evaluated for bariatric surgery. The FSFI was administered to reportedly sexually active women during their preoperative evaluation. The scores for the individual FSFI domains (desire, arousal, lubrication, orgasm, satisfaction, and pain) ranging from 0 (or 1.2) to 6 were summed to produce a FSFI total score (range 2-36). A FSFI total cutoff score of sexual arousal disorder and healthy controls. Of the 102 women, 61 (59.8%) had FSFI total scores of sexual arousal disorder group (all P values sexual function impairment, with 60% of participants reporting FSD. These findings highlight the need to initiate routine assessment of sexual functioning in this population and examine whether the weight loss after bariatric surgery contributes to a reversal of FSD.

  10. Fuel bundle impact velocities due to reverse flow

    International Nuclear Information System (INIS)

    Wahba, N.N.; Locke, K.E.

    1996-01-01

    If a break should occur in the inlet feeder or inlet header of a CANDU reactor, the rapid depressurization will cause the channel flow(s) to reverse. Depending on the gap between the upstream bundle and shield plug, the string of bundles will accelerate in the reverse direction and impact with the upstream shield plug. The reverse flow impact velocities have been calculated for various operating states for the Bruce NGS A reactors. The sensitivity to several analysis assumptions has been determined. (author)

  11. Rapid and Sensitive Lateral Flow Immunoassay Method for Procalcitonin (PCT Based on Time-Resolved Immunochromatography

    Directory of Open Access Journals (Sweden)

    Xiang-Yang Shao

    2017-02-01

    Full Text Available Procalcitonin (PCT is a current, frequently-used marker for severe bacterial infection. The aim of this study was to develop a cost-effective detection kit for rapid quantitative and on-site detection of PCT. To develop the new PCT quantitative detecting kit, a double-antibody sandwich immunofluorescent assay was employed based on time-resolved immunofluorescent assay (TRFIA combined with lateral flow immunoassay (LFIA. The performance of the new developed kit was evaluated in the aspects of linearity, precision, accuracy, and specificity. Two-hundred thirty-four serum samples were enrolled to carry out the comparison test. The new PCT quantitative detecting kit exhibited a higher sensitivity (0.08 ng/mL. The inter-assay coefficient of variation (CV and the intra-assay CV were 5.4%–7.7% and 5.7%–13.4%, respectively. The recovery rates ranged from 93% to 105%. Furthermore, a high correlation (n = 234, r = 0.977, p < 0.0001 and consistency (Kappa = 0.875 were obtained when compared with the PCT kit from Roche Elecsys BRAHMS. Thus, the new quantitative method for detecting PCT has been successfully established. The results indicated that the newly-developed system based on TRFIA combined with LFIA was suitable for rapid and on-site detection for PCT, which might be a useful platform for other biomarkers in point-of-care tests.

  12. A Monte Carlo Comparison between the Free Cash Flow and Discounted Cash Flow Approaches

    NARCIS (Netherlands)

    M.M. Akalu; J.R. Turner (Rodney)

    2002-01-01

    textabstractOne of the debates in the capital budgeting model selection is between the free cash flow and DCF methods. In this paper an attempt is made to compare SVA against NPV model based on Monte Carlo simulations. Accordingly, NPV is found less sensitive to value driver variations and has got

  13. Deterministic methods for sensitivity and uncertainty analysis in large-scale computer models

    International Nuclear Information System (INIS)

    Worley, B.A.; Oblow, E.M.; Pin, F.G.; Maerker, R.E.; Horwedel, J.E.; Wright, R.Q.; Lucius, J.L.

    1987-01-01

    The fields of sensitivity and uncertainty analysis are dominated by statistical techniques when large-scale modeling codes are being analyzed. This paper reports on the development and availability of two systems, GRESS and ADGEN, that make use of computer calculus compilers to automate the implementation of deterministic sensitivity analysis capability into existing computer models. This automation removes the traditional limitation of deterministic sensitivity methods. The paper describes a deterministic uncertainty analysis method (DUA) that uses derivative information as a basis to propagate parameter probability distributions to obtain result probability distributions. The paper demonstrates the deterministic approach to sensitivity and uncertainty analysis as applied to a sample problem that models the flow of water through a borehole. The sample problem is used as a basis to compare the cumulative distribution function of the flow rate as calculated by the standard statistical methods and the DUA method. The DUA method gives a more accurate result based upon only two model executions compared to fifty executions in the statistical case

  14. Flow-pattern identification and nonlinear dynamics of gas-liquid two-phase flow in complex networks.

    Science.gov (United States)

    Gao, Zhongke; Jin, Ningde

    2009-06-01

    The identification of flow pattern is a basic and important issue in multiphase systems. Because of the complexity of phase interaction in gas-liquid two-phase flow, it is difficult to discern its flow pattern objectively. In this paper, we make a systematic study on the vertical upward gas-liquid two-phase flow using complex network. Three unique network construction methods are proposed to build three types of networks, i.e., flow pattern complex network (FPCN), fluid dynamic complex network (FDCN), and fluid structure complex network (FSCN). Through detecting the community structure of FPCN by the community-detection algorithm based on K -mean clustering, useful and interesting results are found which can be used for identifying five vertical upward gas-liquid two-phase flow patterns. To investigate the dynamic characteristics of gas-liquid two-phase flow, we construct 50 FDCNs under different flow conditions, and find that the power-law exponent and the network information entropy, which are sensitive to the flow pattern transition, can both characterize the nonlinear dynamics of gas-liquid two-phase flow. Furthermore, we construct FSCN and demonstrate how network statistic can be used to reveal the fluid structure of gas-liquid two-phase flow. In this paper, from a different perspective, we not only introduce complex network theory to the study of gas-liquid two-phase flow but also indicate that complex network may be a powerful tool for exploring nonlinear time series in practice.

  15. Dicty_cDB: CFC794 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c*nsxw*npspwkskvvitlxmskpkxktkkvfxqin kvsfsxvnn*xxavlxxittskxnplsx*fsd*kvvckxl*kpxlvxpsxwkxkvxitxk msxpkfxtk...tiffck***liiif*ilyffkhikiffflcilfffpfxhin*lckfllklslvkps hwklkvxttlkmsxlkfktkkvfh

  16. Long-term Stable Conservative Multiscale Methods for Vortex Flows

    Science.gov (United States)

    2017-10-31

    Computing Department, Florida State (January 2016) - L. Rebholz, SIAM Southeast 2016, Special session on Recent advances in fluid flow and...Multiscale Methods for Vortex Flows (x) Material has been given an OPSEC review and it has been determined to be non sensitive and, except for...distribution is unlimited. UU UU UU UU 31-10-2017 1-Aug-2014 31-Jul-2017 Final Report: Long-term Stable Conservative Multiscale Methods for Vortex Flows

  17. Entanglement dephasing dynamics driven by a bath of spins

    International Nuclear Information System (INIS)

    Xu Jie; Jing Jun; Yu Ting

    2011-01-01

    We have studied the entanglement dynamics for a two-qubit system coupled to a spin environment of different configurations by a z-x-type interaction. Quantum dynamics of the models considered in this paper is solved analytically. Moreover, we show that simple and concise results may be obtained when certain approximations are properly made. Our purpose is to find out how the entanglement of a central spin system is affected by the pre-designed factors of the system and its environment, such as their initial states and the coupling constants between the system and its environment. Clearly, how the system is coupled to its environment will inevitably change the feature of entanglement evolution of the central spin system. Our major findings include the following: (i) the entanglement of the system of interest is sensitive to the number of spins in the environment, (ii) the initial states of the environment can profoundly affect the dynamics of the entanglement of the central spin system and (iii) the entangled environment can speed up the decay and revival of the entanglement of the central spin system. Our results exhibit some interesting features that have not been found for a bosonic environment.

  18. Evaluation of recovery and quality of sexual activity in women during postpartum in relation to the different mode of delivery: a retrospective analysis.

    Science.gov (United States)

    Laganà, A S; Burgio, M A; Ciancimino, L; Sicilia, A; Pizzo, A; Magno, C; Butticè, S; Triolo, O

    2015-08-01

    Aim of the study was to assess the recovery and quality of sexual activity of women during postpartum, in relation to delivery. We recruited 200 women at 8 weeks after delivery. For each patient we recorded mode of delivery, age, body mass index (BMI), parity and test Female Sexual Function Index (FSFI) score. Sixty-four women (32%) had spontaneous deliveries without episiotomy, 48 (24%) had it with episiotomy, 88 (44%) had caesarean sections. The analysis of variance (ANOVA) test showed no significant differences among the 3 groups for age, BMI, parity. The test FSFI evidenced 68 cases (34%) of Regular Female Sexual Function (RFSF) and 132 (66%) of Female Sexual Dysfunction (FSD). The ANOVA test showed significant differences among the 3 groups in RFSF (F [2, 14]=8.075, P=0.005), but not in FSD (F [2, 30]=2.646, P=0.087). In RFSF, FSFI score was higher in women who had vaginal delivery with episiotomy compared with the other two groups. Conversely, in FSD (both with or without resumed sexual activity at 8 weeks postpartum) we evidenced that patients who had vaginal delivery with episiotomy showed lower FSFI score than the other two groups, with a decrease in lubrication, orgasm and satisfaction scores. Furthermore, we observed that most of the RFSF patients had a job and breastfed. Our results did not evidence a direct and significant correlation between mode of delivery and onset of female postpartum sexual dysfunction, even if FSD patients who underwent episiotomy during delivery markedly showed low FSFI scores.

  19. How do we actually put smarter snacks in schools? NOURISH (Nutrition Opportunities to Understand Reforms Involving Student Health) conversations with food-service directors.

    Science.gov (United States)

    Rosenfeld, Lindsay E; Cohen, Juliana Fw; Gorski, Mary T; Lessing, Andrés J; Smith, Lauren; Rimm, Eric B; Hoffman, Jessica A

    2017-02-01

    In autumn 2012, Massachusetts schools implemented comprehensive competitive food and beverage standards similar to the US Department of Agriculture's Smart Snacks in School standards. We explored major themes raised by food-service directors (FSD) regarding their school-district-wide implementation of the standards. For this qualitative study, part of a larger mixed-methods study, compliance was measured via direct observation of foods and beverages during school site visits in spring 2013 and 2014, calculated to ascertain the percentage of compliant products available to students. Semi-structured interviews with school FSD conducted in each year were analysed for major implementation themes; those raised by more than two-thirds of participating school districts were explored in relationship to compliance. Massachusetts school districts (2013: n 26; 2014: n 21). Data collected from FSD. Seven major themes were raised by more than two-thirds of participating school districts (range 69-100 %): taking measures for successful transition; communicating with vendors/manufacturers; using tools to identify compliant foods and beverages; receiving support from leadership; grappling with issues not covered by the law; anticipating changes in sales of competitive foods and beverages; and anticipating changes in sales of school meals. Each theme was mentioned by the majority of more-compliant school districts (65-81 %), with themes being raised more frequently after the second year of implementation (range increase 4-14 %). FSD in more-compliant districts were more likely to talk about themes than those in less-compliant districts. Identified themes suggest best-practice recommendations likely useful for school districts implementing the final Smart Snacks in School standards, effective July 2016.

  20. Ranking criteria for assessment of municipal solid waste dumping sites

    Directory of Open Access Journals (Sweden)

    Mahmood Khalid

    2017-03-01

    Full Text Available Priority wise channelization of resources is the key to successful environmental management, especially when funds are limited. The study in hand has successfully developed an algorithmic criterion to compare hazardous effects of Municipal Solid Waste (MSW dumping sites quantitatively. It is a Multi Criteria Analysis (MCA that has made use of the scaling function to normalize the data values, Analytical Hierarchy Process (AHP for assigning weights to input parameters showing their relevant importance, and Weighted Linear Combination (WLC for aggregating the normalized scores. Input parameters have been divided into three classes namely Resident’s Concerns, Groundwater Vulnerability and Surface Facilities. Remote Sensing data and GIS analysis were used to prepare most of the input data. To elaborate the idea, four dumpsites have been chosen as case study, namely Old-FSD, New-FSD, Saggian and Mahmood Booti. The comparison has been made first at class levels and then class scores have been aggregated into environmental normalized index for environmental impact ranking. The hierarchy of goodness found for the selected sites is New-FSD > Old-FSD > Mahmood Booti > Saggian with comparative scores of goodness to environment as 36.67, 28.43, 21.26 and 13.63 respectively. Flexibility of proposed model to adjust any number of classes and parameters in one class will be very helpful for developing world where availability of data is the biggest hurdle in research based environmental sustainability planning. The model can be run even without purchasing satellite data and GIS software, with little inaccuracy, using imagery and measurement tools provided by Google Earth.

  1. Evaluating sensitivity of unsaturated soil properties

    International Nuclear Information System (INIS)

    Abdel-Rahman, R.O.; El-Kamash, A.M.; Nagy, M.E.; Khalill, M.Y.

    2005-01-01

    The assessment of near surface disposal performance relay on numerical models of groundwater flow and contaminant transport. These models use the unsaturated soil properties as input parameters, which are subject to uncertainty due to measurements errors and the spatial variability in the subsurface environment. To ascertain how much the output of the model will depend on the unsaturated soil properties the parametric sensitivity analysis is used. In this paper, a parametric sensitivity analysis of the Van Genuchten moisture retention characteristic (VGMRC) model will be presented and conducted to evaluate the relative importance of the unsaturated soil properties under different pressure head values that represent various dry and wet conditions. (author)

  2. Dust in flowing magnetized plasma

    International Nuclear Information System (INIS)

    Pandey, Birendra P.; Samarian, Alex A.; Vladimirov, Sergey V.

    2009-01-01

    Plasma flows occur in almost every laboratory device and interactions of flowing plasmas with near-wall impurities and/or dust significantly affects the efficiency and lifetime of such devices. The charged dust inside the magnetized flowing plasma moves primarily under the influence of the plasma drag and electric forces. Here, the charge on the dust, plasma potential, and plasma density are calculated self-consistently. The electrons are assumed non-Boltzmannian and the effect of electron magnetization and electron-atom collisions on the dust charge is calculated in a self-consistent fashion. For various plasma magnetization parameters viz. the ratio of the electron and ion cyclotron frequencies to their respective collision frequencies, plasma-atom and ionization frequencies, the evolution of the plasma potential and density in the flow region is investigated. The variation of the dust charge profile is shown to be a sensitive function of plasma parameters. (author)

  3. Sensitivity of break-flow-partition on the containment pressure and temperature

    International Nuclear Information System (INIS)

    Kwon, Young Min; Song, Jin Ho; Lee, Sang Yong

    1994-01-01

    For the case of RCS blowdown into the vapor region of a containment at low pressure, the blowdown mixture will start to boil at the containment pressure and liquid will separate from the flow near the break location. The flashed steam is added to the containment atmosphere and liquid is falled to the sump. Analytically, the break flow can be divided into steam and liquid in a number of ways. Discussed in this study is three partition models and Instantaneous Mixing(IM) Model employed in different containment analysis computer codes. IM model is employed in the CONTRANS code developed by ABB-CE for containment thermodynamic analysis. The various partition models were applied to the double ended discharge leg slot break (DEDLS) LOCA which is containment design base accident (CDBA) for Ulchin 3 and 4 PSAR. It was shown that IM model is the most conservative for containment design pressure analysis. Results of the CONTRANS analyses are compared with those of UCN PSAR for which CONTEMPT-LT code was used

  4. High sensitivity tracer imaging of iron oxides using magnetic particle imaging

    International Nuclear Information System (INIS)

    Goodwill, Patrick; Konkle, Justin; Lu, Kuan; Zheng, Bo; Conolly, Steven

    2014-01-01

    Full text: Magnetic Particle Imaging (MPI) is a new tracer imaging modality that is gaining significant interest from NMR and MRI researchers. While the physics of MPI differ substantially from MRI, it employs hardware and imaging concepts that are familiar to MRI researchers, such as magnetic excitation and detection, pulse sequences, and relaxation effects. Furthermore, MPI employs the same superparamagnetic iron oxide (SPIO) contrast agents that are sometimes used for MR angiography and are often used for MRI cell tracking studies. These SPIOs are much safer for humans than iodine or gadolinium, especially for Chronic Kidney Disease (CKD) patients. The weak kidneys of CKD patients cannot safely excrete iodine or gadolinium, leading to increased morbidity and mortality after iodinated X-ray or CT angiograms, or after gadolinium-MRA studies. Iron oxides, on the other hand, are processed in the liver, and have been shown to be safe even for CKD patients. Unlike the 'black blood' contrast generated by SPIOs in MRI due to increased T2 dephasing, SPIOs in MPI generate positive, 'bright blood' contrast. With this ideal contrast, even prototype MPI scanners can already achieve fast, high-sensitivity, and high-contrast angiograms with millimeter-scale resolutions in phantoms and in animals. Moreover, MPI shows great potential for an exciting array of applications, including stem cell tracking in vivo, first-pass contrast studies to diagnose or stage cancer, and inflammation imaging in vivo. So far, only a handful of prototype small-animal MPI scanners have been constructed worldwide. Hence, MPI is open to great advances, especially in hardware, pulse sequence, and nanoparticle improvements, with the potential to revolutionize the biomedical imaging field. (author)

  5. High sensitivity tracer imaging of iron oxides using magnetic particle imaging

    Energy Technology Data Exchange (ETDEWEB)

    Goodwill, Patrick [University of California, Dept. of Bioengineering, Berkeley, CA (United States); Konkle, Justin; Lu, Kuan; Zheng, Bo [UC Berkeley (UCSF), Joint Graduate Group in Bioengineering, CA (United States); Conolly, Steven [University of California, Berkeley Bioengineering, Electrical Engineering, and Computer Science, CA (United States)

    2014-07-01

    Full text: Magnetic Particle Imaging (MPI) is a new tracer imaging modality that is gaining significant interest from NMR and MRI researchers. While the physics of MPI differ substantially from MRI, it employs hardware and imaging concepts that are familiar to MRI researchers, such as magnetic excitation and detection, pulse sequences, and relaxation effects. Furthermore, MPI employs the same superparamagnetic iron oxide (SPIO) contrast agents that are sometimes used for MR angiography and are often used for MRI cell tracking studies. These SPIOs are much safer for humans than iodine or gadolinium, especially for Chronic Kidney Disease (CKD) patients. The weak kidneys of CKD patients cannot safely excrete iodine or gadolinium, leading to increased morbidity and mortality after iodinated X-ray or CT angiograms, or after gadolinium-MRA studies. Iron oxides, on the other hand, are processed in the liver, and have been shown to be safe even for CKD patients. Unlike the 'black blood' contrast generated by SPIOs in MRI due to increased T2 dephasing, SPIOs in MPI generate positive, 'bright blood' contrast. With this ideal contrast, even prototype MPI scanners can already achieve fast, high-sensitivity, and high-contrast angiograms with millimeter-scale resolutions in phantoms and in animals. Moreover, MPI shows great potential for an exciting array of applications, including stem cell tracking in vivo, first-pass contrast studies to diagnose or stage cancer, and inflammation imaging in vivo. So far, only a handful of prototype small-animal MPI scanners have been constructed worldwide. Hence, MPI is open to great advances, especially in hardware, pulse sequence, and nanoparticle improvements, with the potential to revolutionize the biomedical imaging field. (author)

  6. Granular flow through an aperture: influence of the packing fraction

    OpenAIRE

    Alejandra Aguirre , Maria; De Schant , Rosario; Géminard , Jean-Christophe

    2014-01-01

    For the last 50 years, the flow of a granular material through an aperture has been intensely studied in gravity-driven vertical systems (e.g. silos and hoppers). Nevertheless, in many industrial applications, grains are horizontally transported at constant velocity, lying on conveyor belts or floating on the surface of flowing liquids. Unlike fluid flows, that are controlled by the pressure, granular flow is not sensitive to the local pressure but rather to the local velocity of the grains a...

  7. Sensitivity technologies for large scale simulation

    International Nuclear Information System (INIS)

    Collis, Samuel Scott; Bartlett, Roscoe Ainsworth; Smith, Thomas Michael; Heinkenschloss, Matthias; Wilcox, Lucas C.; Hill, Judith C.; Ghattas, Omar; Berggren, Martin Olof; Akcelik, Volkan; Ober, Curtis Curry; van Bloemen Waanders, Bart Gustaaf; Keiter, Eric Richard

    2005-01-01

    Sensitivity analysis is critically important to numerous analysis algorithms, including large scale optimization, uncertainty quantification,reduced order modeling, and error estimation. Our research focused on developing tools, algorithms and standard interfaces to facilitate the implementation of sensitivity type analysis into existing code and equally important, the work was focused on ways to increase the visibility of sensitivity analysis. We attempt to accomplish the first objective through the development of hybrid automatic differentiation tools, standard linear algebra interfaces for numerical algorithms, time domain decomposition algorithms and two level Newton methods. We attempt to accomplish the second goal by presenting the results of several case studies in which direct sensitivities and adjoint methods have been effectively applied, in addition to an investigation of h-p adaptivity using adjoint based a posteriori error estimation. A mathematical overview is provided of direct sensitivities and adjoint methods for both steady state and transient simulations. Two case studies are presented to demonstrate the utility of these methods. A direct sensitivity method is implemented to solve a source inversion problem for steady state internal flows subject to convection diffusion. Real time performance is achieved using novel decomposition into offline and online calculations. Adjoint methods are used to reconstruct initial conditions of a contamination event in an external flow. We demonstrate an adjoint based transient solution. In addition, we investigated time domain decomposition algorithms in an attempt to improve the efficiency of transient simulations. Because derivative calculations are at the root of sensitivity calculations, we have developed hybrid automatic differentiation methods and implemented this approach for shape optimization for gas dynamics using the Euler equations. The hybrid automatic differentiation method was applied to a first

  8. Stand-alone core sensitivity and uncertainty analysis of ALFRED from Monte Carlo simulations

    International Nuclear Information System (INIS)

    Pérez-Valseca, A.-D.; Espinosa-Paredes, G.; François, J.L.; Vázquez Rodríguez, A.; Martín-del-Campo, C.

    2017-01-01

    Highlights: • Methodology based on Monte Carlo simulation. • Sensitivity analysis of Lead Fast Reactor (LFR). • Uncertainty and regression analysis of LFR. • 10% change in the core inlet flow, the response in thermal power change is 0.58%. • 2.5% change in the inlet lead temperature the response is 1.87% in power. - Abstract: The aim of this paper is the sensitivity and uncertainty analysis of a Lead-Cooled Fast Reactor (LFR) based on Monte Carlo simulation of sizes up to 2000. The methodology developed in this work considers the uncertainty of sensitivities and uncertainty of output variables due to a single-input-variable variation. The Advanced Lead fast Reactor European Demonstrator (ALFRED) is analyzed to determine the behavior of the essential parameters due to effects of mass flow and temperature of liquid lead. The ALFRED core mathematical model developed in this work is fully transient, which takes into account the heat transfer in an annular fuel pellet design, the thermo-fluid in the core, and the neutronic processes, which are modeled with point kinetic with feedback fuel temperature and expansion effects. The sensitivity evaluated in terms of the relative standard deviation (RSD) showed that for 10% change in the core inlet flow, the response in thermal power change is 0.58%, and for 2.5% change in the inlet lead temperature is 1.87%. The regression analysis with mass flow rate as the predictor variable showed statistically valid cubic correlations for neutron flux and linear relationship neutron flux as a function of the lead temperature. No statistically valid correlation was observed for the reactivity as a function of the mass flow rate and for the lead temperature. These correlations are useful for the study, analysis, and design of any LFR.

  9. A magnetic nanocomposite for biomimetic flow sensing

    KAUST Repository

    Alfadhel, Ahmed

    2014-01-01

    A magnetic nanocomposite has been implemented as artificial hair on a giant magnetoimpedance (GMI) thin-film sensor for flow sensing. The 500 μm long and 100 μm in diameter pillars are composed of iron nanowires incorporated in polydimethylsiloxane (PDMS). The nanowires\\' length and diameter are 6 μm and 35 nm, respectively. Upon fluid flow, the pillars are deflected, causing a change in the magnetic field at the GMI element and a corresponding change in impedance. The permanent magnetic behavior of the nanowires in combination with the GMI sensor and the high elasticity of the PDMS pillars result in a high-performance flow sensor with low power consumption and potential for remote detection. No additional magnetic field is required to magnetize the nanowires or bias the sensor, which simplifies miniaturization and integration in microsystems. At a power consumption of 31.6 μW, air flow rates up to 190 mm s-1 can be detected with a sensitivity of 24 mΩ (mm)-1 s and a resolution of 0.56 mm s-1 while the range for water flow is up to 7.8 mm s-1 with a sensitivity of 0.9 Ω (mm)-1 s and a resolution of 15 μm s-1. When power consumption is reduced to as low as 80 nW a high resolution of 32 μm s-1 is still maintained.

  10. Flux pinning and flux flow studies in superconductors using flux flow noise techniques. Progress report, April 1, 1976--December 17, 1976

    International Nuclear Information System (INIS)

    Joiner, W.C.H.

    1976-12-01

    Measurements of flux flow noise power spectra have been combined with critical current measurements and measurements of current-voltage characteristics to study flux flow and local pinning interactions effective during flux flow. A model of flux flow noise generation in the presence of local pinning interactions is developed and applied to situations where pinning is dominated by: (1) grain boundaries, (2) normal metal precipitates in a superconducting matrix, (3) gross deformation producing a critical current peak effect, and (4) surface grooves imposed on a sample surface. In the case of pinning caused by normal metal precipitates in a superconducting matrix, unusual training and hysterisis effects are observed in the flux flow characteristics. The greater sensitivity of noise spectra, as compared with bulk critical current measurements, in obtaining a detailed picture of flux flow is emphasized

  11. First status report on regional groundwater flow modeling for the Palo Duro Basin, Texas

    International Nuclear Information System (INIS)

    Andrews, R.W.

    1984-12-01

    Regional groundwater flow within the principal hydrogeological units of the Palo Duro Basin is evaluated by developing a conceptual model of the flow regime in the shallow aquifers and the deep-basin brine aquifers and testing these models using a three-dimensional, finite-difference flow code. Semiquantitative sensitivity analysis (a limited parametric study) is conducted to define the system response to changes in hydrologic properties or boundary conditions. Adjoint sensitivity analysis is applied to the conceptualized flow regime in the Wolfcamp carbonate aquifer. All steps leading to the final results and conclusions are incorporated in this report. The available data utilized in this study are summarized. The specific conceptual models, defining the areal and vertical averaging of lithologic units, aquifer properties, fluid properties, and hydrologic boundary conditions, are described in detail. The results are delineated by the simulated potentiometric surfaces and tables summarizing areal and vertical boundary fluxes, Darcy velocities at specific points, and groundwater travel paths. Results from the adjoint sensitivity analysis included importance functions and sensitivity coefficients, using heads or the average Darcy velocities as the performance measures. The reported work is the first stage of an ongoing evaluation of two areas within the Palo Duro Basin as potantial repositories for high-level radioactive wastes. The results and conclusions should thus be considered preliminary and subject to modification with the collection of additional data. However, this report does provide a useful basis for describing the sensitivity and, to a lesser extent, the uncertainty of the present conceptualization of groundwater flow within the Palo Duro Basin

  12. Relationship between thermal stratification and flow patterns in steam-quenching suppression pool

    International Nuclear Information System (INIS)

    Song, Daehun; Erkan, Nejdet; Jo, Byeongnam; Okamoto, Koji

    2015-01-01

    Highlights: • Thermal stratification mechanism by direct contact condensation is investigated. • Thermal stratification condition changes according to the flow pattern. • Thermal stratification depends on the force balance between buoyancy and momentum. • Flow pattern change was observed even in the same regime. • Flow pattern is affected by the sensitive force balance. - Abstract: This study aims to examine the relationship between thermal stratification and flow patterns in a steam-quenching suppression pool using particle image velocimetry. Thermal stratification was experimentally evaluated in a depressurized water pool under different steam mass flux conditions. The time evolution of the temperature profile of the suppression pool was presented with the variation of condensation regimes, and steam condensation processes were visualized using a high-speed camera. The thermal stratification condition was classified into full mixing, gradual thermal stratification, and developed thermal stratification. It was found that the condition was determined by the flow patterns depending on the force balance between buoyancy and momentum. The force balance affected both the condensation regime and the flow pattern, and hence, the flow pattern was changed with the condensation regime. However, the force balance had a sensitive influence on the flow in the pool; therefore, distinct flow patterns were observed even in the same condensation regime.

  13. Interfacial area transport in a confined Bubbly flow

    Energy Technology Data Exchange (ETDEWEB)

    Kim, S.; Sun, X.; Ishii, M. [Purdue Univ., Lafayette, IN (United States). School of Nuclear Engineering; Lincoln, F. [Bettis Atomic Power Lab., West Mifflin, Bechtel Bettis, Inc., PA (United States)

    2001-07-01

    The interfacial area transport equation applicable to the bubbly flow is presented. The model is evaluated against the data acquired in an adiabatic air-water upward two-phase flow loop with a test section of 20 cm in width and 1 cm in gap. In general, a good agreement, within the measurement error of {+-}10%, is observed for a wide range in the bubbly flow regime. The sensitivity analysis on the individual particle interaction mechanisms demonstrates the active interactions between the bubbles and highlights the mechanisms playing the dominant role in interfacial area transport. (author)

  14. Oxygen sensitivity of krypton and Lyman-alpha hygrometers

    NARCIS (Netherlands)

    Dijk, van A.; Kohsiek, W.; Bruin, de H.A.R.

    2003-01-01

    The oxygen sensitivity of krypton and Lyman-¿ hygrometers is studied. Using a dewpoint generator and a controlled nitrogen/oxygen flow the extinction coefficients of five hygrometers associated with the third-order Taylor expansion of the Lambert¿Beer law around reference conditions for oxygen and

  15. Flight tests of a supersonic natural laminar flow airfoil

    International Nuclear Information System (INIS)

    Frederick, M A; Banks, D W; Garzon, G A; Matisheck, J R

    2015-01-01

    A flight test campaign of a supersonic natural laminar flow airfoil has been recently completed. The test surface was an 80 inch (203 cm) chord and 40 inch (102 cm) span article mounted on the centerline store location of an F-15B airplane. The test article was designed with a leading edge sweep of effectively 0° to minimize boundary layer crossflow. The test article surface was coated with an insulating material to avoid significant heat transfer to and from the test article structure to maintain a quasi-adiabatic wall. An aircraft-mounted infrared camera system was used to determine boundary layer transition and the extent of laminar flow. The tests were flown up to Mach 2.0 and chord Reynolds numbers in excess of 30 million. The objectives of the tests were to determine the extent of laminar flow at high Reynolds numbers and to determine the sensitivity of the flow to disturbances. Both discrete (trip dots) and 2D disturbances (forward-facing steps) were tested. A series of oblique shocks, of yet unknown origin, appeared on the surface, which generated sufficient crossflow to affect transition. Despite the unwanted crossflow, the airfoil performed well. The results indicate that the sensitivity of the flow to the disturbances, which can translate into manufacturing tolerances, was similar to that of subsonic natural laminar flow wings. (paper)

  16. Collective flow as a probe of heavy-ion reaction dynamics

    International Nuclear Information System (INIS)

    Awes, T.C.

    1997-01-01

    Collective flow of nuclear matter probes the dynamics of heavy-ion reactions and can provide information about the nuclear-matter equation of state. In particular, the incident energy dependences of collective flow may be a sensitive means to deduce the existence of a Quark Gluon Plasma phase in the equation of state. Collective flow measurements from 30 A MeV to 200 A GeV incident energies are briefly reviewed. Preliminary results on collective flow from the WA98 experiment at the CERN SPS are presented

  17. Interpretation and value of MR CSF flow studies for paediatric ...

    African Journals Online (AJOL)

    Imaging techniques may be underutilised when clinicians are unaware of the technique or do not recognise its potential. Phase-contrast MR imaging (PC-MRI) is a rapid, simple and non-invasive technique that is sensitive to CSF flow. It demonstrates a mechanical coupling between cerebral blood and CSF flow throughout ...

  18. Application of perturbation methods for sensitivity analysis for nuclear power plant steam generators

    International Nuclear Information System (INIS)

    Gurjao, Emir Candeia

    1996-02-01

    The differential and GPT (Generalized Perturbation Theory) formalisms of the Perturbation Theory were applied in this work to a simplified U-tubes steam generator model to perform sensitivity analysis. The adjoint and importance equations, with the corresponding expressions for the sensitivity coefficients, were derived for this steam generator model. The system was numerically was numerically solved in a Fortran program, called GEVADJ, in order to calculate the sensitivity coefficients. A transient loss of forced primary coolant in the nuclear power plant Angra-1 was used as example case. The average and final values of functionals: secondary pressure and enthalpy were studied in relation to changes in the secondary feedwater flow, enthalpy and total volume in secondary circuit. Absolute variations in the above functionals were calculated using the perturbative methods, considering the variations in the feedwater flow and total secondary volume. Comparison with the same variations obtained via direct model showed in general good agreement, demonstrating the potentiality of perturbative methods for sensitivity analysis of nuclear systems. (author)

  19. 4D-MR flow analysis in patients after repair for tetralogy of Fallot

    International Nuclear Information System (INIS)

    Geiger, J.; Markl, M.; Jung, B.; Langer, M.; Grohmann, J.; Stiller, B.; Arnold, R.

    2011-01-01

    Comprehensive analysis of haemodynamics by 3D flow visualisation and retrospective flow quantification in patients after repair of tetralogy of Fallot (TOF). Time-resolved flow-sensitive 4D MRI (spatial resolution ∝ 2.5 mm, temporal resolution = 38.4 ms) was acquired in ten patients after repair of TOF and in four healthy controls. Data analysis included the evaluation of haemodynamics in the aorta, the pulmonary trunk (TP) and left (lPA) and right (rPA) pulmonary arteries by 3D blood flow visualisation using particle traces, and quantitative measurements of flow velocity. 3D visualisation of whole heart haemodynamics provided a comprehensive overview on flow pattern changes in TOF patients, mainly alterations in flow velocity, retrograde flow and pathological vortices. There was consistently higher blood flow in the rPA of the patients (rPA/lPA flow ratio: 2.6 ± 2.5 vs. 1.1 ± 0.1 in controls). Systolic peak velocity in the TP was higher in patients (1.9 m/s ± 0.7 m/s) than controls (0.9 m/s ± 0.1 m/s). 4D flow-sensitive MRI permits the comprehensive evaluation of blood flow characteristics in patients after repair of TOF. Altered flow patterns for different surgical techniques in the small patient cohort may indicate its value for patient monitoring and potentially identifying optimal surgical strategies. (orig.)

  20. 4D-MR flow analysis in patients after repair for tetralogy of Fallot

    Energy Technology Data Exchange (ETDEWEB)

    Geiger, J.; Markl, M.; Jung, B.; Langer, M. [University Hospital Freiburg, Department of Radiology, Medical Physics, Freiburg (Germany); Grohmann, J.; Stiller, B.; Arnold, R. [University Hospital Freiburg, Department of Congenital Heart Disease and Pediatric Cardiology, Freiburg (Germany)

    2011-08-15

    Comprehensive analysis of haemodynamics by 3D flow visualisation and retrospective flow quantification in patients after repair of tetralogy of Fallot (TOF). Time-resolved flow-sensitive 4D MRI (spatial resolution {proportional_to} 2.5 mm, temporal resolution = 38.4 ms) was acquired in ten patients after repair of TOF and in four healthy controls. Data analysis included the evaluation of haemodynamics in the aorta, the pulmonary trunk (TP) and left (lPA) and right (rPA) pulmonary arteries by 3D blood flow visualisation using particle traces, and quantitative measurements of flow velocity. 3D visualisation of whole heart haemodynamics provided a comprehensive overview on flow pattern changes in TOF patients, mainly alterations in flow velocity, retrograde flow and pathological vortices. There was consistently higher blood flow in the rPA of the patients (rPA/lPA flow ratio: 2.6 {+-} 2.5 vs. 1.1 {+-} 0.1 in controls). Systolic peak velocity in the TP was higher in patients (1.9 m/s {+-} 0.7 m/s) than controls (0.9 m/s {+-} 0.1 m/s). 4D flow-sensitive MRI permits the comprehensive evaluation of blood flow characteristics in patients after repair of TOF. Altered flow patterns for different surgical techniques in the small patient cohort may indicate its value for patient monitoring and potentially identifying optimal surgical strategies. (orig.)

  1. A Monte Carlo Comparison between the Free Cash Flow and Discounted Cash Flow Approaches

    OpenAIRE

    Mehari Mekonnen Akalu; Rodney Turner

    2002-01-01

    textabstractOne of the debates in the capital budgeting model selection is between the free cash flow and DCF methods. In this paper an attempt is made to compare SVA against NPV model based on Monte Carlo simulations. Accordingly, NPV is found less sensitive to value driver variations and has got higher forecast errors as compared to SVA model.

  2. An Inexpensive, Fast and Sensitive Quantitative Lateral Flow Magneto-Immunoassay for Total Prostate Specific Antigen

    Directory of Open Access Journals (Sweden)

    Jacqueline M. Barnett

    2014-07-01

    Full Text Available We describe the detection characteristics of a device the Resonant Coil Magnetometer (RCM to quantify paramagnetic particles (PMPs in immunochromatographic (lateral flow assays. Lateral flow assays were developed using PMPs for the measurement of total prostate specific antigen (PSA in serum samples. A detection limit of 0.8 ng/mL was achieved for total PSA using the RCM and is at clinically significant concentrations. Comparison of data obtained in a pilot study from the analysis of serum samples with commercially available immunoassays shows good agreement. The development of a quantitative magneto-immunoassay in lateral flow format for total PSA suggests the potential of the RCM to operate with many immunoassay formats. The RCM has the potential to be modified to quantify multiple analytes in this format. This research shows promise for the development of an inexpensive device capable of quantifying multiple analytes at the point-of-care using a magneto-immunoassay in lateral flow format.

  3. Preliminary Assessment of the Loss of Flow Accident for PGSFR

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Andong; Choi, Yong Won; Bae, Moohoon [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2014-10-15

    TRACE code have being considered as a candidate tool for SFR audit calculation for licensing review since 2012. On the basis of modeling and precalculation experience for the Demonstration Sodium cooled Fast Reactor (DSFR-600), TRACE code model for PGSFR was developed this year. In this paper, one of representing Design Base Event (DBE), Loss of Flow (LOF) accident was pre-calculated and Locked Rotor (LR) case was compared with LOF case since it could be a possible limiting case for LOF representing DBE. Sensitivity calculation for the LR case was implemented for identifying major parameters for the scenario. For the preparation of the review of licensing application for PGSFR, TRACE model for the PGSFR was developed and the loss of flow accident was precalculated. The locked pump rotor case was also calculated as a possible bounding case for the loss of flow scenario. Pre-calculation showed that the locked rotor case was similar or worst case to the loss of flow accident. Therefore, the locked rotor case should take into account in design base accident assessment of PGSFR. Sensitivity calculations for the rocked rotor case also studied for identification of unfixed design parameters influencing to estimation of inner surface temperature. Sensitivity result showed that the first temperature peak was largely influenced by reactor trip delay and second peak mostly influenced by pump coast down characteristic.

  4. Highly sensitive miniature fluidic flowmeter based on an FBG heated by Co2+-doped fiber

    NARCIS (Netherlands)

    Liu, Z.; Htein, L.; Cheng, L.K.; Martina, Q.; Jansen, R.; Tam, H.Y.

    2017-01-01

    In this paper, we present a miniature fluidic flow sensor based on a short fiber Bragg grating inscribed in a single mode fiber and heated by Co2+-doped multimode fibers. The proposed flow sensor was employed to measure the flow rates of oil and water, showing good sensitivity of 0.339 nm/(m/s) and

  5. Sensitivity analysis for near-surface disposal in argillaceous media using NAMMU-HYROCOIN Level 3-Test case 1

    International Nuclear Information System (INIS)

    Miller, D.R.; Paige, R.W.

    1988-07-01

    HYDROCOIN is an international project for comparing groundwater flow models and modelling strategies. Level 3 of the project concerns the application of groundwater flow models to repository performance assessment with emphasis on the treatment of sensitivity and uncertainty in models and data. Level 3, test case 1 concerns sensitivity analysis of the groundwater flow around a radioactive waste repository situated in a near surface argillaceous formation. Work on this test case has been carried out by Harwell and will be reported in full in the near future. This report presents the results obtained using the computer program NAMMU. (author)

  6. Hair receptor sensitivity to changes in laminar boundary layer shape

    International Nuclear Information System (INIS)

    Dickinson, B T

    2010-01-01

    Biologists have shown that bat wings contain distributed arrays of flow-sensitive hair receptors. The hair receptors are hypothesized to feedback information on airflows over the bat wing for enhanced stability or maneuverability during flight. Here, we study the geometric specialization of hair-like structures for the detection of changes in boundary layer velocity profiles (shapes). A quasi-steady model that relates the flow velocity profile incident on the longitudinal axis of a hair to the resultant moment and shear force at the hair base is developed. The hair length relative to the boundary layer momentum thickness that maximizes the resultant moment and shear-force sensitivity to changes in boundary layer shape is determined. The sensitivity of the resultant moment and shear force is shown to be highly dependent on hair length. Hairs that linearly taper to a point are shown to provide greater output sensitivity than hairs of uniform cross-section. On an order of magnitude basis, the computed optimal hair lengths are in agreement with the range of hair receptor lengths measured on individual bat species. These results support the hypothesis that bats use hair receptors for detecting changes in boundary layer shape and provide geometric guidelines for artificial hair sensor design and application.

  7. Application of adjoint sensitivity theory to performance assessment of hydrogeologic concerns

    International Nuclear Information System (INIS)

    Metcalfe, D.E.; Harper, W.V.

    1986-01-01

    Sensitivity and uncertainty analyses are important components of performance assessment activities for potential high-level radioactive waste repositories. The application of the adjoint sensitivity technique is demonstrated for the Leadville Limestone in the Paradox Basin, Utah. The adjoint technique is used sequentially to first assist in the calibration of the regional conceptual ground-water flow model to measured potentiometric data. Second, it is used to evaluate the sensitivities of the calculated pressures used to define local scale boundary conditions to regional parameters and boundary conditions

  8. Geometry of vanishing flow: A new probe to determine the in ...

    Indian Academy of Sciences (India)

    We studied the transverse flow throughout the mass range from 20Ne+20 Ne to. 131Xe+131Xe as a ... Collective transverse in-plane flow [1–3] was found to be one of the most sensitive observ- ables in this ... From earlier measurements, τ.

  9. Methodology for sensitivity analysis, approximate analysis, and design optimization in CFD for multidisciplinary applications. [computational fluid dynamics

    Science.gov (United States)

    Taylor, Arthur C., III; Hou, Gene W.

    1992-01-01

    Fundamental equations of aerodynamic sensitivity analysis and approximate analysis for the two dimensional thin layer Navier-Stokes equations are reviewed, and special boundary condition considerations necessary to apply these equations to isolated lifting airfoils on 'C' and 'O' meshes are discussed in detail. An efficient strategy which is based on the finite element method and an elastic membrane representation of the computational domain is successfully tested, which circumvents the costly 'brute force' method of obtaining grid sensitivity derivatives, and is also useful in mesh regeneration. The issue of turbulence modeling is addressed in a preliminary study. Aerodynamic shape sensitivity derivatives are efficiently calculated, and their accuracy is validated on two viscous test problems, including: (1) internal flow through a double throat nozzle, and (2) external flow over a NACA 4-digit airfoil. An automated aerodynamic design optimization strategy is outlined which includes the use of a design optimization program, an aerodynamic flow analysis code, an aerodynamic sensitivity and approximate analysis code, and a mesh regeneration and grid sensitivity analysis code. Application of the optimization methodology to the two test problems in each case resulted in a new design having a significantly improved performance in the aerodynamic response of interest.

  10. Enzymatic amplification of a flow-injected thermometric enzyme-linked immunoassay for human insulin.

    Science.gov (United States)

    Mecklenburg, M; Lindbladh, C; Li, H; Mosbach, K; Danielsson, B

    1993-08-01

    A flow-injected thermometric enzyme linked immunoassay for human insulin which employs the lactate dehydrogenase/lactate oxidase (LDH/LOD) substrate recycling system for signal amplification is described. The system is composed of two columns, an immunosorbent column containing immobilized anti-insulin antibodies for sensing and a recycling column containing immobilized LDH/LOD/Catalase for detection. The effect of flow rates, conjugate concentrations, and chromatographic support material upon the sensitivity of the assay are investigated. The assay has a detection limit of 0.025 microgram/ml and a linear range from 0.05 to 2 micrograms/ml. This corresponds to a 10-fold increase in sensitivity over the unamplified system. A recombinant human insulin-proinsulin conjugate was also tested. The results show that enzymatic amplification can be employed to increase the sensitivity and reproducibility of flow injection assay-based biosensors. The implications of these results upon on-line analysis are discussed.

  11. Advanced flow MRI: emerging techniques and applications

    International Nuclear Information System (INIS)

    Markl, M.; Schnell, S.; Wu, C.; Bollache, E.; Jarvis, K.; Barker, A.J.; Robinson, J.D.; Rigsby, C.K.

    2016-01-01

    Magnetic resonance imaging (MRI) techniques provide non-invasive and non-ionising methods for the highly accurate anatomical depiction of the heart and vessels throughout the cardiac cycle. In addition, the intrinsic sensitivity of MRI to motion offers the unique ability to acquire spatially registered blood flow simultaneously with the morphological data, within a single measurement. In clinical routine, flow MRI is typically accomplished using methods that resolve two spatial dimensions in individual planes and encode the time-resolved velocity in one principal direction, typically oriented perpendicular to the two-dimensional (2D) section. This review describes recently developed advanced MRI flow techniques, which allow for more comprehensive evaluation of blood flow characteristics, such as real-time flow imaging, 2D multiple-venc phase contrast MRI, four-dimensional (4D) flow MRI, quantification of complex haemodynamic properties, and highly accelerated flow imaging. Emerging techniques and novel applications are explored. In addition, applications of these new techniques for the improved evaluation of cardiovascular (aorta, pulmonary arteries, congenital heart disease, atrial fibrillation, coronary arteries) as well as cerebrovascular disease (intra-cranial arteries and veins) are presented.

  12. How science teachers balance religion and evolution in the science classroom: A case study of science classes in a Florida Public School District

    Science.gov (United States)

    Willems, Pierre Dominique

    The purpose of this case study was to research how science teachers balance both religion and evolution in the science classroom with as little controversy as possible. In this study I attempted to provide some insight on how teachers are currently teaching evolution in their science classes in light of the religious beliefs of the students as well as their own. The case study was conducted in a school district in Florida where I attempted to answer the following questions: (a) How do science teachers in the Florida School District (FSD) approach the religion--evolution issue in preparing students for a career in a field of science? (b) How do science teachers in the FSD reconcile the subject of evolution with the religious views of their students? (c) How do science teachers in the FSD reconcile their own religious views with the teaching of evolution? (d) How do science teachers in the FSD perceive the relationship between religion and science? The data was collected through interviews with two high school teachers, and one middle school teacher, by observing each participant teach, by collecting site documents and by administering an exploratory survey to student volunteers. Analysis was conducted by open coding which produced four themes from which the research questions were answered and the survey answers were counted to produce the percentages displayed in the tables in chapter four. The teachers avoided discussion on religiously oriented questions or statements by the students and did not reveal their own religious orientation. The topic of microevolution appeared to reduce stress in the classroom environment, as opposed to addressing macroevolution.

  13. Effect of freezing method and frozen storage duration on instrumental quality of lamb throughout display.

    Science.gov (United States)

    Muela, E; Sañudo, C; Campo, M M; Medel, I; Beltrán, J A

    2010-04-01

    This study evaluated the effect of freezing method (FM) (air blast freezer, freezing tunnel, or nitrogen chamber) and frozen storage duration (FSD) (1, 3, or 6 months) on the instrumental measurements of quality of thawed lamb, aged for a total of 72 h, throughout a 10-d display period, compared to the quality of fresh meat. pH, colour, lipid oxidation, thawing, and cooking losses in Longissimus thoracis and lumborum muscle, were determined following standard methods. FM affected yellowness, FSD redness and thawing losses, and both affected oxidation (increased as freezing rate decreased and/or as storage duration increased). When compared with fresh meat, the main differences appeared on oxidation (where a significant interaction between treatment (3FM x 3FSD + fresh meat) with display duration was detected), and on total losses (thaw + cook losses). Oxidation was lower in fresh meat, but values were not significantly different from those stored frozen for 1 month. Fresh meat had smaller total losses than did thawed meat, but losses were not significantly different from meat frozen in the freezing tunnel and stored frozen for 1 month. Display duration had a greater effect on instrumental quality parameters than did FM or FSD. pH, b*, and oxidation increased, and L* and a* decreased with an increase in the number of days on display. In conclusion, neither freezing method nor frozen storage up to 6 months influenced extensively the properties of lamb when instrumental measurements of quality were measured in meat that had been displayed for 1d after thawing. The small deterioration shown in this study should not give consumers concerns about frozen meat. 2009 Elsevier Ltd. All rights reserved.

  14. Relationship between spontaneous expiratory flow-volume curve pattern and air-flow obstruction in elderly COPD patients.

    Science.gov (United States)

    Nozoe, Masafumi; Mase, Kyoshi; Murakami, Shigefumi; Okada, Makoto; Ogino, Tomoyuki; Matsushita, Kazuhiro; Takashima, Sachie; Yamamoto, Noriyasu; Fukuda, Yoshihiro; Domen, Kazuhisa

    2013-10-01

    Assessment of the degree of air-flow obstruction is important for determining the treatment strategy in COPD patients. However, in some elderly COPD patients, measuring FVC is impossible because of cognitive dysfunction or severe dyspnea. In such patients a simple test of airways obstruction requiring only a short run of tidal breathing would be useful. We studied whether the spontaneous expiratory flow-volume (SEFV) curve pattern reflects the degree of air-flow obstruction in elderly COPD patients. In 34 elderly subjects (mean ± SD age 80 ± 7 y) with stable COPD (percent-of-predicted FEV(1) 39.0 ± 18.5%), and 12 age-matched healthy subjects, we measured FVC and recorded flow-volume curves during quiet breathing. We studied the SEFV curve patterns (concavity/convexity), spirometry results, breathing patterns, and demographics. The SEFV curve concavity/convexity prediction accuracy was examined by calculating the receiver operating characteristic curves, cutoff values, area under the curve, sensitivity, and specificity. Fourteen subjects with COPD had a concave SEFV curve. All the healthy subjects had convex SEFV curves. The COPD subjects who had concave SEFV curves often had very severe airway obstruction. The percent-of-predicted FEV(1)% (32.4%) was the most powerful SEFV curve concavity predictor (area under the curve 0.92, 95% CI 0.83-1.00), and had the highest sensitivity (0.93) and specificity (0.88). Concavity of the SEFV curve obtained during tidal breathing may be a useful test for determining the presence of very severe obstruction in elderly patients unable to perform a satisfactory FVC maneuver.

  15. Multiplex polymerase chain reaction on FTA cards vs. flow cytometry for B-lymphocyte clonality.

    Science.gov (United States)

    Dictor, Michael; Skogvall, Ingela; Warenholt, Janina; Rambech, Eva

    2007-01-01

    Two-colour flow cytometry was compared with multiplex PCR with capillary electrophoresis for clonality determination in specific categories of B-cell lymphoma. FTA cards were evaluated for preserving DNA from node imprints and expediting molecular analysis. A single-tube multiplex PCR targeted IGH and lymphoma-specific translocations in DNA extracted from 180 frozen lymphoid tissues and DNA bound to FTA cards from 192 fresh tissues and 137 aspirates. PCR results were compared with flow cytometry in the extracted and aspirated samples. Overall, single-tube multiplex PCR sensitivity was equivalent in the sample groups (intergroup range 79%-91%). False negatives were associated with tumour origin in the follicle centre. Multiplex PCR and flow cytometry were equally sensitive and together detected 98% of B-cell lymphomas. Additional two-tube targeting of IGK suggested an overall molecular sensitivity >90%. False positive (pseudoclonal) single-tube multiplex PCR was associated with necrosis and sparse lymphocytes. Multiplex PCR using template DNA bound to an FTA card effectively detects B-lymphocyte clonality, obviates DNA extraction and refrigeration, and can be used without diminished sensitivity in fine needle aspirates or node imprints as a replacement for or complement to flow cytometry at any point in the diagnostic work-up.

  16. Adjoint shape optimization for fluid-structure interaction of ducted flows

    Science.gov (United States)

    Heners, J. P.; Radtke, L.; Hinze, M.; Düster, A.

    2018-03-01

    Based on the coupled problem of time-dependent fluid-structure interaction, equations for an appropriate adjoint problem are derived by the consequent use of the formal Lagrange calculus. Solutions of both primal and adjoint equations are computed in a partitioned fashion and enable the formulation of a surface sensitivity. This sensitivity is used in the context of a steepest descent algorithm for the computation of the required gradient of an appropriate cost functional. The efficiency of the developed optimization approach is demonstrated by minimization of the pressure drop in a simple two-dimensional channel flow and in a three-dimensional ducted flow surrounded by a thin-walled structure.

  17. Transition from condensation-induced counter-current flow to dispersed flow

    International Nuclear Information System (INIS)

    Gale, J.; Tiselj, I.

    2004-01-01

    Model of transition from the horizontally stratified condensation-induced counter-current flow to slug flow has been analyzed with computer code WAHA and compared to the experimental data obtained in the steamline of the PMK2 test facility of Hungarian Atomic Energy Institute. The experiment was performed in the steamline initially filled with hot vapor that was gradually flooded with cold liquid. Successful simulation of the condensation-induced water hammer that follows the transition, requires accurate description of the horizontally stratified and slug flow regimes and criteria for transition between both flow regimes. Current version of the WAHA code, not verified for the condensation induced type of the water hammer, predicts the water-hammer pressure peak that exceeds 600 bar, while the measured pressure is p m = 170 ± 50 bar. Sensitivity analysis of the inter-phase exchange terms and transition conditions, pointed to the most important closure relations for heat, mass and momentum transfer. The main conclusion of the analysis is large uncertainty of the simulations: minor modification of the crucial correlations can lead to a severe water-hammer in one case, or to the 'calm' transient without pressure peaks in the other case. Large uncertainty is observed in experiments. The same simulation was performed also with RELAP5 code. However, no water hammer was predicted. (author)

  18. Rotating permanent magnet excitation for blood flow measurement.

    Science.gov (United States)

    Nair, Sarath S; Vinodkumar, V; Sreedevi, V; Nagesh, D S

    2015-11-01

    A compact, portable and improved blood flow measurement system for an extracorporeal circuit having a rotating permanent magnetic excitation scheme is described in this paper. The system consists of a set of permanent magnets rotating near blood or any conductive fluid to create high-intensity alternating magnetic field in it and inducing a sinusoidal varying voltage across the column of fluid. The induced voltage signal is acquired, conditioned and processed to determine its flow rate. Performance analysis shows that a sensitivity of more than 250 mV/lpm can be obtained, which is more than five times higher than conventional flow measurement systems. Choice of rotating permanent magnet instead of an electromagnetic core generates alternate magnetic field of smooth sinusoidal nature which in turn reduces switching and interference noises. These results in reduction in complex electronic circuitry required for processing the signal to a great extent and enable the flow measuring device to be much less costlier, portable and light weight. The signal remains steady even with changes in environmental conditions and has an accuracy of greater than 95%. This paper also describes the construction details of the prototype, the factors affecting sensitivity and detailed performance analysis at various operating conditions.

  19. Experimental modelling of fragmentation applied to volcanic explosions

    Science.gov (United States)

    Haug, Øystein Thordén; Galland, Olivier; Gisler, Galen R.

    2013-12-01

    Explosions during volcanic eruptions cause fragmentation of magma and host rock, resulting in fragments with sizes ranging from boulders to fine ash. The products can be described by fragment size distributions (FSD), which commonly follow power laws with exponent D. The processes that lead to power-law distributions and the physical parameters that control D remain unknown. We developed a quantitative experimental procedure to study the physics of the fragmentation process through time. The apparatus consists of a Hele-Shaw cell containing a layer of cohesive silica flour that is fragmented by a rapid injection of pressurized air. The evolving fragmentation of the flour is monitored with a high-speed camera, and the images are analysed to obtain the evolution of the number of fragments (N), their average size (A), and the FSD. Using the results from our image-analysis procedure, we find transient empirical laws for N, A and the exponent D of the power-law FSD as functions of the initial air pressure. We show that our experimental procedure is a promising tool for unravelling the complex physics of fragmentation during phreatomagmatic and phreatic eruptions.

  20. The effect of oxLDL on microvesicle release from platelets, measured by a sensitive flow cytometry method.

    Directory of Open Access Journals (Sweden)

    Tine Bo Nielsen

    2015-11-01

    Full Text Available Microvesicles (MVs are submicron vesicles with sizes of 0.1-1.0-µm in diameter, released from various cell types upon activation or apoptosis. Their involvement in a variety of diseases has been intensively investigated. In blood, platelets are potent MV secretors, and oxLDL, a platelet ligand, induce platelet activation and thus potentially MV secretion. This interaction occurs through binding of oxLDL with CD36, located on the platelet membrane. In this study we investigated the effect of in vitro incubation of platelets with oxLDL on MV release. Furthermore, we compared the results obtained when separating MVs larger than 0.5-µm as a measure of results obtained from less sensitive conventional flow cytometers with MVs below the 0.5-µm limit. MV size-distribution was analysed in plasma from 11 healthy volunteers (4 females, 7 males. MVs were identified as < 1-μm and positive for lactadherin binding and cell specific markers. Platelet rich plasma (PRP was incubated without and with oxLDL or LDL (as control to investigate the impact on platelet activation, evident by release of MVs. Size-calibrated fluorescent beads were used to establish the MV gate, and separate small- and large-size vesicles. CD41+ and CD41+CD36+ MVs increased by 6-8 fold in PRP, when left at room temperature, and the presence of cell specific markers increased. Total MV count was unaffected. Incubations with oxLDL did not increase the MV release or affect the distribution of small- and large-size MVs. We found a large inter-individual variation in the fraction of small- and large-size MVs of 73%. In conclusion, we propose that pro-coagulant activity and activation of platelets induced by interaction of platelet CD36 with oxLDL may not involve release of MVs. Furthermore, our results demonstrate great inter-individual variability in size-distribution of platelet derived MVs and thereby stresses the importance for generation of standardized protocols for MV quantification

  1. Consanguinity and its relationship to differential fertility and mortality in the Kotia: a tribal population of Andhra Pradesh, India.

    Science.gov (United States)

    Yasim; Naidu, J M; Mascie-Taylor, C G

    1997-04-01

    Data on patterns of marriage, differential fertility and mortality were collected from 211 Kotia women residing in Visakhapatnam district of Andhra Pradesh, India. Consanguineous marriages made up just over a quarter of the total, and of these, father's sister's daughter (FSD) were more common than mother's brother's daughter (MBD). The mean inbreeding coefficient for the sample (F) was 0.0172. Women in consanguineous marriages had a lower mean number of total conceptions, live births and living offspring (net fertility) than women in non-consanguineous marriages. Significant heterogeneity was found in the means of living offspring for FSD, MBD and non-consanguineous couples, but not for conceptions and live births.

  2. Joining thick section aluminum to steel with suppressed FeAl intermetallic formation via friction stir dovetailing

    Energy Technology Data Exchange (ETDEWEB)

    Reza-E-Rabby, Md.; Ross, Kenneth; Overman, Nicole R.; Olszta, Matthew J.; McDonnell, Martin; Whalen, Scott A.

    2018-04-01

    A new solid-phase technique called friction stir dovetailing (FSD) has been developed for joining thick section aluminum to steel. In FSD, mechanical interlocks are formed at the aluminum-steel interface and are reinforced by metallurgical bonds where intermetallic growth has been uniquely suppressed. Lap shear testing shows superior strength and extension at failure compared to popular friction stir approaches where metallurgical bonding is the only joining mechanism. High resolution microscopy revealed the presence of a 40-70 nm interlayer having a composition of 76.4 at% Al, 18.4 at% Fe, and 5.2 at% Si, suggestive of limited FeAl3 intermetallic formation.

  3. Cerebrospinal fluid flow waveforms: effect of altered cranial venous outflow. A phase-contrast MR flow imaging study

    International Nuclear Information System (INIS)

    Bhadelia, R.A.; Wolpert, S.M.

    1998-01-01

    Our purpose was to assess the effect of alterations in the cranial venous outflow on cerebrospinal fluid (CSF) flow waveforms using phase-contrast MRI. Thirteen healthy subjects were assessed for CSF flow and cerebral vascular flow at the C2-3 level, both before and after jugular venous compression (JVC). The flow waveforms were assessed both as an aggregate, and after dividing subjects in two groups based on percent jugular venous flow (PJVF) i. e. jugular outflow expressed as percent of cerebral arterial inflow. Group 1: 7 subjects with PJVF more than and including median (predominantly jugular outflow); Group 2: 6 subjects with PJVF less than median (predominantly extra-jugular outflow). CSF waveforms: JVC produced rounding of contours and flattening of dicrotic waves, with the effect being greater in group 1 than group 2. In group 1, systolic upslopes of the waveforms increased. No significant aggregate amplitude changes were noted; amplidutes increased in group 1 (P = 0.001), and decreased in group 2 (P = 0.03). Temporal interval to the maximum CSF systolic flow significantly increased in group 1. Vascular flow: Arterial flow significantly decreased in group 1. Jugular flow significantly decreased in both groups. The results suggest that CSF flow waveforms are sensitive to alterations in the cranial venous outflow. Changes in group 1 are most likely because of an elevation in intracranial pressure. Analysis of CSF flow waveforms appears a promising noninvasive tool for assessment of cranial compartment. (orig.)

  4. A Study of Nonlinear Elasticity Effects on Permeability of Stress Sensitive Shale Rocks Using an Improved Coupled Flow and Geomechanics Model: A Case Study of the Longmaxi Shale in China

    Directory of Open Access Journals (Sweden)

    Chenji Wei

    2018-02-01

    Full Text Available Gas transport in shale gas reservoirs is largely affected by rock properties such as permeability. These properties are often sensitive to the in-situ stress state changes. Accurate modeling of shale gas transport in shale reservoir rocks considering the stress sensitive effects on rock petrophysical properties is important for successful shale gas extraction. Nonlinear elasticity in stress sensitive reservoir rocks depicts the nonlinear stress-strain relationship, yet it is not thoroughly studied in previous reservoir modeling works. In this study, an improved coupled flow and geomechanics model that considers nonlinear elasticity is proposed. The model is based on finite element methods, and the nonlinear elasticity in the model is validated with experimental data on shale samples selected from the Longmaxi Formation in Sichuan Basin China. Numerical results indicate that, in stress sensitive shale rocks, nonlinear elasticity affects shale permeability, shale porosity, and distributions of effective stress and pore pressure. Elastic modulus change is dependent on not only in-situ stress state but also stress history path. Without considering nonlinear elasticity, the modeling of shale rock permeability in Longmaxi Formation can overestimate permeability values by 1.6 to 53 times.

  5. High sensitivity on-line monitor for radioactive effluent

    Energy Technology Data Exchange (ETDEWEB)

    Sasaki, Toshimi [Tohoku Electric Power Co. Ltd., Sendai (Japan); Ishizuka, Akira; Abe, Eisuke; Inoue, Yasuhiko; Fujii, Masaaki; Kitaguchi, Hiroshi; Doi, Akira

    1983-04-01

    A new approach for a highly sensitive effluent monitor is presented. The free flow type monitor, which consists of a straightener, nozzle, monitoring section and ..gamma..-ray detector, is demonstrated to be effective in providing long term stability. The 160 start-and-stop cycles of effluent discharge were repeated in a 120-h testing period. Results showed a background increase was not observed for the free flow type monitor. The background count rate was calibrated to the lowest detection limit to be 2.2 x 10/sup -2/ Bq/ml for a 300 s measurement time.

  6. Three-dimensional shape perception from chromatic orientation flows

    Science.gov (United States)

    Zaidi, Qasim; Li, Andrea

    2010-01-01

    The role of chromatic information in 3-D shape perception is controversial. We resolve this controversy by showing that chromatic orientation flows are sufficient for accurate perception of 3-D shape. Chromatic flows required less cone contrast to convey shape than did achromatic flows, thus ruling out luminance artifacts as a problem. Luminance artifacts were also ruled out by a protanope’s inability to see 3-D shape from chromatic flows. Since chromatic orientation flows can only be extracted from retinal images by neurons that are responsive to color modulations and selective for orientation, the psychophysical results also resolve the controversy over the existence of such neurons. In addition, we show that identification of 3-D shapes from chromatic flows can be masked by luminance modulations, indicating that it is subserved by orientation-tuned neurons sensitive to both chromatic and luminance modulations. PMID:16961963

  7. Coherence properties and quantum state transportation in an optical conveyor belt.

    Science.gov (United States)

    Kuhr, S; Alt, W; Schrader, D; Dotsenko, I; Miroshnychenko, Y; Rosenfeld, W; Khudaverdyan, M; Gomer, V; Rauschenbeutel, A; Meschede, D

    2003-11-21

    We have prepared and detected quantum coherences of trapped cesium atoms with long dephasing times. Controlled transport by an "optical conveyor belt" over macroscopic distances preserves the atomic coherence with slight reduction of coherence time. The limiting dephasing effects are experimentally identified, and we present an analytical model of the reversible and irreversible dephasing mechanisms. Our experimental methods are applicable at the single-atom level. Coherent quantum bit operations along with quantum state transport open the route towards a "quantum shift register" of individual neutral atoms.

  8. Highly sensitive heavy metal ion detection using AlQ3 microwire functionalized QCM

    Science.gov (United States)

    Can, Nursel; Aǧar, Meltem; Altındal, Ahmet

    2016-03-01

    Tris(8-hydroxyquinoline) aluminum (Alq3) microwires was successfully synthesized for the fabrication of Alq3 microwires-coated QCM sensors to detect the heavy metal ions in aqueous solution. AT-cut quartz crystal microbalance (QCM) of 10 MHz fundamental resonance frequency having gold electrodes were used as transducers. Typical measuring cycle consisted of repeated flow of target measurands through the flow cell and subsequent washing to return the baseline. The QCM results indicated that the Alq3 microwires exhibit excellent sensitivity, stability and short response-recovery time, which are much attractive for the development of portable and highly sensitive heavy metal ion sensors in water samples.

  9. Numerical simulation of flow in Brush Creek Valley, Colorado

    International Nuclear Information System (INIS)

    Leone, J.M. Jr.; Lee, R.L.

    1987-06-01

    In this paper, we present some results from our three-dimensional, non-hydrostatic, finite element model applied to simulations of flow in Brush Creek Valley. These simulations are not intended to reproduce any particular experiment, but rather are to evaluate the qualitative performance of the model, to explore the major difficulties involved, and to begin sensitivity studies of the flows of interest. 2 refs., 11 figs

  10. Flow in water-intake pump bays: A guide for utility engineers. Final report

    International Nuclear Information System (INIS)

    Ettema, R.

    1998-09-01

    This report is intended to serve as a guide for power-plant engineers facing problems with flow conditions in pump bays in water-intake structures, especially those located alongside rivers. The guide briefly introduces the typical prevailing flow field outside of a riverside water intake. That flow field often sets the inflow conditions for pump bays located within the water intake. The monograph then presents and discusses the main flow problems associated with pump bays. The problems usually revolve around the formation of troublesome vortices. A novel feature of this monograph is the use of numerical modeling to reveal diagnostically how the vortices form and their sensitivities to flow conditions, such as uniformity of approach flow entering the bay and water-surface elevation relative to pump-bell submergence. The modeling was carried out using a computer code developed specially for the present project. Pump-bay layouts are discussed next. The discussion begins with a summary of the main variables influencing bay flows. The numerical model is used to determine the sensitivities of the vortices to variations in the geometric parameters. The fixes include the use of flow-control vanes and suction scoops for ensuring satisfactory flow performance in severe flow conditions; notably flows with strong cross flow and shallow flows. The monograph ends with descriptions of modeling techniques. An extensive discussion is provided on the use of numerical model for illuminating bay flows. The model is used to show how fluid viscosity affects bay flow. The effect of fluid viscosity is an important consideration in hydraulic modeling of water intakes

  11. Dicty_cDB: AFM145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGXP Frame B: ---xxxxxxxvxxxxxxxxxx...vxxxxmvglxxixiskxnxlsxwxxd*evvxkxlskh*x vrpsllklrxqiilxmlxqrfkxkkvshqtnkd*fslvnn*kmvv...ittfkrnplsi*fsd*evvckfl*klslvkplhsklkvvttlrm*kqkfktkkvx Frame C: ---xxxxxxrfxxxxxxxixx*xixxwxxxxxxqypkxixxpx

  12. Experimental investigation of certain internal condensing and boiling flows: Their sensitivity to pressure fluctuations and heat transfer enhancements

    Science.gov (United States)

    Kivisalu, Michael Toomas

    Space-based (satellite, scientific probe, space station, etc.) and millimeter -- to -- micro-scale (such as are used in high power electronics cooling, weapons cooling in aircraft, etc.) condensers and boilers are shear/pressure driven. They are of increasing interest to system engineers for thermal management because flow boilers and flow condensers offer both high fluid flow-rate-specific heat transfer capacity and very low thermal resistance between the fluid and the heat exchange surface, so large amounts of heat may be removed using reasonably-sized devices without the need for excessive temperature differences. However, flow stability issues and degredation of performance of shear/pressure driven condensers and boilers due to non-desireable flow morphology over large portions of their lengths have mostly prevented their use in these applications. This research is part of an ongoing investigation seeking to close the gap between science and engineering by analyzing two key innovations which could help address these problems. First, it is recommended that the condenser and boiler be operated in an innovative flow configuration which provides a non-participating core vapor stream to stabilize the annular flow regime throughout the device length, accomplished in an energy-efficient manner by means of ducted vapor re-circulation. This is demonstrated experimentally.. Second, suitable pulsations applied to the vapor entering the condenser or boiler (from the re-circulating vapor stream) greatly reduce the thermal resistance of the already effective annular flow regime. For experiments reported here, application of pulsations increased time-averaged heat-flux up to 900 % at a location within the flow condenser and up to 200 % at a location within the flow boiler, measured at the heat-exchange surface. Traditional fully condensing flows, reported here for comparison purposes, show similar heat-flux enhancements due to imposed pulsations over a range of frequencies

  13. Ferredoxin-dependent and antimycin A-sensitive reduction of cytochrome b-559 by far-red light in maize [Zea mays] thylakoids; participation of a meladiol-reducible cytochrome b-559 in cyclic electron flow

    International Nuclear Information System (INIS)

    Miyake, C.; Schreiber, U.; Asada, K.

    1995-01-01

    Thylakoids from mesophyll cells of maize showed a high rate of the ferredoxin (Fd)-dependent and antimycin A (AntiA)-sensitive cyclic electron flow as determined by the quenching of 9-aminoacridine fluorescence which indicates the formation of ΔpH across the membranes. Spectrophotometric survey of the thylakoids showed the reduction of a Cyt having an α-peak at 559 nm [Cyt b-559(Fd)] by far-red light, which depended on Fd and was sensitive to AntiA. Dose dependencies of Fd and AntiA on the photoreduction of Cyt b-559(Fd) were the same as those of the formation of ΔpH. Cyt b-559(Fd) occurred in an oxidized form even in the presence of ascorbate and was reduced by far-red light. In darkness, it was reduced only by menadiol (E m,7 = –10mV). Thus, Cyt b-559(Fd) was distinguished from Cyt b-559 in the PSII complex by its low redox potential. The present results indicate that Cyt b-559(Fd) mediates electron transfer from Fd to plastoquinone during Fd-dependent cyclic electron flow around PSI. (author)

  14. Sensitivity analysis of MIDAS tests using SPACE code. Effect of nodalization

    International Nuclear Information System (INIS)

    Eom, Shin; Oh, Seung-Jong; Diab, Aya

    2018-01-01

    The nodalization sensitivity analysis for the ECCS (Emergency Core Cooling System) bypass phe�nomena was performed using the SPACE (Safety and Performance Analysis CodE) thermal hydraulic analysis computer code. The results of MIDAS (Multi-�dimensional Investigation in Downcomer Annulus Simulation) test were used. The MIDAS test was conducted by the KAERI (Korea Atomic Energy Research Institute) for the performance evaluation of the ECC (Emergency Core Cooling) bypass phenomenon in the DVI (Direct Vessel Injection) system. The main aim of this study is to examine the sensitivity of the SPACE code results to the number of thermal hydraulic channels used to model the annulus region in the MIDAS experiment. The numerical model involves three nodalization cases (4, 6, and 12 channels) and the result show that the effect of nodalization on the bypass fraction for the high steam flow rate MIDAS tests is minimal. For computational efficiency, a 4 channel representation is recommended for the SPACE code nodalization. For the low steam flow rate tests, the SPACE code over-�predicts the bypass fraction irrespective of the nodalization finesse. The over-�prediction at low steam flow may be attributed to the difficulty to accurately represent the flow regime in the vicinity of the broken cold leg.

  15. Sensitivity analysis of MIDAS tests using SPACE code. Effect of nodalization

    Energy Technology Data Exchange (ETDEWEB)

    Eom, Shin; Oh, Seung-Jong; Diab, Aya [KEPCO International Nuclear Graduate School (KINGS), Ulsan (Korea, Republic of). Dept. of NPP Engineering

    2018-02-15

    The nodalization sensitivity analysis for the ECCS (Emergency Core Cooling System) bypass phe�nomena was performed using the SPACE (Safety and Performance Analysis CodE) thermal hydraulic analysis computer code. The results of MIDAS (Multi-�dimensional Investigation in Downcomer Annulus Simulation) test were used. The MIDAS test was conducted by the KAERI (Korea Atomic Energy Research Institute) for the performance evaluation of the ECC (Emergency Core Cooling) bypass phenomenon in the DVI (Direct Vessel Injection) system. The main aim of this study is to examine the sensitivity of the SPACE code results to the number of thermal hydraulic channels used to model the annulus region in the MIDAS experiment. The numerical model involves three nodalization cases (4, 6, and 12 channels) and the result show that the effect of nodalization on the bypass fraction for the high steam flow rate MIDAS tests is minimal. For computational efficiency, a 4 channel representation is recommended for the SPACE code nodalization. For the low steam flow rate tests, the SPACE code over-�predicts the bypass fraction irrespective of the nodalization finesse. The over-�prediction at low steam flow may be attributed to the difficulty to accurately represent the flow regime in the vicinity of the broken cold leg.

  16. Orthogonality Catastrophe as a prerequisite for the irreversible decay of the global relative phase of a two-component Bose-Einstein condensate

    Science.gov (United States)

    Birman, Joseph L.; Kuklov, A. B.

    2001-05-01

    The concept of the orthogonality catastrophe (OC), which has been introduced previously for one component condensate ( A.B. Kuklov, J.L. Birman, PRA 63), 013609 (2001), is applied to the two-component condensate. The evolution of the global relative phase, which is created by the rf-pulse, is studied under the condition of no exchange of bosons between the components after the pulse. It is shown that the normal component does not induce the OC. Instead, it produces a reversible thermal dephasing, which competes with the quantum phase diffusion (QPD) effect (E.M.Wright, et al, PRL 77), 2158(1996). The thermal dephasing results from the thermal ensemble averaging, and the corresponding dephasing rate is controlled by the two-body interaction and temperature as well as by the closeness to the intrinsic su(2) symmetry, so that no dephasing exists in the case of the exact symmetry (A.B. Kuklov, J.L. Birman, PRL 85), 5488 (2000). The reversible nature of the thermal dephasing as well as of the QPD can be revealed in the atomic echo effect. The role of external noise in erasing the phase memory is discussed as well.

  17. Dicty_cDB: AFO379 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxkxxxxxxxfxxxxxvxfxxvxixxwxxxxxixixkxnxxxx...kpslvrllhsklkvlitlrmlkpksktkkvfh rinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklkvvt tlrm*kqkfktkkvs Frame B: ---xxxxxxxxx...fxxxxxxxxxxxxxsxxxxxxxfxw*xlxxgxxxxxxqyxkxxxxxxg xxixrwyxn

  18. Dicty_cDB: VFM254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (All Frames) Frame A: ---xxxxxxxxxxxxxxxxvxxxxxxxrxxxxxxxxxxxxxxxkvxxxxxkxxfxxvxnx xmvvlxxittfkrnplsi*ssd*ev...vckflskpslvrllhxklkvlitlrmlkpksktkk vfhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklk vvttlrm*kqkfktkkvshq Frame B: ---xxx...xxxxxxxxxxxxwxxxxxxsxgxxxxxxcxxxxxxxxryxxxxxxxxfxw*xix x

  19. Radiation-sensitive switching circuits

    Energy Technology Data Exchange (ETDEWEB)

    Moore, J.H.; Cockshott, C.P.

    1976-03-16

    A radiation-sensitive switching circuit includes a light emitting diode which from time to time illuminates a photo-transistor, the photo-transistor serving when its output reaches a predetermined value to operate a trigger circuit. In order to allow for aging of the components, the current flow through the diode is increased when the output from the transistor falls below a known level. Conveniently, this is achieved by having a transistor in parallel with the diode, and turning the transistor off when the output from the phototransistor becomes too low. The circuit is designed to control the ignition system in an automobile engine.

  20. DNA Antenna Tile-Associated Deoxyribozyme Sensor with Improved Sensitivity.

    Science.gov (United States)

    Cox, Amanda J; Bengtson, Hillary N; Gerasimova, Yulia V; Rohde, Kyle H; Kolpashchikov, Dmitry M

    2016-11-03

    Some natural enzymes increase the rate of diffusion-limited reactions by facilitating substrate flow to their active sites. Inspired by this natural phenomenon, we developed a strategy for efficient substrate delivery to a deoxyribozyme (DZ) catalytic sensor. This resulted in a three- to fourfold increase in sensitivity and up to a ninefold improvement in the detection limit. The reported strategy can be used to enhance catalytic efficiency of diffusion-limited enzymes and to improve sensitivity of enzyme-based biosensors. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Particle migration and sorting in microbubble streaming flows

    Science.gov (United States)

    Thameem, Raqeeb; Hilgenfeldt, Sascha

    2016-01-01

    Ultrasonic driving of semicylindrical microbubbles generates strong streaming flows that are robust over a wide range of driving frequencies. We show that in microchannels, these streaming flow patterns can be combined with Poiseuille flows to achieve two distinctive, highly tunable methods for size-sensitive sorting and trapping of particles much smaller than the bubble itself. This method allows higher throughput than typical passive sorting techniques, since it does not require the inclusion of device features on the order of the particle size. We propose a simple mechanism, based on channel and flow geometry, which reliably describes and predicts the sorting behavior observed in experiment. It is also shown that an asymptotic theory that incorporates the device geometry and superimposed channel flow accurately models key flow features such as peak speeds and particle trajectories, provided it is appropriately modified to account for 3D effects caused by the axial confinement of the bubble. PMID:26958103

  2. First status report on regional ground-water flow modeling for the Paradox Basin, Utah

    International Nuclear Information System (INIS)

    Andrews, R.W.

    1984-05-01

    Regional ground-water flow within the principal hydrogeologic units of the Paradox Basin is evaluated by developing a conceptual model of the flow regime in the shallow aquifers and the deep-basin brine aquifers and testing these models using a three-dimensional, finite-difference flow code. Semiquantitative sensitivity analysis (a limited parametric study) is conducted to define the system response to changes in hydrologic properties or boundary conditions. A direct method for sensitivity analysis using an adjoint form of the flow equation is applied to the conceptualized flow regime in the Leadville limestone aquifer. All steps leading to the final results and conclusions are incorporated in this report. The available data utilized in this study is summarized. The specific conceptual models, defining the areal and vertical averaging of litho-logic units, aquifer properties, fluid properties, and hydrologic boundary conditions, are described in detail. Two models were evaluated in this study: a regional model encompassing the hydrogeologic units above and below the Paradox Formation/Hermosa Group and a refined scale model which incorporated only the post Paradox strata. The results are delineated by the simulated potentiometric surfaces and tables summarizing areal and vertical boundary fluxes, Darcy velocities at specific points, and ground-water travel paths. Results from the adjoint sensitivity analysis include importance functions and sensitivity coefficients, using heads or the average Darcy velocities to represent system response. The reported work is the first stage of an ongoing evaluation of the Gibson Dome area within the Paradox Basin as a potential repository for high-level radioactive wastes

  3. Analytical Tools to Improve Optimization Procedures for Lateral Flow Assays

    Directory of Open Access Journals (Sweden)

    Helen V. Hsieh

    2017-05-01

    Full Text Available Immunochromatographic or lateral flow assays (LFAs are inexpensive, easy to use, point-of-care medical diagnostic tests that are found in arenas ranging from a doctor’s office in Manhattan to a rural medical clinic in low resource settings. The simplicity in the LFA itself belies the complex task of optimization required to make the test sensitive, rapid and easy to use. Currently, the manufacturers develop LFAs by empirical optimization of material components (e.g., analytical membranes, conjugate pads and sample pads, biological reagents (e.g., antibodies, blocking reagents and buffers and the design of delivery geometry. In this paper, we will review conventional optimization and then focus on the latter and outline analytical tools, such as dynamic light scattering and optical biosensors, as well as methods, such as microfluidic flow design and mechanistic models. We are applying these tools to find non-obvious optima of lateral flow assays for improved sensitivity, specificity and manufacturing robustness.

  4. Encoding of naturalistic optic flow by motion sensitive neurons of nucleus rotundus in the zebra finch (Taeniopygia guttata.

    Directory of Open Access Journals (Sweden)

    Dennis eEckmeier

    2013-09-01

    Full Text Available The retinal image changes that occur during locomotion, the optic flow, carry information about self-motion and the three-dimensional structure of the environment. Especially fast moving animals with only little binocular vision depend on these depth cues for manoeuvring. They actively control their gaze to facilitate perception of depth based on cues in the optic flow. In the visual system of birds, nucleus rotundus neurons were originally found to respond to object motion but not to background motion. However, when background and object were both moving, responses increase the more the direction and velocity of object and background motion on the retina differed. These properties may play a role in representing depth cues in the optic flow. We therefore investigated how neurons in nucleus rotundus respond to optic flow that contains depth cues. We presented simplified and naturalistic optic flow on a panoramic LED display while recording from single neurons in nucleus rotundus of anaesthetized zebra finches. Unlike most studies on motion vision in birds, our stimuli included depth information.We found extensive responses of motion selective neurons in nucleus rotundus to optic flow stimuli. Simplified stimuli revealed preferences for optic flow reflecting translational or rotational self-motion. Naturalistic optic flow stimuli elicited complex response modulations, but the presence of objects was signalled by only few neurons. The neurons that did respond to objects in the optic flow, however, show interesting properties.

  5. A New Approach for Accurate Prediction of Liquid Loading of Directional Gas Wells in Transition Flow or Turbulent Flow

    Directory of Open Access Journals (Sweden)

    Ruiqing Ming

    2017-01-01

    Full Text Available Current common models for calculating continuous liquid-carrying critical gas velocity are established based on vertical wells and laminar flow without considering the influence of deviation angle and Reynolds number on liquid-carrying. With the increase of the directional well in transition flow or turbulent flow, the current common models cannot accurately predict the critical gas velocity of these wells. So we built a new model to predict continuous liquid-carrying critical gas velocity for directional well in transition flow or turbulent flow. It is shown from sensitivity analysis that the correction coefficient is mainly influenced by Reynolds number and deviation angle. With the increase of Reynolds number, the critical liquid-carrying gas velocity increases first and then decreases. And with the increase of deviation angle, the critical liquid-carrying gas velocity gradually decreases. It is indicated from the case calculation analysis that the calculation error of this new model is less than 10%, where accuracy is much higher than those of current common models. It is demonstrated that the continuous liquid-carrying critical gas velocity of directional well in transition flow or turbulent flow can be predicted accurately by using this new model.

  6. Design and Characterization of a Novel Bio-inspired Hair Flow Sensor Based on Resonant Sensing

    Science.gov (United States)

    Guo, X.; Yang, B.; Wang, Q. H.; Lu, C. F.; Hu, D.

    2018-03-01

    Flow sensors inspired by the natural hair sensing mechanism have great prospect in the research of micro-autonomous system and technology (MAST) for the three-dimensional structure characteristics with high spatial and quality utilization. A novel bio-inspired hair flow sensor (BHFS) based on resonant sensing with a unique asymmetric design is presented in this paper. A hair transducer and a signal detector which is constituted of a two-stage micro-leverage mechanism and two symmetrical resonators (double ended tuning fork, DETF) are adopted to realize the high sensitivity to air flow. The sensitivity of the proposed BHFS is improved significantly than the published ones due to the high sensitivity of resonators and the higher amplification factor possessed by the two-stage micro-leverage mechanism. The standard deep dry silicon on glass (DDSOG) process is chosen to fabricate the proposed BHFS. The experiment result demonstrates that the fabricated BHFS has a mechanical sensitivity of 5.26 Hz/(m/s)2 at a resonant frequency of 22 kHz with the hair height of 6 mm.

  7. Microfluidic Impedance Flow Cytometry Enabling High-Throughput Single-Cell Electrical Property Characterization

    Science.gov (United States)

    Chen, Jian; Xue, Chengcheng; Zhao, Yang; Chen, Deyong; Wu, Min-Hsien; Wang, Junbo

    2015-01-01

    This article reviews recent developments in microfluidic impedance flow cytometry for high-throughput electrical property characterization of single cells. Four major perspectives of microfluidic impedance flow cytometry for single-cell characterization are included in this review: (1) early developments of microfluidic impedance flow cytometry for single-cell electrical property characterization; (2) microfluidic impedance flow cytometry with enhanced sensitivity; (3) microfluidic impedance and optical flow cytometry for single-cell analysis and (4) integrated point of care system based on microfluidic impedance flow cytometry. We examine the advantages and limitations of each technique and discuss future research opportunities from the perspectives of both technical innovation and clinical applications. PMID:25938973

  8. Assessment of salt tolerance of some newly developed and candidate wheat (triticum aestivum l.) cultivars using gas exchange and chlorophyll fluorescence attributes

    International Nuclear Information System (INIS)

    Kanwal, H.; Shahbaz, M.; Ashraf, M.

    2011-01-01

    The present study was aimed to assess salt tolerance of some newly developed and candidate cultivars of wheat using gas exchange and chlorophyll fluorescence parameters. Ten wheat cultivars including five newly developed (S-24, Saher-2006, Fsd-2008, Lasani and Inqlab-91) and five candidate (P .B-18, M.P-65, S.H-20, AARI-10 and G.A-20) were grown in sand culture. Salt stress (150 mM NaCl in Hoagland's nutrient solution) was applied at the seedling stage. A significant reduction in plant biomass production was recorded in all wheat cultivars. Cultivars S-24, Saher-2006 and Fsd-2008 showed less reduction in biomass production as compared with the other cultivars. Different gas exchange attributes such as leaf net photosynthetic rate (A), transpiration rate ( E), and stomatal conductance (gs) were also adversely affected due to salt stress and were positively associated with the plant biomass production of the genotypes under saline stress. More negative effects in relation to these gas exchange attributes were recorded in cvs. Lasani, G.A-20 and ARRI-10 than those in the other cultivars. Leaf maximum chlorophyll fluorescence (Fm), maximum fluorescence at steady state (Fms ), and photochemical fluorescence quenching (Qp) increased while maximum quantum yield (Fv/Fm), quantum yield of electron transport (Qp), electron transport rate ( ETR ) and non-photochemical quenching (Qn) decreased due to imposition of salt stress. The adverse effects of salt stress on these chlorophyll fluorescence attributes were minimum in cultivars S-24, Saher-2006 and Fsd-2008. A significant positive correlation was recorded between biomass production, different gas exchange attributes and chlorophyll fluorescence parameters. Overall, cvs. S-24, Saher-2006 and Fsd-2008 were ranked as salt tolerant on the basis of their performance in biomass production, gas exchange attributes and chlorophyll fluorescence parameters. (author)

  9. Female Sexual Dysfunction-Medical and Psychological Treatments, Committee 14.

    Science.gov (United States)

    Kingsberg, Sheryl A; Althof, Stanley; Simon, James A; Bradford, Andrea; Bitzer, Johannes; Carvalho, Joana; Flynn, Kathryn E; Nappi, Rossella E; Reese, Jennifer B; Rezaee, Roya L; Schover, Leslie; Shifrin, Jan L

    2017-12-01

    Since the millennium we have witnessed significant strides in the science and treatment of female sexual dysfunction (FSD). This forward progress has included (i) the development of new theoretical models to describe healthy and dysfunctional sexual responses in women; (ii) alternative classification strategies of female sexual disorders; (iii) major advances in brain, hormonal, psychological, and interpersonal research focusing on etiologic factors and treatment approaches; (iv) strong and effective public advocacy for FSD; and (v) greater educational awareness of the impact of FSD on the woman and her partner. To review the literature and describe the best practices for assessing and treating women with hypoactive sexual desire disorder, female sexual arousal disorder, and female orgasmic disorders. The committee undertook a comprehensive review of the literature and discussion among themselves to determine the best assessment and treatment methods. Using a biopsychosocial lens, the committee presents recommendations (with levels of evidence) for assessment and treatment of hypoactive sexual desire disorder, female sexual arousal disorder, and female orgasmic disorders. The numerous significant strides in FSD that have occurred since the previous International Consultation of Sexual Medicine publications are reviewed in this article. Although evidence supports an integrated biopsychosocial approach to assessment and treatment of these disorders, the biological and psychological factors are artificially separated for review purposes. We recognize that best outcomes are achieved when all relevant factors are identified and addressed by the clinician and patient working together in concert (the sum is greater than the whole of its parts). Kingsberg SA, Althof S, Simon JA, et al. Female Sexual Dysfunction-Medical and Psychological Treatments, Committee 14. J Sex Med 2017;14:1463-1491. Copyright © 2017 International Society for Sexual Medicine. Published by

  10. Flow rates through earthen, geomembrane ampersand composite cut-off walls

    International Nuclear Information System (INIS)

    Tachavises, C.; Benson, C.H.

    1997-01-01

    Flow rates through soil-bentonite (SIB), geomembrane (GM), and composite geomembrane-soil (CGS) cut-off walls were determined using a numerical model of ground water flow. Various geological and wall conditions were simulated. Results of the simulations show that flow rates past all wall types are affected by hydraulic conductivities of the aquifer and underlying confining layer. Flow rates past GM walls with perfect joints are very low, provided the confining layer has low hydraulic conductivity. However, if a small fraction of the joints are defective, GM walls can be ineffective in blocking flow. CGS walls with a low hydraulic conductivity shell are less sensitive to joint defects. CGS walls with good shells typically have lower flow rates than SB and GM walls, even if the CGS wall contains defective joints

  11. A congestion line flow control in deregulated power system

    Directory of Open Access Journals (Sweden)

    Venkatarajan Shanmuga Sundaram

    2011-01-01

    Full Text Available Under open access, market-driven transactions have become the new independent decision variables defining the behavior of the power system. The possibility of transmission lines getting over-loaded is relatively more under deregulated operation because different parts of the system are owned by separate companies and in part operated under varying service charges. This paper discusses a two-tier algorithm for correcting the lone overloads in conjunction with the conventional power-flow methods. The method uses line flow sensitivities, which are computed by the East Decoupled Power-flow algorithm and can be adapted for on-line implementation.

  12. Laser doppler anemometry in single- and two-phase flows

    International Nuclear Information System (INIS)

    Durst, F.

    1976-01-01

    The present report gives an introduction into laser-Doppler anemometry and tries to explain the basic physical principles of this measuring technique. Moire fringe patterns are used in order to visually model LDA-signals and to explain the basic difference in optical systems. It is pointed out that LDA measurements in highly turbulent flows and in two-phase flows should be attempted with direction sensitive instruments only. Some of the optical systems developed by the author and his collaborators are introduced and their functioning in measurements is demonstrated. These measurements embrace investigations in a number of single-phase flows including flames. (orig.) [de

  13. Optoelectronic iron detectors for pharmaceutical flow analysis.

    Science.gov (United States)

    Rybkowska, Natalia; Koncki, Robert; Strzelak, Kamil

    2017-10-25

    Compact flow-through optoelectronic detectors fabricated by pairing of light emitting diodes have been applied for development of economic flow analysis systems dedicated for iron ions determination. Three analytical methods with different chromogens selectively recognizing iron ions have been compared. Ferrozine and ferene S based methods offer higher sensitivity and slightly lower detection limits than method with 1,10-phenantroline, but narrower ranges of linear response. Each system allows detection of iron in micromolar range of concentration with comparable sample throughput (20 injections per hour). The developed flow analysis systems have been successfully applied for determination of iron in diet supplements. The utility of developed analytical systems for iron release studies from drug formulations has also been demonstrated. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Efeito da temperatura de extrusão e do teor de proteina da farinha de soja desengordurada na qualidade do macarrão instantaneo de arroz

    OpenAIRE

    Atilio Enrique Liceti Dibos

    1993-01-01

    Resumo: O efeito da temperatura de extrusão e do teor de proteína da farinha de soja desengordurada (FSD) na qualidade tecnologica e nutricional do macarrão instantâneo de arroz foi estudado. Farinha de arroz foi misturada com vários níveis de FSD para se obterem teores de proteína de 15, 20 e 25%. A matéria-prima com os diversos níveis de proteína foi processada num extrusor de rosca única às temperaturas de 80, 100 e 120°C. O macarrão foi submetido aos vários testes tecnológicos para avalia...

  15. Sensitivity analysis of machine-learning models of hydrologic time series

    Science.gov (United States)

    O'Reilly, A. M.

    2017-12-01

    Sensitivity analysis traditionally has been applied to assessing model response to perturbations in model parameters, where the parameters are those model input variables adjusted during calibration. Unlike physics-based models where parameters represent real phenomena, the equivalent of parameters for machine-learning models are simply mathematical "knobs" that are automatically adjusted during training/testing/verification procedures. Thus the challenge of extracting knowledge of hydrologic system functionality from machine-learning models lies in their very nature, leading to the label "black box." Sensitivity analysis of the forcing-response behavior of machine-learning models, however, can provide understanding of how the physical phenomena represented by model inputs affect the physical phenomena represented by model outputs.As part of a previous study, hybrid spectral-decomposition artificial neural network (ANN) models were developed to simulate the observed behavior of hydrologic response contained in multidecadal datasets of lake water level, groundwater level, and spring flow. Model inputs used moving window averages (MWA) to represent various frequencies and frequency-band components of time series of rainfall and groundwater use. Using these forcing time series, the MWA-ANN models were trained to predict time series of lake water level, groundwater level, and spring flow at 51 sites in central Florida, USA. A time series of sensitivities for each MWA-ANN model was produced by perturbing forcing time-series and computing the change in response time-series per unit change in perturbation. Variations in forcing-response sensitivities are evident between types (lake, groundwater level, or spring), spatially (among sites of the same type), and temporally. Two generally common characteristics among sites are more uniform sensitivities to rainfall over time and notable increases in sensitivities to groundwater usage during significant drought periods.

  16. Unsteady Simulations of the Flow in a Channel Flow and a Ventilated Room Using the SST-SAS Model

    DEFF Research Database (Denmark)

    Davidson, Lars; Nielsen, Peter V.

    The SAS model (Scale Adapted Simulation) was invented by Menter and his co-workers. The idea behind the SST-SAS model is to add an additional production term - the SAS term - in the w equation which is sensitive to resolved (i.e. unsteady) fluctuations. In regions where the flow is on the limit...

  17. Modeling sediment concentration of rill flow

    Science.gov (United States)

    Yang, Daming; Gao, Peiling; Zhao, Yadong; Zhang, Yuhang; Liu, Xiaoyuan; Zhang, Qingwen

    2018-06-01

    Accurate estimation of sediment concentration is essential to establish physically-based erosion models. The objectives of this study were to evaluate the effects of flow discharge (Q), slope gradient (S), flow velocity (V), shear stress (τ), stream power (ω) and unit stream power (U) on sediment concentration. Laboratory experiments were conducted using a 10 × 0.1 m rill flume under four flow discharges (2, 4, 8 and 16 L min-1), and five slope gradients (5°, 10°, 15°, 20° and 25°). The results showed that the measured sediment concentration varied from 87.08 to 620.80 kg m-3 with a mean value of 343.13 kg m-3. Sediment concentration increased as a power function with flow discharge and slope gradient, with R2 = 0.975 and NSE = 0.945. The sediment concentration was more sensitive to slope gradient than to flow discharge. The sediment concentration was well predicted by unit stream power (R2 = 0.937, NSE = 0.865), whereas less satisfactorily by flow velocity (R2 = 0.470, NSE = 0.539) and stream power (R2 = 0.773, NSE = 0.732). In addition, using the equations to simulate the measured sediment concentration of other studies, the result further indicated that slope gradient, flow discharge and unit stream power were good predictors of sediment concentration. In general, slope gradient, flow discharge and unit stream power seem to be the preferred predictors for estimating sediment concentration.

  18. Critical slowing down and the gradient flow coupling in the Schroedinger functional

    Energy Technology Data Exchange (ETDEWEB)

    Fritzsch, Patrick; Stollenwerk, Felix [Humboldt-Universitaet, Berlin (Germany). Inst. fuer Physik; Ramos, Alberto [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC

    2013-11-15

    We study the sensitivity of the gradient flow coupling to sectors of different topological charge and its implications in practical situations. Furthermore, we investigate an alternative definition of the running coupling that is expected to be less sensitive to the problems of the HMC algorithm to efficiently sample all topological sectors.

  19. Critical slowing down and the gradient flow coupling in the Schroedinger functional

    International Nuclear Information System (INIS)

    Fritzsch, Patrick; Stollenwerk, Felix; Ramos, Alberto

    2013-11-01

    We study the sensitivity of the gradient flow coupling to sectors of different topological charge and its implications in practical situations. Furthermore, we investigate an alternative definition of the running coupling that is expected to be less sensitive to the problems of the HMC algorithm to efficiently sample all topological sectors.

  20. Review of photoacoustic flow imaging: its current state and its promises.

    Science.gov (United States)

    van den Berg, P J; Daoudi, K; Steenbergen, W

    2015-09-01

    Flow imaging is an important method for quantification in many medical imaging modalities, with applications ranging from estimating wall shear rate to detecting angiogenesis. Modalities like ultrasound and optical coherence tomography both offer flow imaging capabilities, but suffer from low contrast to red blood cells and are sensitive to clutter artefacts. Photoacoustic imaging (PAI) is a relatively new field, with a recent interest in flow imaging. The recent enthusiasm for PA flow imaging is due to its intrinsic contrast to haemoglobin, which offers a new spin on existing methods of flow imaging, and some unique approaches in addition. This review article will delve into the research on photoacoustic flow imaging, explain the principles behind the many techniques and comment on their individual advantages and disadvantages.

  1. Sensitivity Analysis of Flow and Temperature Distributions of Density Currents in a River-Reservoir System under Upstream Releases with Different Durations

    Directory of Open Access Journals (Sweden)

    Gang Chen

    2015-11-01

    Full Text Available A calibrated three-dimensional Environmental Fluid Dynamics Code model was applied to simulate unsteady flow patterns and temperature distributions in the Bankhead river-reservoir system in Alabama, USA. A series of sensitivity model runs were performed under daily repeated large releases (DRLRs with different durations (2, 4 and 6 h from Smith Dam Tailrace (SDT when other model input variables were kept unchanged. The density currents in the river-reservoir system form at different reaches, are destroyed at upstream locations due to the flow momentum of the releases, and form again due to solar heating. DRLRs (140 m3/s with longer durations push the bottom cold water further downstream and maintain a cooler bottom water temperature. For the 6-h DRLR, the momentum effect definitely reaches Cordova (~43.7 km from SDT. Positive bottom velocity (density currents moving downstream is achieved 48.4%, 69.0% and 91.1% of the time with an average velocity of 0.017, 0.042 and 0.053 m/s at Cordova for the 2-h, 4-h and 6-h DRLR, respectively. Results show that DRLRs lasting for at least 4 h maintain lower water temperatures at Cordova. When the 4-h and 6-h DRLRs repeat for more than 6 and 10 days, respectively, bottom temperatures at Cordova become lower than those for the constant small release (2.83 m3/s. These large releases overwhelm the mixing effects due to inflow momentum and maintain temperature stratification at Cordova.

  2. Direct comparison of flow-FISH and qPCR as diagnostic tests for telomere length measurement in humans.

    Directory of Open Access Journals (Sweden)

    Fernanda Gutierrez-Rodrigues

    Full Text Available Telomere length measurement is an essential test for the diagnosis of telomeropathies, which are caused by excessive telomere erosion. Commonly used methods are terminal restriction fragment (TRF analysis by Southern blot, fluorescence in situ hybridization coupled with flow cytometry (flow-FISH, and quantitative PCR (qPCR. Although these methods have been used in the clinic, they have not been comprehensively compared. Here, we directly compared the performance of flow-FISH and qPCR to measure leukocytes' telomere length of healthy individuals and patients evaluated for telomeropathies, using TRF as standard. TRF and flow-FISH showed good agreement and correlation in the analysis of healthy subjects (R(2 = 0.60; p<0.0001 and patients (R(2 = 0.51; p<0.0001. In contrast, the comparison between TRF and qPCR yielded modest correlation for the analysis of samples of healthy individuals (R(2 = 0.35; p<0.0001 and low correlation for patients (R(2 = 0.20; p = 0.001; Bland-Altman analysis showed poor agreement between the two methods for both patients and controls. Quantitative PCR and flow-FISH modestly correlated in the analysis of healthy individuals (R(2 = 0.33; p<0.0001 and did not correlate in the comparison of patients' samples (R(2 = 0.1, p = 0.08. Intra-assay coefficient of variation (CV was similar for flow-FISH (10.8 ± 7.1% and qPCR (9.5 ± 7.4%; p = 0.35, but the inter-assay CV was lower for flow-FISH (9.6 ± 7.6% vs. 16 ± 19.5%; p = 0.02. Bland-Altman analysis indicated that flow-FISH was more precise and reproducible than qPCR. Flow-FISH and qPCR were sensitive (both 100% and specific (93% and 89%, respectively to distinguish very short telomeres. However, qPCR sensitivity (40% and specificity (63% to detect telomeres below the tenth percentile were lower compared to flow-FISH (80% sensitivity and 85% specificity. In the clinical setting, flow-FISH was more accurate, reproducible, sensitive, and specific in the measurement of human

  3. Cost-effective flow injection amperometric system with metal nanoparticle loaded carbon nanotube modified screen printed carbon electrode for sensitive determination of hydrogen peroxide.

    Science.gov (United States)

    Reanpang, Preeyaporn; Themsirimongkon, Suwaphid; Saipanya, Surin; Chailapakul, Orawon; Jakmunee, Jaroon

    2015-11-01

    Various metal nanoparticles (NPs) decorated on carbon nanotube (CNT) was modified on the home-made screen printed carbon electrode (SPCE) in order to enhances sensitivity of hydrogen peroxide (H2O2) determination. The simple casting method was used for the electrode modification. The monometallic and bimetallic NPs modified electrodes were investigated for their electrochemical properties for H2O2 reduction. The Pd-CNT/SPCE is appropriated to measure the H2O2 reduction at a potential of -0.3 V, then this modified electrode was incorporated with a home-made flow through cell and applied in a simple flow injection amperometry (FI-Amp). Some parameters influencing the resulted modified electrode and the FI-Amp system were studied. The proposed detection system was able to detect H2O2 in the range of 0.1-1.0 mM, with detection limit of 20 µM. Relative standard deviation for 100 replicated injections of 0.6 mM H2O2 was 2.3%. The reproducibility of 6 electrodes preparing in 3 different lots was 8.2%. It was demonstrated for determination of H2O2 in disinfectant, hair colorant and milk samples. Recoveries in the range of 90-109% were observed. The developed system provided high stability, good repeatability, high sample throughput and low reagent consumption. Copyright © 2015 Elsevier B.V. All rights reserved.

  4. Transitional grain-size-sensitive flow of milky quartz aggregates

    Science.gov (United States)

    Fukuda, J. I.; Holyoke, C. W., III; Kronenberg, A. K.

    2014-12-01

    Fine-grained (~15 μm) milky quartz aggregates exhibit reversible flow strengths in triaxial compression experiments conducted at T = 800-900oC, Pc = 1.5 GPa when strain rates are sequentially decreased (typically from 10-3.5 to 10-4.5 and 10-5.5 s-1), and then returned to the original rate (10-3.5 s-1), while samples that experience grain growth at 1000oC (to 35 μm) over the same sequence of strain rates exhibit an irreversible increase in strength. Polycrystalline quartz aggregates have been synthesized from natural milky quartz powders (ground to 5 μm) by HIP methods at T = 1000oC, Pc = 1.5 GPa and t = 24 hours, resulting in dense, fine-grained aggregates of uniform water content of ~4000 ppm (H/106Si), as indicated by a broad OH absorption band at 3400 cm-1. In experiments performed at 800o and 900oC, grain sizes of the samples are essentially constant over the duration of each experiment, though grain shapes change significantly, and undulatory extinction and deformation lamellae indicate that much of the sample shortening (to 50%) is accomplished, over the four strain-rate steps, by dislocation creep. Differential stresses measured at T = 800oC decrease from 160 to 30 MPa as strain rate is reduced from 10-4.6 to 10-5.5 s-1, and a stress of 140 MPa is measured when strain rate is returned to 10-4.5 s-1. Samples deformed at 1000o and 1100oC experience normal grain growth, with grain boundary energy-driven grain-coarsening textures superposed by undulatory extinction and deformation lamellae. Differential stresses measured at 1000oC and strain rates of 10-3.6, 10-4.6, and 10-5.5 s-1 are 185, 80, and 80 MPa, respectively, while an increased flow stress of 260 MPa is measured (following ~28 hours of prior high temperature deformation and grain growth) when strain rate is returned to 10-3.6 s-1. While all samples exhibit lattice preferred orientations, the stress exponent n inferred for the fine-grained 800oC sample is 1.5 and the stress exponent of the coarse

  5. Groundwater flow cycling between a submarine spring and an inland fresh water spring.

    Science.gov (United States)

    Davis, J Hal; Verdi, Richard

    2014-01-01

    Spring Creek Springs and Wakulla Springs are large first magnitude springs that derive water from the Upper Floridan Aquifer. The submarine Spring Creek Springs are located in a marine estuary and Wakulla Springs are located 18 km inland. Wakulla Springs has had a consistent increase in flow from the 1930s to the present. This increase is probably due to the rising sea level, which puts additional pressure head on the submarine Spring Creek Springs, reducing its fresh water flow and increasing flows in Wakulla Springs. To improve understanding of the complex relations between these springs, flow and salinity data were collected from June 25, 2007 to June 30, 2010. The flow in Spring Creek Springs was most sensitive to rainfall and salt water intrusion, and the flow in Wakulla Springs was most sensitive to rainfall and the flow in Spring Creek Springs. Flows from the springs were found to be connected, and composed of three repeating phases in a karst spring flow cycle: Phase 1 occurred during low rainfall periods and was characterized by salt water backflow into the Spring Creek Springs caves. The higher density salt water blocked fresh water flow and resulted in a higher equivalent fresh water head in Spring Creek Springs than in Wakulla Springs. The blocked fresh water was diverted to Wakulla Springs, approximately doubling its flow. Phase 2 occurred when heavy rainfall resulted in temporarily high creek flows to nearby sinkholes that purged the salt water from the Spring Creek Springs caves. Phase 3 occurred after streams returned to base flow. The Spring Creek Springs caves retained a lower equivalent fresh water head than Wakulla Springs, causing them to flow large amounts of fresh water while Wakulla Springs flow was reduced by about half. Published 2013. This article is a U.S. Government work and is in the public domain in the USA.

  6. Prevalence and risk factors for female sexual dysfunction among Egyptian women.

    Science.gov (United States)

    Ibrahim, Zakia Mahdy; Ahmed, Magdy Refaat; Sayed Ahmed, Waleed Ali

    2013-06-01

    To assess sexual function among married women and determine associated risk factors for sexual dysfunction. Cross-sectional hospital-based study involving 509 non-pregnant married females 20-59 years old who were enrolled into the study after approval of the ethics committee. The study population was recruited among women attending gynecology outpatient clinic or their relatives visiting inpatients of obstetrics and gynecology department at Suez Canal University Hospital. Female and male partner-related data were collected using an interview questionnaire. Sexual dysfunction was assessed using female sexual function index (FSFI). Mean female age was 39.5 years. About half of the participants were premenopausal (48.7 %). Most of the females were circumcised (71.7 %). Desire and Orgasm domains were the most affected with 52.8 % of the participants having sexual dysfunction. Total FSFI score of ≤26.55 was the cutoff value for diagnosis of FSD and female age, postmenopausal status, duration of marriage, circumcision, partner's age, and the presence of male sexual dysfunction were found to be significant associated factors with FSD. FSD is highly prevalent in Egypt and orgasm and desire scores were the most affected domains. Several personal (female age, postmenopausal status, duration of marriage and circumcision) and male partner (age, and the presence of sexual dysfunction) factors were significantly associated.

  7. Sensitivity analysis using two-dimensional models of the Whiteshell geosphere

    Energy Technology Data Exchange (ETDEWEB)

    Scheier, N. W.; Chan, T.; Stanchell, F. W.

    1992-12-01

    As part of the assessment of the environmental impact of disposing of immobilized nuclear fuel waste in a vault deep within plutonic rock, detailed modelling of groundwater flow, heat transport and containment transport through the geosphere is being performed using the MOTIF finite-element computer code. The first geosphere model is being developed using data from the Whiteshell Research Area, with a hypothetical disposal vault at a depth of 500 m. This report briefly describes the conceptual model and then describes in detail the two-dimensional simulations used to help initially define an adequate three-dimensional representation, select a suitable form for the simplified model to be used in the overall systems assessment with the SYVAC computer code, and perform some sensitivity analysis. The sensitivity analysis considers variations in the rock layer properties, variations in fracture zone configurations, the impact of grouting a vault/fracture zone intersection, and variations in boundary conditions. This study shows that the configuration of major fracture zones can have a major influence on groundwater flow patterns. The flows in the major fracture zones can have high velocities and large volumes. The proximity of the radionuclide source to a major fracture zone may strongly influence the time it takes for a radionuclide to be transported to the surface. (auth)

  8. Sensitivity of intermittent streams to climate variations in the USA

    Science.gov (United States)

    Eng, Kenny; Wolock, David M.; Dettinger, Mike

    2015-01-01

    There is a great deal of interest in the literature on streamflow changes caused by climate change because of the potential negative effects on aquatic biota and water supplies. Most previous studies have primarily focused on perennial streams, and there have been only a few studies examining the effect of climate variability on intermittent streams. Our objectives in this study were to (1) identify regions of similar zero-flow behavior, and (2) evaluate the sensitivity of intermittent streams to historical variability in climate in the United States. This study was carried out at 265 intermittent streams by evaluating: (1) correlations among time series of flow metrics (number of zero-flow events, the average of the central 50% and largest 10% of flows) with climate (magnitudes, durations and intensity), and (2) decadal changes in the seasonality and long-term trends of these flow metrics. Results identified five distinct seasonality patterns in the zero-flow events. In addition, strong associations between the low-flow metrics and historical changes in climate were found. The decadal analysis suggested no significant seasonal shifts or decade-to-decade trends in the low-flow metrics. The lack of trends or changes in seasonality is likely due to unchanged long-term patterns in precipitation over the time period examined.

  9. Flow cytometric characterization of cerebrospinal fluid cells.

    Science.gov (United States)

    de Graaf, Marieke T; de Jongste, Arjen H C; Kraan, Jaco; Boonstra, Joke G; Sillevis Smitt, Peter A E; Gratama, Jan W

    2011-09-01

    Flow cytometry facilitates the detection of a large spectrum of cellular characteristics on a per cell basis, determination of absolute cell numbers and detection of rare events with high sensitivity and specificity. White blood cell (WBC) counts in cerebrospinal fluid (CSF) are important for the diagnosis of many neurological disorders. WBC counting and differential can be performed by microscopy, hematology analyzers, or flow cytometry. Flow cytometry of CSF is increasingly being considered as the method of choice in patients suspected of leptomeningeal localization of hematological malignancies. Additionally, in several neuroinflammatory diseases such as multiple sclerosis and paraneoplastic neurological syndromes, flow cytometry is commonly performed to obtain insight into the immunopathogenesis of these diseases. Technically, the low cellularity of CSF samples, combined with the rapidly declining WBC viability, makes CSF flow cytometry challenging. Comparison of flow cytometry with microscopic and molecular techniques shows that each technique has its own advantages and is ideally combined. We expect that increasing the number of flow cytometric parameters that can be simultaneously studied within one sample, will further refine the information on CSF cell subsets in low-cellular CSF samples and enable to define cell populations more accurately. Copyright © 2011 International Clinical Cytometry Society.

  10. CFD simulations of flow erosion and flow-induced deformation of needle valve: Effects of operation, structure and fluid parameters

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Hongjun, E-mail: ticky863@126.com [State Key Laboratory of Oil and Gas Reservoir Geology and Exploitation, Southwest Petroleum University, Chengdu 610500, Sichuan (China); State Key Laboratory of Hydraulics and Mountain River Engineering, Sichuan University, Chengdu 610065, Sichuan (China); Pan, Qian; Zhang, Wenli; Feng, Guang; Li, Xue [State Key Laboratory of Oil and Gas Reservoir Geology and Exploitation, Southwest Petroleum University, Chengdu 610500, Sichuan (China)

    2014-07-01

    Highlights: • A combined FSI–CFD and DPM computational method is used to investigate flow erosion and deformation of needle valve. • The numerical model is validated with the comparison of measured and predicted erosion rate. • Effects of operation, structure and fluid parameters on flow erosion and flow-induced deformation are discussed. • Particle diameter has the most significant effect on flow erosion. • Inlet rate has the most obvious effect on flow-induced deformation. - Abstract: A three-dimensional fluid–structure interaction (FSI) computational model coupling with a combined continuum and discrete model has been used to predict the flow erosion rate and flow-induced deformation of needle valve. Comparisons with measured data demonstrate good agreement with the predictions of erosion rate. The flow field distribution of gas-particle flow and the erosion rate and deformation of valve core are captured under different operating and structural conditions with different fluid parameters. The effects of inlet velocity, valve opening and inlet valve channel size, particle concentration, particle diameter and particle phase components are discussed in detail. The results indicate that valve tip has the most severe erosion and deformation, and flow field, erosion rate and deformation of valve are all sensitive to inlet condition changes, structural changes and fluid properties changes. The effect of particle diameter on erosion is the most significant, while the influence of inlet rate on deformation is the greatest one.

  11. Collective flow of pions in relativistic heavy-ion collisions

    International Nuclear Information System (INIS)

    Russkikh, V.N.; Ivanov, Yu.B.

    1995-02-01

    The transverse-momentum distributions of pions in the Au(1 GeV/nucleon)+Au collisions are analyzed. The calculations are carried out within relativistic meanfield one- and two-fluid models. The rapidity distributions of the mean transverse momentum of pions are found to be fairly sensitive to the nuclear equation of state and, especially, to the stopping power. It is shown that the collective flow of pions in the reaction plane always correlates with the 'hot' flow of nucleons (i.e. those emitted from hot regions of nuclear system), while not always, with the total nucleon flow. This 'hot' nucleon flow can be experimentally singled out by selecting nucleons with sufficiently high transverse momenta. We predict that the 'hot' nucleon flow selected in this way will always correlate with the pion flow. Available experimental data on transverse-momentum spectra of pions are compared with calculations employing various equations of state and stopping power. (orig.)

  12. High sensitivity, high surface area Enzyme-linked Immunosorbent Assay (ELISA).

    Science.gov (United States)

    Singh, Harpal; Morita, Takahiro; Suzuki, Yuma; Shimojima, Masayuki; Le Van, An; Sugamata, Masami; Yang, Ming

    2015-01-01

    Enzyme-linked immunosorbent assays (ELISA) are considered the gold standard in the demonstration of various immunological reactions with an application in the detection of infectious diseases such as during outbreaks or in patient care. This study aimed to produce an ELISA-based diagnostic with an increased sensitivity of detection compared to the standard 96-well method in the immunologic diagnosis of infectious diseases. A '3DStack' was developed using readily available, low cost fabrication technologies namely nanoimprinting and press stamping with an increased surface area of 4 to 6 times more compared to 96-well plates. This was achieved by stacking multiple nanoimprinted polymer sheets. The flow of analytes between the sheets was enhanced by rotating the 3DStack and confirmed by Finite-Element (FE) simulation. An Immunoglobulin G (IgG) ELISA for the detection of antibodies in human serum raised against Rubella virus was performed for validation. An improved sensitivity of up to 1.9 folds higher was observed using the 3DStack compared to the standard method. The increased surface area of the 3DStack developed using nanoimprinting and press stamping technologies, and the flow pattern between sheets generated by rotating the 3DStack were potential contributors to a more sensitive ELISA-based diagnostic device.

  13. Nanoparticle separation with a miniaturized asymmetrical flow field-flow fractionation cartridge

    Science.gov (United States)

    Müller, David; Cattaneo, Stefano; Meier, Florian; Welz, Roland; deMello, Andrew

    2015-07-01

    Asymmetrical Flow Field-Flow Fractionation (AF4) is a separation technique applicable to particles over a wide size range. Despite the many advantages of AF4, its adoption in routine particle analysis is somewhat limited by the large footprint of currently available separation cartridges, extended analysis times and significant solvent consumption. To address these issues, we describe the fabrication and characterization of miniaturized AF4 cartridges. Key features of the scale-down platform include simplified cartridge and reagent handling, reduced analysis costs and higher throughput capacities. The separation performance of the miniaturized cartridge is assessed using certified gold and silver nanoparticle standards. Analysis of gold nanoparticle populations indicates shorter analysis times and increased sensitivity compared to conventional AF4 separation schemes. Moreover, nanoparticulate titanium dioxide populations exhibiting broad size distributions are analyzed in a rapid and efficient manner. Finally, the repeatability and reproducibility of the miniaturized platform are investigated with respect to analysis time and separation efficiency.

  14. Modeling the radical chemistry in an oxidation flow reactor: radical formation and recycling, sensitivities, and the OH exposure estimation equation.

    Science.gov (United States)

    Li, Rui; Palm, Brett B; Ortega, Amber M; Hlywiak, James; Hu, Weiwei; Peng, Zhe; Day, Douglas A; Knote, Christoph; Brune, William H; de Gouw, Joost A; Jimenez, Jose L

    2015-05-14

    Oxidation flow reactors (OFRs) containing low-pressure mercury (Hg) lamps that emit UV light at both 185 and 254 nm ("OFR185") to generate OH radicals and O3 are used in many areas of atmospheric science and in pollution control devices. The widely used potential aerosol mass (PAM) OFR was designed for studies on the formation and oxidation of secondary organic aerosols (SOA), allowing for a wide range of oxidant exposures and short experiment duration with reduced wall loss effects. Although fundamental photochemical and kinetic data applicable to these reactors are available, the radical chemistry and its sensitivities have not been modeled in detail before; thus, experimental verification of our understanding of this chemistry has been very limited. To better understand the chemistry in the OFR185, a model has been developed to simulate the formation, recycling, and destruction of radicals and to allow the quantification of OH exposure (OHexp) in the reactor and its sensitivities. The model outputs of OHexp were evaluated against laboratory calibration experiments by estimating OHexp from trace gas removal and were shown to agree within a factor of 2. A sensitivity study was performed to characterize the dependence of the OHexp, HO2/OH ratio, and O3 and H2O2 output concentrations on reactor parameters. OHexp is strongly affected by the UV photon flux, absolute humidity, reactor residence time, and the OH reactivity (OHR) of the sampled air, and more weakly by pressure and temperature. OHexp can be strongly suppressed by high OHR, especially under low UV light conditions. A OHexp estimation equation as a function of easily measurable quantities was shown to reproduce model results within 10% (average absolute value of the relative errors) over the whole operating range of the reactor. OHexp from the estimation equation was compared with measurements in several field campaigns and shows agreement within a factor of 3. The improved understanding of the OFR185 and

  15. Recurrence network analysis of experimental signals from bubbly oil-in-water flows

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Zhong-Ke; Zhang, Xin-Wang; Du, Meng [School of Electrical Engineering and Automation, Tianjin University, Tianjin 300072 (China); Jin, Ning-De, E-mail: ndjin@tju.edu.cn [School of Electrical Engineering and Automation, Tianjin University, Tianjin 300072 (China)

    2013-02-04

    Based on the signals from oil–water two-phase flow experiment, we construct and analyze recurrence networks to characterize the dynamic behavior of different flow patterns. We first take a chaotic time series as an example to demonstrate that the local property of recurrence network allows characterizing chaotic dynamics. Then we construct recurrence networks for different oil-in-water flow patterns and investigate the local property of each constructed network, respectively. The results indicate that the local topological statistic of recurrence network is very sensitive to the transitions of flow patterns and allows uncovering the dynamic flow behavior associated with chaotic unstable periodic orbits.

  16. Recurrence network analysis of experimental signals from bubbly oil-in-water flows

    International Nuclear Information System (INIS)

    Gao, Zhong-Ke; Zhang, Xin-Wang; Du, Meng; Jin, Ning-De

    2013-01-01

    Based on the signals from oil–water two-phase flow experiment, we construct and analyze recurrence networks to characterize the dynamic behavior of different flow patterns. We first take a chaotic time series as an example to demonstrate that the local property of recurrence network allows characterizing chaotic dynamics. Then we construct recurrence networks for different oil-in-water flow patterns and investigate the local property of each constructed network, respectively. The results indicate that the local topological statistic of recurrence network is very sensitive to the transitions of flow patterns and allows uncovering the dynamic flow behavior associated with chaotic unstable periodic orbits.

  17. Study in flow rig by using radiotracer

    International Nuclear Information System (INIS)

    Widatalla, R. K.

    2012-06-01

    Application of radioisotope technology have proved itself to be effective techniques for troubleshooting and optimizing industrial process in petrochemical industry In this study gamma scanning technique has been employed for better understanding of malfunctions by using the flow rig system. The scanning were carried out using 9 9mT C gamma radiation source with activity of 1 mCi and quantity of 5 ml to measure the flow rate for the water flow rig The experiment was repeated by reducing the data interval time to get more precise result. The investigations were also carried out using 5 ml of 9 9mT C with activity of 0.3 mCi for measuring the Residence Time Distribution (RTD) inside the flow rig tank which enables calculating the effective volume for the operating tank and its dead volume. The results proved that the technique is sensitive, reliable and can be adopted to investigate industrial reactors. (Author)

  18. Techno-Economic Modeling and Analysis of Redox Flow Battery Systems

    Directory of Open Access Journals (Sweden)

    Jens Noack

    2016-08-01

    Full Text Available A techno-economic model was developed to investigate the influence of components on the system costs of redox flow batteries. Sensitivity analyses were carried out based on an example of a 10 kW/120 kWh vanadium redox flow battery system, and the costs of the individual components were analyzed. Particular consideration was given to the influence of the material costs and resistances of bipolar plates and energy storage media as well as voltages and electric currents. Based on the developed model, it was possible to formulate statements about the targeted optimization of a developed non-commercial vanadium redox flow battery system and general aspects for future developments of redox flow batteries.

  19. Sensitive determination of perphenazine in pharmaceuticals and human serum by flow injection chemiluminescence method using [Ru(phen)3]2+-Ce(IV) system and a chemometrical optimization approach

    International Nuclear Information System (INIS)

    Rezaei, B.; Mokhtari, A.

    2011-01-01

    This paper describes a simple, rapid and sensitive chemiluminescence (CL) method for the determination of perphenazine by flow injection system. All variables that can affect the CL response were optimized by employing central composite design (CCD) for the experimental design and response surface methodology for the modeling. Optimization by means of CCD method with respect to conventional single factor at a time method showed a significant improvement in the sensitivity. Under the optimum experimental conditions, a wide linear relationship between analyte concentration and peak height was obtained within the range 1.2-1,300 ng mL -1 with correlation coefficient of 0.9978. The limit of detection was 0.4 ng mL -1 (S/N = 3) and the relative standard deviation for 6 repeated measurements of a solution containing 70.5 ng mL -1 was lower than 4%. This method was successfully applied for the quantification of perphenazine in pharmaceutical formulations and human serum with good recoveries (95.3-104.0%). Sample throughput was 100 +- 5 samples per hour. (author)

  20. Inversion of collective matter flow and equation of state

    International Nuclear Information System (INIS)

    Peter, J.

    1992-03-01

    The multidetector array Mur + Tonneau has been used to perform a 4π detection of charged particles and fragments emitted in reactions at energies ranging from 25 to 95 MeV/u. The collective transverse momentum in the reaction plane (sidewards flow parameter) is observed to strongly vary as a function of impact parameter and incident energy. The measured values have to be corrected for the effects due to the error on the reaction plane determination and to the detector limitations. Those limitations caused by the method itself are more important than those caused by the detector. The flow value changes from negative values (negative scattering at low energies). The inversion (or balance) energy is in the range 50-100 MeV/u, depending on the system and impact parameter value. Comparisons between experimental data and theoretical values are shown for the system 40 Ar + 27 Al. These studies (BUU, Landau-Vlasov, QMD) show that the flow, and especially the inversion energy, is sensitive to the nucleon-nucleon cross section σNN in medium. The data indicate that a momentum dependent effective interaction should be used. Then, the flow value is not much sensitive to the incompressibility modulus K, but possibly in peripheral collisions. Additional observables should be used. The azimuthal distribution of mid-rapidity particles indicates a rotation-like behaviour of the interaction region

  1. Ultrasound Vector Flow Imaging: Part II: Parallel Systems

    DEFF Research Database (Denmark)

    Jensen, Jørgen Arendt; Nikolov, Svetoslav Ivanov; Yu, Alfred C. H.

    2016-01-01

    The paper gives a review of the current state-of-theart in ultrasound parallel acquisition systems for flow imaging using spherical and plane waves emissions. The imaging methods are explained along with the advantages of using these very fast and sensitive velocity estimators. These experimental...... ultrasound imaging for studying brain function in animals. The paper explains the underlying acquisition and estimation methods for fast 2-D and 3-D velocity imaging and gives a number of examples. Future challenges and the potentials of parallel acquisition systems for flow imaging are also discussed....

  2. Flow cytometric fingerprinting for microbial strain discrimination and physiological characterization.

    Science.gov (United States)

    Buysschaert, Benjamin; Kerckhof, Frederiek-Maarten; Vandamme, Peter; De Baets, Bernard; Boon, Nico

    2018-02-01

    The analysis of microbial populations is fundamental, not only for developing a deeper understanding of microbial communities but also for their engineering in biotechnological applications. Many methods have been developed to study their characteristics and over the last few decades, molecular analysis tools, such as DNA sequencing, have been used with considerable success to identify the composition of microbial populations. Recently, flow cytometric fingerprinting is emerging as a promising and powerful method to analyze bacterial populations. So far, these methods have primarily been used to observe shifts in the composition of microbial communities of natural samples. In this article, we apply a flow cytometric fingerprinting method to discriminate among 29 Lactobacillus strains. Our results indicate that it is possible to discriminate among 27 Lactobacillus strains by staining with SYBR green I and that the discriminatory power can be increased by combined SYBR green I and propidium iodide staining. Furthermore, we illustrate the impact of physiological changes on the fingerprinting method by demonstrating how flow cytometric fingerprinting is able to discriminate the different growth phases of a microbial culture. The sensitivity of the method is assessed by its ability to detect changes in the relative abundance of a mix of polystyrene beads down to 1.2%. When a mix of bacteria was used, the sensitivity was as between 1.2% and 5%. The presented data demonstrate that flow cytometric fingerprinting is a sensitive and reproducible technique with the potential to be applied as a method for the dereplication of bacterial isolates. © 2017 International Society for Advancement of Cytometry. © 2017 International Society for Advancement of Cytometry.

  3. An iterative method for controlling reactive power flow in boundary transformers

    Energy Technology Data Exchange (ETDEWEB)

    Trigo, Angel L.; Martinez, Jose L.; Riquelme, Jesus; Romero, Esther [Department of Electrical Engineering, University of Seville (Spain)

    2011-02-15

    This paper presents an operational tool designed to help the system operator to control the reactive power flow in transmission-subtransmission boundary transformers. The main objective is to determine the minimum number of control actions necessary to ensure that reactive power flows in transmission/subtransmission transformers remain within limits. The proposed iterative procedure combines the use of a linear programming problem and a load flow tool. The linear programming assumes a linear behaviour between dependent and control variables around an operating point, modelled with sensitivities. Experimental results regarding IEEE systems are provided comparing the performance of the proposed approach with that of a conventional optimal power flow. (author)

  4. Are urine flow-volume nomograms developed on Caucasian men optimally applicable for Indian men? Need for appraisal of flow-volume relations in local population

    Directory of Open Access Journals (Sweden)

    Mayank M Agarwal

    2010-01-01

    Full Text Available Introduction : Flow-volume nomograms and volume-corrected flow-rates (cQ are tools to correct uroflow rates (Q with varied voided volumes (VV of urine. We investigated the applicability of the available nomograms in our local population. Materials and Methods : Raw data of our previous study on variation in Q with voiding position (standing, sitting, and squatting in healthy adult men was reanalyzed. Additionally, the departmental urodynamic database of the last four years was searched for uroflow data of men with voiding symptoms (International Prostatic Symptom Score (IPSS > 7 and global quality of life score >2. These results were projected on the Liverpool and Siroky nomograms for men. The Q-VV relations were statistically analyzed using curve-estimation regression method to examine the current definition of corrected maximum flow rate (Qmax. Results : We found a cubic relation between Q and VV; based on this we developed novel equation for cQ [cQ=Q/(VV 1/3 ] and novel confidence-limit flow-volume nomograms. The imaginary 16 th percentile line of Liverpool nomogram, -1 standard-deviation line of Siroky nomogram and lower 68% confidence-limit line of our nomogram had sensitivity of 96.2%, 100% and 89.3%, and specificity of 75.3% 69.3% and 86.0%, respectively for Qmax-VV relations. Corresponding values for average flow rate (Qave-volume relations were 96.2%, 100% and 94.6%, and 75.2%, 50.4% and 86.0%, respectively. The area under curve of the receiver operating characteristics (ROC curve for cQmax and cQave was 0.954 and 0.965, respectively, suggesting significantly higher discriminatory power than chance (P = 0.0001. Conclusion : Flow-volume nomograms developed on Caucasian population may not be optimally applicable to the Indian population. We introduce flow-volume nomograms and cQ, which have high sensitivity and specificity.

  5. Full system decontamination (FSD) for sustainable dose reduction

    International Nuclear Information System (INIS)

    Stiepani, Christoph; Sempere-Belda, Luis; Topf, Christian; Basu, Ashim

    2012-09-01

    Nuclear power plants experience an increase in dose rates during operation due to the build-up of the activity inventory. The activity build-up is influenced by the construction materials, past and present water chemistries, and the individual operating history of the plant. Depending on these factors the dose levels in an operating plant may reach a point in which concrete actions to reduce the overall radiation exposure become necessary. In the past dose reduction plans were performed, based on - Modification in coolant water chemistry - Substitution of Cobalt containing materials - Outage optimization program - Installation of permanent shielding - Decontamination The dose rate reduction took several years and today a stagnation of further dose rate reduction can be seen. Therefore AREVA has developed the Concept for Sustainable Dose Reduction in Operating BWRs and PWRs. This is a program of joint corrective measures to minimize dose levels rapidly and keep them low for continued operation. It can be applied in plants from all constructors and designs. The concept is based fully on the application of proven technologies, including: - Full System Decontamination with AREVA's decontamination process HP/CORD UV to minimize the activity inventory - The formation of new, very stable protective oxides on the system surfaces including injection of depleted zinc - Introduction of advanced water chemistry for maintaining the low dose levels achieved during ongoing operation The implementation of this program is particularly interesting for plants with a long operation history, especially when considering life extension. The latest application was performed successfully at the German PWR Grafenrheinfeld in 2010. In this paper the concept for sustainable dose reduction will be outlined and the site application detailed and the achieved results at PWR Grafenrheinfeld will be described. The recontamination after one cycle will be outlined in a second paper. (authors)

  6. Fabrication of ultra-sensitive leak detection standards

    International Nuclear Information System (INIS)

    Winkelman, C.R.

    1980-01-01

    The primary difficulty with flow rate measurements below 10 -10 standard cubic centimeters per second (std. cc/sec) is that there are no commercially available standards. The requirements, however, dictate that the problem of design and construction of a qualifiable standard in the ultra-sensitive range had to be solved. There are a number of leak types which were considered - capillary leaks, orifice leaks, and the pore type leaks, among others. The capillary leak was not used because of the cracking or sorting effects that are common to this type leak. For example, a gas blend flowing through a capillary leak will result in the lighter gases passing through the leak first. The difficulty of fabricating the proper hole size in relation to the flow rate requirements ruled out the orifice type leak. The choice was the pore type leak which utilizes the basic concept of a stainless steel knife edge driven into a fixed section composed of stainless steel with a gold over-lay and maintained under force

  7. Biomimetic flow-sensor arrays based on the filiform hairs on the cerci of crickets

    NARCIS (Netherlands)

    Wiegerink, Remco J.; Floris, J.; Jaganatharaja, R.K.; Izadi, N.; Lammerink, Theodorus S.J.; Krijnen, Gijsbertus J.M.

    2007-01-01

    In this paper we report on the latest developments in biomimetic flow-sensors based on the flow sensitive mechano-sensors of crickets. Crickets have one form of acoustic sensing evolved in the form of mechanoreceptive sensory hairs. These filiform hairs are highly perceptive to low-frequency sound

  8. Multivariate recurrence network analysis for characterizing horizontal oil-water two-phase flow.

    Science.gov (United States)

    Gao, Zhong-Ke; Zhang, Xin-Wang; Jin, Ning-De; Marwan, Norbert; Kurths, Jürgen

    2013-09-01

    Characterizing complex patterns arising from horizontal oil-water two-phase flows is a contemporary and challenging problem of paramount importance. We design a new multisector conductance sensor and systematically carry out horizontal oil-water two-phase flow experiments for measuring multivariate signals of different flow patterns. We then infer multivariate recurrence networks from these experimental data and investigate local cross-network properties for each constructed network. Our results demonstrate that a cross-clustering coefficient from a multivariate recurrence network is very sensitive to transitions among different flow patterns and recovers quantitative insights into the flow behavior underlying horizontal oil-water flows. These properties render multivariate recurrence networks particularly powerful for investigating a horizontal oil-water two-phase flow system and its complex interacting components from a network perspective.

  9. Acute airway effects of airborne formaldehyde in sensitized and non-sensitized mice housed in a dry or humid environment

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Søren Thor, E-mail: stl@nrcwe.dk; Wolkoff, Peder, E-mail: pwo@nrcwe.dk; Hammer, Maria, E-mail: mha@nrcwe.dk; Kofoed-Sørensen, Vivi, E-mail: vks@nrcwe.dk; Clausen, Per Axel, E-mail: pac@nrcwe.dk; Nielsen, Gunnar Damgård, E-mail: gdn@nrcwe.dk

    2013-05-01

    We investigated the role of air humidity and allergic sensitization on the acute airway response to inhaled formaldehyde (FA) vapor. Mice were sensitized to the immunogen ovalbumin (OVA) by three intraperitoneal injections followed by two aerosol challenges, giving rise to allergic airway inflammation. Control mice were sham sensitized by saline injections and challenged by saline aerosols. Once sensitized, the mice were housed at high (85–89%) or low (< 10%) relative humidity, respectively for 48 h prior to a 60-min exposure to either 0.4, 1.8 or about 5 ppm FA. Before, during and after exposure, breathing parameters were monitored. These included the specific markers of nose and lung irritations as well as the expiratory flow rate, the latter being a marker of airflow limitation. The sensory irritation response in the upper airways was not affected by allergic inflammation or changes in humidity. At high relative humidity, the OVA-sensitized mice had a decreased expiratory airflow rate compared to the saline control mice after exposure to approximately 5 ppm FA. This is in accordance with the observations that asthmatics are more sensitive than non-asthmatics to higher concentrations of airway irritants including FA. In the dry environment, the opposite trend was seen; here, the saline control mice had a significantly decreased expiratory airflow rate compared to OVA-sensitized mice when exposed to 1.8 and 4 ppm FA. We speculate that increased mucus production in the OVA-sensitized mice has increased the “scrubber effect” in the nose, consequently protecting the conducting and lower airways. - Highlights: ► Role of air humidity and allergy on sensitivity to an airway irritant was studied. ► In the humid environment, allergy amplified the effects of formaldehyde. ► In the dry environment, allergy reduced the effect of formaldehyde. ► Neither allergy nor humidity changed the formaldehyde-induced nasal irritation.

  10. Acute airway effects of airborne formaldehyde in sensitized and non-sensitized mice housed in a dry or humid environment

    International Nuclear Information System (INIS)

    Larsen, Søren Thor; Wolkoff, Peder; Hammer, Maria; Kofoed-Sørensen, Vivi; Clausen, Per Axel; Nielsen, Gunnar Damgård

    2013-01-01

    We investigated the role of air humidity and allergic sensitization on the acute airway response to inhaled formaldehyde (FA) vapor. Mice were sensitized to the immunogen ovalbumin (OVA) by three intraperitoneal injections followed by two aerosol challenges, giving rise to allergic airway inflammation. Control mice were sham sensitized by saline injections and challenged by saline aerosols. Once sensitized, the mice were housed at high (85–89%) or low (< 10%) relative humidity, respectively for 48 h prior to a 60-min exposure to either 0.4, 1.8 or about 5 ppm FA. Before, during and after exposure, breathing parameters were monitored. These included the specific markers of nose and lung irritations as well as the expiratory flow rate, the latter being a marker of airflow limitation. The sensory irritation response in the upper airways was not affected by allergic inflammation or changes in humidity. At high relative humidity, the OVA-sensitized mice had a decreased expiratory airflow rate compared to the saline control mice after exposure to approximately 5 ppm FA. This is in accordance with the observations that asthmatics are more sensitive than non-asthmatics to higher concentrations of airway irritants including FA. In the dry environment, the opposite trend was seen; here, the saline control mice had a significantly decreased expiratory airflow rate compared to OVA-sensitized mice when exposed to 1.8 and 4 ppm FA. We speculate that increased mucus production in the OVA-sensitized mice has increased the “scrubber effect” in the nose, consequently protecting the conducting and lower airways. - Highlights: ► Role of air humidity and allergy on sensitivity to an airway irritant was studied. ► In the humid environment, allergy amplified the effects of formaldehyde. ► In the dry environment, allergy reduced the effect of formaldehyde. ► Neither allergy nor humidity changed the formaldehyde-induced nasal irritation

  11. [Research on optimization of mathematical model of flow injection-hydride generation-atomic fluorescence spectrometry].

    Science.gov (United States)

    Cui, Jian; Zhao, Xue-Hong; Wang, Yan; Xiao, Ya-Bing; Jiang, Xue-Hui; Dai, Li

    2014-01-01

    Flow injection-hydride generation-atomic fluorescence spectrometry was a widely used method in the industries of health, environmental, geological and metallurgical fields for the merit of high sensitivity, wide measurement range and fast analytical speed. However, optimization of this method was too difficult as there exist so many parameters affecting the sensitivity and broadening. Generally, the optimal conditions were sought through several experiments. The present paper proposed a mathematical model between the parameters and sensitivity/broadening coefficients using the law of conservation of mass according to the characteristics of hydride chemical reaction and the composition of the system, which was proved to be accurate as comparing the theoretical simulation and experimental results through the test of arsanilic acid standard solution. Finally, this paper has put a relation map between the parameters and sensitivity/broadening coefficients, and summarized that GLS volume, carrier solution flow rate and sample loop volume were the most factors affecting sensitivity and broadening coefficients. Optimizing these three factors with this relation map, the relative sensitivity was advanced by 2.9 times and relative broadening was reduced by 0.76 times. This model can provide a theoretical guidance for the optimization of the experimental conditions.

  12. High blood pressure and visual sensitivity

    Science.gov (United States)

    Eisner, Alvin; Samples, John R.

    2003-09-01

    The study had two main purposes: (1) to determine whether the foveal visual sensitivities of people treated for high blood pressure (vascular hypertension) differ from the sensitivities of people who have not been diagnosed with high blood pressure and (2) to understand how visual adaptation is related to standard measures of systemic cardiovascular function. Two groups of middle-aged subjects-hypertensive and normotensive-were examined with a series of test/background stimulus combinations. All subjects met rigorous inclusion criteria for excellent ocular health. Although the visual sensitivities of the two subject groups overlapped extensively, the age-related rate of sensitivity loss was, for some measures, greater for the hypertensive subjects, possibly because of adaptation differences between the two groups. Overall, the degree of steady-state sensitivity loss resulting from an increase of background illuminance (for 580-nm backgrounds) was slightly less for the hypertensive subjects. Among normotensive subjects, the ability of a bright (3.8-log-td), long-wavelength (640-nm) adapting background to selectively suppress the flicker response of long-wavelength-sensitive (LWS) cones was related inversely to the ratio of mean arterial blood pressure to heart rate. The degree of selective suppression was also related to heart rate alone, and there was evidence that short-term changes of cardiovascular response were important. The results suggest that (1) vascular hypertension, or possibly its treatment, subtly affects visual function even in the absence of eye disease and (2) changes in blood flow affect retinal light-adaptation processes involved in the selective suppression of the flicker response from LWS cones caused by bright, long-wavelength backgrounds.

  13. Calibration of regional palaeohydrogeology and sensitivity analysis using hydrochemistry data in site investigations

    International Nuclear Information System (INIS)

    Hunter, F.M.I.; Hartley, L.J.; Hoch, A.; Jackson, C.P.; McCarthy, R.; Marsic, N.; Gylling, B.

    2008-01-01

    A transient coupled regional model of groundwater flow and solute transport has been developed, which allows the use of hydrochemical data to calibrate the model input parameters. The methodology has been illustrated using examples from the Simpevarp area in south-eastern Sweden which is being considered for geological disposal of spent nuclear fuel. The 3-dimensional model includes descriptions of spatial heterogeneity, density driven flow, rock matrix diffusion and transport and mixing of different water types, and has been simulated between 8000 BC and 2000 AD. Present-day analyses of major elemental ions and stable isotopes have been used to calibrate the model, which has then been cross checked against measured hydraulic conductivities, and against the hydrochemical interpretation of reference water mixing fractions. The key hydrogeological model sensitivities have been identified using the calibrated model and are found to include high sensitivity to the top surface flow boundary condition, the influence of variations in fracture transmissivity in different orientations (anisotropy), spatial heterogeneity in the deterministic regional deformation zones and the spacing between water bearing fractures (in terms of its effect on matrix diffusion)

  14. Introducing wet aerosols into the static high sensitivity ICP (SHIP)

    Energy Technology Data Exchange (ETDEWEB)

    Scheffer, Andy; Engelhard, Carsten; Sperling, Michael; Buscher, Wolfgang [University of Muenster, Institute of Inorganic and Analytical Chemistry, Muenster (Germany)

    2007-08-15

    A demountable design of the static high sensitivity ICP (SHIP) for optical emission spectrometry is presented, and its use as an excitation source with the introduction of wet aerosols was investigated. Aerosols were produced by standard pneumatic sample introduction systems, namely a cross flow nebulizer, Meinhard nebulizer and PFA low flow nebulizer, which have been applied in conjunction with a double pass and a cyclonic spray chamber. The analytical capabilities of these sample introduction systems in combination with the SHIP system were evaluated with respect to the achieved sensitivity. It was found that a nebulizer tailored for low argon flow rates (0.3-0.5 L min{sup -1}) is best suited for the low flow plasma (SHIP). An optimization of all gas flow rates of the SHIP system with the PFA low flow nebulizer was carried out in a two-dimensional way with the signal to background ratio (SBR) and the robustness as optimization target parameters. Optimum conditions for a torch model with 1-mm injector tube were 0.25 and 0.36 L min{sup -1} for the plasma gas and the nebulizer gas, respectively. A torch model with a 2-mm injector tube was optimized to 0.4 L min{sup -1} for the plasma gas and 0.44 L min{sup -1} for the nebulizer gas. In both cases the SHIP system saves approximately 95% of the argon consumed by conventional inductively coupled plasma systems. The limits of detection were found to be in the low microgram per litre range and below for many elements, which was quite comparable to those of the conventional setup. Furthermore, the short-term stability and the wash out behaviour of the SHIP were investigated. Direct comparison with the conventional setup indicated that no remarkable memory effects were caused by the closed design of the torch. The analysis of a NIST SRM 1643e (Trace Elements in Water) with the SHIP yielded recoveries of 97-103% for 13 elements, measured simultaneously. (orig.)

  15. Detection of circulating immune complexes by Raji cell assay: comparison of flow cytometric and radiometric methods

    International Nuclear Information System (INIS)

    Kingsmore, S.F.; Crockard, A.D.; Fay, A.C.; McNeill, T.A.; Roberts, S.D.; Thompson, J.M.

    1988-01-01

    Several flow cytometric methods for the measurement of circulating immune complexes (CIC) have recently become available. We report a Raji cell flow cytometric assay (FCMA) that uses aggregated human globulin (AHG) as primary calibrator. Technical advantages of the Raji cell flow cytometric assay are discussed, and its clinical usefulness is evaluated in a method comparison study with the widely used Raji cell immunoradiometric assay. FCMA is more precise and has greater analytic sensitivity for AHG. Diagnostic sensitivity by the flow cytometric method is superior in systemic lupus erythematosus (SLE), rheumatoid arthritis, and vasculitis patients: however, diagnostic specificity is similar for both assays, but the reference interval of FCMA is narrower. Significant correlations were found between CIC levels obtained with both methods in SLE, rheumatoid arthritis, and vasculitis patients and in longitudinal studies of two patients with cerebral SLE. The Raji cell FCMA is recommended for measurement of CIC levels to clinical laboratories with access to a flow cytometer

  16. Numerical modelling of flow structures over idealized transverse aeolian dunes of varying geometry

    Science.gov (United States)

    Parsons, Daniel R.; Walker, Ian J.; Wiggs, Giles F. S.

    2004-04-01

    A Computational Fluid Dynamics (CFD) model (PHOENICS™ 3.5) previously validated for wind tunnel measurements is used to simulate the streamwise and vertical velocity flow fields over idealized transverse dunes of varying height ( h) and stoss slope basal length ( L). The model accurately reproduced patterns of: flow deceleration at the dune toe; stoss flow acceleration; vertical lift in the crest region; lee-side flow separation, re-attachment and reversal; and flow recovery distance. Results indicate that the flow field over transverse dunes is particularly sensitive to changes in dune height, with an increase in height resulting in flow deceleration at the toe, streamwise acceleration and vertical lift at the crest, and an increase in the extent of, and strength of reversed flows within, the lee-side separation cell. In general, the length of the separation zone varied from 3 to 15 h from the crest and increased over taller, steeper dunes. Similarly, the flow recovery distance ranged from 45 to >75 h and was more sensitive to changes in dune height. For the range of dune shapes investigated in this study, the differing effects of height and stoss slope length raise questions regarding the applicability of dune aspect ratio as a parameter for explaining airflow over transverse dunes. Evidence is also provided to support existing research on: streamline curvature and the maintenance of sand transport in the toe region; vertical lift in the crest region and its effect on grainfall delivery; relations between the turbulent shear layer and downward forcing of flow re-attachment; and extended flow recovery distances beyond the separation cell. Field validation is required to test these findings in natural settings. Future applications of the model will characterize turbulence and shear stress fields, examine the effects of more complex isolated dune forms and investigate flow over multiple dunes.

  17. All-Particle Multiscale Computation of Hypersonic Rarefied Flow

    Science.gov (United States)

    Jun, E.; Burt, J. M.; Boyd, I. D.

    2011-05-01

    This study examines a new hybrid particle scheme used as an alternative means of multiscale flow simulation. The hybrid particle scheme employs the direct simulation Monte Carlo (DSMC) method in rarefied flow regions and the low diffusion (LD) particle method in continuum flow regions. The numerical procedures of the low diffusion particle method are implemented within an existing DSMC algorithm. The performance of the LD-DSMC approach is assessed by studying Mach 10 nitrogen flow over a sphere with a global Knudsen number of 0.002. The hybrid scheme results show good overall agreement with results from standard DSMC and CFD computation. Subcell procedures are utilized to improve computational efficiency and reduce sensitivity to DSMC cell size in the hybrid scheme. This makes it possible to perform the LD-DSMC simulation on a much coarser mesh that leads to a significant reduction in computation time.

  18. Assessment of subchannel code ASSERT-PV for flow-distribution predictions

    International Nuclear Information System (INIS)

    Nava-Dominguez, A.; Rao, Y.F.; Waddington, G.M.

    2014-01-01

    Highlights: • Assessment of the subchannel code ASSERT-PV 3.2 for the prediction of flow distribution. • Open literature and in-house experimental data to quantify ASSERT-PV predictions. • Model changes assessed against vertical and horizontal flow experiments. • Improvement of flow-distribution predictions under CANDU-relevant conditions. - Abstract: This paper reports an assessment of the recently released subchannel code ASSERT-PV 3.2 for the prediction of flow-distribution in fuel bundles, including subchannel void fraction, quality and mass fluxes. Experimental data from open literature and from in-house tests are used to assess the flow-distribution models in ASSERT-PV 3.2. The prediction statistics using the recommended model set of ASSERT-PV 3.2 are compared to those from previous code versions. Separate-effects sensitivity studies are performed to quantify the contribution of each flow-distribution model change or enhancement to the improvement in flow-distribution prediction. The assessment demonstrates significant improvement in the prediction of flow-distribution in horizontal fuel channels containing CANDU bundles

  19. Assessment of subchannel code ASSERT-PV for flow-distribution predictions

    Energy Technology Data Exchange (ETDEWEB)

    Nava-Dominguez, A., E-mail: navadoma@aecl.ca; Rao, Y.F., E-mail: raoy@aecl.ca; Waddington, G.M., E-mail: waddingg@aecl.ca

    2014-08-15

    Highlights: • Assessment of the subchannel code ASSERT-PV 3.2 for the prediction of flow distribution. • Open literature and in-house experimental data to quantify ASSERT-PV predictions. • Model changes assessed against vertical and horizontal flow experiments. • Improvement of flow-distribution predictions under CANDU-relevant conditions. - Abstract: This paper reports an assessment of the recently released subchannel code ASSERT-PV 3.2 for the prediction of flow-distribution in fuel bundles, including subchannel void fraction, quality and mass fluxes. Experimental data from open literature and from in-house tests are used to assess the flow-distribution models in ASSERT-PV 3.2. The prediction statistics using the recommended model set of ASSERT-PV 3.2 are compared to those from previous code versions. Separate-effects sensitivity studies are performed to quantify the contribution of each flow-distribution model change or enhancement to the improvement in flow-distribution prediction. The assessment demonstrates significant improvement in the prediction of flow-distribution in horizontal fuel channels containing CANDU bundles.

  20. Fine-grained Information Flow for Concurrent Computation

    DEFF Research Database (Denmark)

    Li, Ximeng

    and reference monitors, have been proposed in the context of programming languages and process calculi, to enforce such properties. The most widely used definitions of information flow security are noninterference-like properties. For concurrent systems where processes communicate with each other to accomplish...... computational tasks, fine-grained security policies can be formulated by distinguishing between whether communication can happen, and what is communicated. As the first contribution of this PhD thesis, we formulate a noninterference-like property that takes all combinations of sensitivity levels for “whether...... to a classical one when the two dimensions are intentionally blurred. As the second contribution, we focus on the “what” dimension and further allow the flow policy to vary under different contents stored and communicated. This is the area of content-dependent (or conditional) information flow, which has...