WorldWideScience

Sample records for figs

  1. Supplementary data Fig. S1 Fig. S1. FE-SEM images of the ...

    Indian Academy of Sciences (India)

    微软用户

    Fig. S3. Cycling behavior of V2O5 nanomaterials recorded by CV at 20 mV·s-1 scan rate. Page 4. 4. Fig. S4. Fig. S4. Cycling behavior of V2O5 nanomaterials electrodes of galvanostatic charge and discharge profiles recorded by GCD at a current density of 1 A·g-1. Page 5. 5. Fig. S5. Fig. S5. Cycling behavior of V2O5 ...

  2. Cattle manure fertilization increases fig yield

    OpenAIRE

    Leonel,Sarita; Tecchio,Marco Antonio

    2009-01-01

    Fertilization using organic compounds is complementary to chemical fertilization, being essential to integrated fruit production. Reports on fig tree (Ficus carica L.) organic fertilization and mineral nutrition are worldwide scarce, especially in Brazil. This experiment aimed to evaluate the effects of cattle manure fertilization on the yield and productivity of the fig tree 'Roxo de Valinhos' in Botucatu, São Paulo State, Brazil, during the 2002/03, 2003/04, 2004/05 and 2005/06 crop cycles....

  3. Distribution of Fig Mosaic in Jordan

    OpenAIRE

    Khalil I. Al-Mughrabi; Ghandi H. Anfoka

    2000-01-01

    Fig mosaic (FM) is one of the most important diseases of figs in Jordan. A nationwide survey was conducted to determine the incidence and severity of this disease in trees and in seedlings propagated by cuttings in orchards and nurseries in 13 provinces and cities all over the country. Cultivars surveyed included Khdari, Mwazi, Zraki, Khartamani, Dafoori, Turki, Hamari, Esaili, Ajlouni, in addition to an Italian and a French cultivar. Disease severity varied from moderately severe...

  4. Distribution of Fig Mosaic in Jordan

    Directory of Open Access Journals (Sweden)

    Khalil I. Al-Mughrabi

    2000-08-01

    Full Text Available Fig mosaic (FM is one of the most important diseases of figs in Jordan. A nationwide survey was conducted to determine the incidence and severity of this disease in trees and in seedlings propagated by cuttings in orchards and nurseries in 13 provinces and cities all over the country. Cultivars surveyed included Khdari, Mwazi, Zraki, Khartamani, Dafoori, Turki, Hamari, Esaili, Ajlouni, in addition to an Italian and a French cultivar. Disease severity varied from moderately severe to extremely severe with leaf malformation and fruit drop FM was found in all provinces. Incidence of FM, averaged over trees of all cultivars and all age categories, was 95.3%. Fig trees 3 years and older had the highest disease incidence, ranging from 93.3% to 100% in the different orchards. The Esaili cultivar had the lowest incidence ranging between 50% and100%, with an average of 76.5%. The highest FM incidence was on Dafoori. Of the most common cultivars, Khdari was the most susceptible. Jerash province had the highest percentage (12.5% of fig seedlings and trees in the most severe disease category. The highest percentage (27.8% of healthy fig seedlings and trees was in Irbid province. This paper reports the incidence of FM in various local and imported fig cultivars of different ages, and relates the spread of the disease to the method of fig propagation practiced in Jordan. Suggested solutions for the problem, which include the introduction of disease and pest free fig seedlings derived from tissue culture and the establishment of new rules and regulations to prevent the spread of the disease are discussed.

  5. Larger fig wasps are more careful about which figs to enter--with good reason.

    Science.gov (United States)

    Liu, Cong; Yang, Da-Rong; Compton, Stephen G; Peng, Yan-Qiong

    2013-01-01

    Floral longevity reflects a balance between gains in pollinator visitation and the costs of flower maintenance. Because rewards to pollinators change over time, older flowers may be less attractive, reducing the value of extended longevity. Un-pollinated figs, the inflorescences of Ficus species, can remain receptive for long periods, but figs that are older when entered by their host-specific fig wasp pollinators produce fewer seeds and fig wasp offspring. Our field experiments with Ficushispida, a dioecious fig tree, examined how the length of time that receptive figs have remained un-pollinated influences the behaviour and reproductive success of its short-lived fig wasp pollinator, Ceratosolensolmsi marchali. The results were consistent in three different seasons, and on male and female trees, although receptivity was greatly extended during colder months. Pollinators took longer to find the ostioles of older figs, and longer to penetrate them. They also became increasingly unwilling to enter figs as they aged, and increasing numbers of the wasps became trapped in the ostiolar bracts. Larger individuals were particularly unwilling to enter older figs, resulting in older figs being pollinated by smaller wasps. On female trees, where figs produce only seeds, seed production declined rapidly with fig age. On male trees, the numbers and size of fig wasp offspring declined, and a higher proportion were male. Older male figs are harder to enter, especially for larger individuals, and offer poorer quality oviposition opportunities. This study opens an interesting new perspective on the coevolution of figs and their pollinators, especially factors influencing pollinator body size and emphasises the subtleties of interactions between mutualists.

  6. 21 CFR 145.130 - Canned figs.

    Science.gov (United States)

    2010-04-01

    ..., a mixture of brown sugar and honey, the statement “___ sirup of brown sugar and honey” the blank to... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned figs. 145.130 Section 145.130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

  7. Sexual specialization in two tropical dioecious figs.

    Science.gov (United States)

    Patel, Aviva; McKey, Doyle

    1998-07-01

    Ficus species (figs) and their species-specific pollinator wasps are involved in an intimate mutualism in which wasps lay eggs in some ovaries of the closed inflorescences (syconia), and mature, inseminated offspring carry pollen from mature syconia to fertilize receptive inflorescences. In monoecious species, each syconium produces seeds and wasps. In functionally dioecious fig species, making up approximately half the figs worldwide, male and female functions are separated; hermaphrodite (functionally male) trees produce wasps and pollen only, while female trees produce seeds only. This sexual separation allows selection to act independently on the reproductive biology of each sex. Examining sexual specialization in a tight mutualism allows us to determine aspects of the mutualism that are flexible and those that are canalized. In this study, we quantified the phenology of two species of dioecious figs, F. exasperata and F. hispida, for 2 years by following the fates of several thousand syconia over time. In studying each of these species in a dry and a wet site in south India, we tested specific predictions of how dioecious figs might optimize sexual function. On female trees of both species, more inflorescences matured during the wet (monsoon) season than in any other season; this fruiting period enabled seeds to be produced during the season most suitable for germination. In F. exasperata, functionally male trees released most wasps from mature syconia in the dry season, during peak production of receptive female syconia, and thus maximized successful pollination. In F. hispida, "male" trees produced more syconia in the dry and monsoon seasons than in the post-monsoon season. In both species, male and female trees abscised more unpollinated, young inflorescences than pollinated inflorescences, but abscission appeared to be more likely due to resource- rather than pollinator- limitation. The phenology of F. exasperata requires that male inflorescences wait in

  8. Putting your sons in the right place: the spatial distribution of fig wasp offspring inside figs

    NARCIS (Netherlands)

    Zavodna, M.; Compton, S.G.; Biere, A.; Gilmartin, P.M.; Van Damme, J.M.M.

    2005-01-01

    1. Pollinating fig wasps (Hymenoptera, Agaonidae) display sex ratio adjustment, producing less female-biased combined sex ratios as the number of ovipositing females (foundresses) inside a fig increases. Because males have low mobility, the oviposition sites (galled ovules) chosen by each foundress

  9. Climate warming and the potential extinction of fig wasps, the obligate pollinators of figs.

    Science.gov (United States)

    Jevanandam, Nanthinee; Goh, Alexander G R; Corlett, Richard T

    2013-06-23

    Figs (Ficus) have a reciprocally obligate mutualism with tiny, short-lived (1-2 days) fig wasps (Agaonidae). The small size and short life of these pollinators is expected to make them more vulnerable to climate change than their larger and longer-lived hosts. We experimentally tested the thermal tolerances of four species of adult female fig wasp from equatorial Singapore. The results suggest that an increase of 3°C or more above the current temperatures experienced across much of the equatorial tropics would markedly decrease the active adult lifespan of all four species. Fig plants are the centre of an intricate web of specialist and generalist animals. Unless fig wasps can acclimate or adapt to warmer temperatures in time, these responses may disrupt the mutualism, potentially affecting multiple trophic levels.

  10. Fig: ure it Out: A Creative Psychoanalysis

    Directory of Open Access Journals (Sweden)

    Neil Murphy

    2010-09-01

    Full Text Available Sigmund Freud’s contribution to the field of psychology was significant, not because it was flawless but because it challenged conventional views of the time.   In the modern era, an individual’s view of the world is constantly being challenged due, in large part, to insurmountable information made available for public consumption. It’s an unrelenting bombardment of input that has made prominent the rift between facts and beliefs. This inquisitive article is an exploration of that conflict.   By applying Freudian psychology to one of the most confrontational and debatable topics of the 21st century—the environment—Fig: ure It Out reviews our environmental problems from one psychological perspective. Do we define truths by facts or by the way in which we cope with new information? It’s an example of human behaviour within a changing world.

  11. Proverbe et expression figée

    Directory of Open Access Journals (Sweden)

    Laura Cîţu

    2008-11-01

    Full Text Available Les deux types d’énoncés sentencieux abordés dans cette étude ne feront pas l’objet d’une analyse formelle de type structural, se proposant de décrire une éventuelle architecture et des propriétés syntaxiques spécifiques. Il ne s’agira non plus d’une approche stylistique, rhétorique ou pragmatique. En revanche, c’est une vision de sémantique référentielle qui sera projetée sur ce type de séquences, laquelle essaiera de surprendre un trait fondamental et constant des proverbes, qui permet de le distinguer des expressions figées, et dont l’identification est apte aussi de prédire quelles phrases de la langue pourraient accéder au statut des proverbes.

  12. The role of non-fig-wasp insects on fig tree biology, with a proposal of the F phase (Fallen figs)

    Science.gov (United States)

    Palmieri, Luciano; Pereira, Rodrigo Augusto Santinelo

    2018-07-01

    The two seminal papers by Galil and Eisikowitch describing the development of Ficus flowers and their sycophilous wasps (i.e., phases A-E) have been adopted in several ecological and evolutionary studies on a wide range of fig tree-insect interactions. Their classification, however, is not inclusive enough to encompass all the diversity of insects associated with the fig development, and the impact of this fauna on the fig-fig wasp mutualism is still unexplored. Here we describe the life history of the non-fig-wasp insects and propose an additional phase to fig-development classification, the F phase (Fallen figs). These figs are not consumed by frugivores while still on the parent tree, fall to the ground and turn into a resource for a diverse range of animals. To support the relevance of the F phase, we summarized a 5-years-period of field observations made on different biomes in three continents. Additionally, we compiled data from the literature of non-fig-wasp insects including only insects associated with inflorescences of wild fig tree species. We report 129 species of non-fig-wasp insects feeding on figs; they colonize the figs in different phases of development and some groups rely on the fallen figs to complete their life cycles. Their range of interaction varies from specialists - that use exclusively fig pulp or fig seeds in their diets - to generalists, opportunists and parasitoids species. The formalization of this additional phase will encourage new studies on fig tree ecology and improve our knowledge on the processes that affect the diversification of insects. It will also help us to understand the implications this fauna may have had on the origin and maintenance of mutualistic interactions.

  13. Specific attraction of fig-pollinating wasps: role of volatile compounds released by tropical figs.

    Science.gov (United States)

    Grison-Pigé, Laure; Bessière, Jean-Marie; Hossaert-McKey, Martine

    2002-02-01

    Floral scents often act as pollinator attractants. In the case of obligate and specific plant-pollinator relationships, the role of floral signals may be crucial in allowing the encounter of the partners. About 750 Ficus species (Moraceae) are involved in such interactions, each with a distinct species of pollinating wasp (Chalcidoidea, Agaonidae). Several species have been shown to release volatile compounds, but their role in pollinator attraction has rarely been simultaneously tested. We investigated the floral scents of four tropical fig species and combined chemical analysis with biological tests of stimulation of insects. Pollinators of three species were stimulated by the odor of their associated fig species and generally not by the odor of another species. The fourth actually comprised two distinct varieties. The main compound was often a different one in each species. Floral blends of different species always shared compounds, but ratios of these compounds varied among species.

  14. Molecular phylogenies of figs and fig-pollinating wasps in the Ryukyu and Bonin (Ogasawara) islands, Japan.

    Science.gov (United States)

    Azuma, Hiroshi; Harrison, Rhett D; Nakamura, Keiko; Su, Zhi-Hui

    2010-01-01

    The interaction between figs (Ficus, Moraceae) and fig-pollinating wasps (Chalcidoidea, Agaonidae) is one of the most specific mutualisms, and thus is a model system for studying coevolution and cospeciation. In this study we focused on figs and their associated fig-wasps found in the Ryukyu and Bonin (Ogasawara) Islands, Japan, because it has been suggested that breakdown in the specificity may occur in islands or at edge of a species' distribution. We collected 136 samples of 15 native fig species and 95 samples of 13 associated fig-wasps from all major islands in the Ryukyu Islands, including two fig species and one fig-wasp species endemic to the Bonin Islands. We performed molecular phylogenetic analyses using plastid DNA and nuclear ITS sequences for the figs and nuclear 28S rRNA and mitochondrial COI genes for the fig-wasps to investigate the interspecific phylogenies and intraspecific variation within the mutualism. Our phylogenetic analyses using multiple samples per species show the single clade of each fig (except the Bonin endemic species) and fig-pollinating wasp species. Fig species belonging to the same subgenera formed well-supported clades in both plastid and ITS trees, except for the subgenus Urostigma. Likewise, fig wasps emerging from host fig species belonging to the same subgenera formed mostly well supported clades in both 28S and COI trees. Host specificity between the figs and fig-wasps functions strictly in these islands. There was very little sequence variation within species, and that no major geographic structure was found. The two Bonin endemic species (F. boninsimae and F. nishimurae) or their common ancestor and the associated fig-wasps (Blastophaga sp.) are apparently derived from F. erecta and its associated fig-wasps (B. nipponica), respectively, and probably migrated from the Ryukyu Islands.

  15. FIG4 regulates lysosome membrane homeostasis independent of phosphatase function

    OpenAIRE

    Bharadwaj, Rajnish; Cunningham, Kathleen M.; Zhang, Ke; Lloyd, Thomas E.

    2015-01-01

    FIG4 is a phosphoinositide phosphatase that is mutated in several diseases including Charcot-Marie-Tooth Disease 4J (CMT4J) and Yunis-Varon syndrome (YVS). To investigate the mechanism of disease pathogenesis, we generated Drosophila models of FIG4-related diseases. Fig4 null mutant animals are viable but exhibit marked enlargement of the lysosomal compartment in muscle cells and neurons, accompanied by an age-related decline in flight ability. Transgenic animals expressing Drosophila Fig4 mi...

  16. FIG4 regulates lysosome membrane homeostasis independent of phosphatase function.

    Science.gov (United States)

    Bharadwaj, Rajnish; Cunningham, Kathleen M; Zhang, Ke; Lloyd, Thomas E

    2016-02-15

    FIG4 is a phosphoinositide phosphatase that is mutated in several diseases including Charcot-Marie-Tooth Disease 4J (CMT4J) and Yunis-Varon syndrome (YVS). To investigate the mechanism of disease pathogenesis, we generated Drosophila models of FIG4-related diseases. Fig4 null mutant animals are viable but exhibit marked enlargement of the lysosomal compartment in muscle cells and neurons, accompanied by an age-related decline in flight ability. Transgenic animals expressing Drosophila Fig4 missense mutations corresponding to human pathogenic mutations can partially rescue lysosomal expansion phenotypes, consistent with these mutations causing decreased FIG4 function. Interestingly, Fig4 mutations predicted to inactivate FIG4 phosphatase activity rescue lysosome expansion phenotypes, and mutations in the phosphoinositide (3) phosphate kinase Fab1 that performs the reverse enzymatic reaction also causes a lysosome expansion phenotype. Since FIG4 and FAB1 are present together in the same biochemical complex, these data are consistent with a model in which FIG4 serves a phosphatase-independent biosynthetic function that is essential for lysosomal membrane homeostasis. Lysosomal phenotypes are suppressed by genetic inhibition of Rab7 or the HOPS complex, demonstrating that FIG4 functions after endosome-to-lysosome fusion. Furthermore, disruption of the retromer complex, implicated in recycling from the lysosome to Golgi, does not lead to similar phenotypes as Fig4, suggesting that the lysosomal defects are not due to compromised retromer-mediated recycling of endolysosomal membranes. These data show that FIG4 plays a critical noncatalytic function in maintaining lysosomal membrane homeostasis, and that this function is disrupted by mutations that cause CMT4J and YVS. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. Chemical camouflage: a key process in shaping an ant-treehopper and fig-fig wasp mutualistic network.

    Science.gov (United States)

    Wang, Bo; Lu, Min; Cook, James M; Yang, Da-Rong; Dunn, Derek W; Wang, Rui-Wu

    2018-01-30

    Different types of mutualisms may interact, co-evolve and form complex networks of interdependences, but how species interact in networks of a mutualistic community and maintain its stability remains unclear. In a mutualistic network between treehoppers-weaver ants and fig-pollinating wasps, we found that the cuticular hydrocarbons of the treehoppers are more similar to the surface chemical profiles of fig inflorescence branches (FIB) than the cuticular hydrocarbons of the fig wasps. Behavioral assays showed that the cuticular hydrocarbons from both treehoppers and FIBs reduce the propensity of weaver ants to attack treehoppers even in the absence of honeydew rewards, suggesting that chemical camouflage helps enforce the mutualism between weaver ants and treehoppers. High levels of weaver ant and treehopper abundances help maintain the dominance of pollinating fig wasps in the fig wasp community and also increase fig seed production, as a result of discriminative predation and disturbance by weaver ants of ovipositing non-pollinating fig wasps (NPFWs). Ants therefore help preserve this fig-pollinating wasp mutualism from over exploitation by NPFWs. Our results imply that in this mutualistic network chemical camouflage plays a decisive role in regulating the behavior of a key species and indirectly shaping the architecture of complex arthropod-plant interactions.

  18. Four viruses infecting figs in Western Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Amal Y. ALDHEBIANI

    2015-12-01

    Full Text Available Many diseases are compromising fig production in Saudi Arabia and in particular those caused by viruses. RT-PCR assays were conducted on 80 samples collected from four fig-growing provinces in the West Mecca region of Saudi Arabia, including the Fatima, Khulais, Rabigh and Alshifa valleys. Samples consisted of leaf tissues taken from caprifig and common fig trees. The presence of Fig mosaic virus (FMV, Fig leaf mottle-associated virus 1 (FLMaV-1, Fig leaf mottle-associated virus 2 (FLMaV-2 and Fig mild mottle-associated virus (FMMaV was assessed from the samples. RT-PCR results showed that all four viruses were present in the surveyed areas with different proportions of infection. Incidence was 69% of samples, with a peak of 80%, from the Alshifa and Fatima valleys, 60% from Rabigh and 55% from Khulais valley. FLMaV-1 was the prevailing virus (55% of samples, followed by FMV (34%, whereas FLMaV-2 (11% of samples and FMMaV (6% were less common. Most of the mosaic symptoms observed in surveyed fig orchards occurred with the presence of FMV. However, many other symptoms remained unexplained because of the arduous task of determining the involvement of other fig-infecting viruses with mosaic disease. This is the first report of FMMaV and FLMaV-2 in Saudi Arabia, and of FMV and FLMaV-1 in western Saudi Arabia. The virus status of this crop is probably compromised and a sanitation programme is required to produce healthy plant material in Saudi Arabia.

  19. Moving your sons to safety: galls containing male fig wasps expand into the centre of figs, away from enemies.

    Directory of Open Access Journals (Sweden)

    Hui Yu

    Full Text Available Figs are the inflorescences of fig trees (Ficus spp., Moraceae. They are shaped like a hollow ball, lined on their inner surface by numerous tiny female flowers. Pollination is carried out by host-specific fig wasps (Agaonidae. Female pollinators enter the figs through a narrow entrance gate and once inside can walk around on a platform generated by the stigmas of the flowers. They lay their eggs into the ovules, via the stigmas and styles, and also gall the flowers, causing the ovules to expand and their pedicels to elongate. A single pollinator larva develops in each galled ovule. Numerous species of non-pollinating fig wasps (NPFW, belonging to other families of Chalcidoidea also make use of galled ovules in the figs. Some initiate galls, others make use of pollinator-generated galls, killing pollinator larvae. Most NPFW oviposit from the outside of figs, making peripherally-located pollinator larvae more prone to attack. Style length variation is high among monoecious Ficus spp. and pollinators mainly oviposit into more centrally-located ovules, with shorter styles. Style length variation is lower in male (wasp-producing figs of dioecious Ficus spp., making ovules equally vulnerable to attack by NPFW at the time that pollinators oviposit. We recorded the spatial distributions of galled ovules in mature male figs of the dioecious Ficus hirta in Southern China. The galls contained pollinators and three NPFW that kill them. Pollinators were concentrated in galls located towards the centre of the figs, NPFW towards the periphery. Due to greater pedicel elongation by male galls, male pollinators became located in more central galls than their females, and so were less likely to be attacked. This helps ensure that sufficient males survive, despite strongly female-biased sex ratios, and may be a consequence of the pollinator females laying mostly male eggs at the start of oviposition sequences.

  20. Search for methylation-sensitive amplification polymorphisms in mutant figs

    OpenAIRE

    Rodrigues, M. G F; Martins, A. B G [UNESP; Bertoni, B. W.; Figueira, A.; Giuliatti, S.

    2013-01-01

    Fig (Ficus carica) breeding programs that use conventional approaches to develop new cultivars are rare, owing to limited genetic variability and the difficulty in obtaining plants via gamete fusion. Cytosine methylation in plants leads to gene repression, thereby affecting transcription without changing the DNA sequence. Previous studies using random amplification of polymorphic DNA and amplified fragment length polymorphism markers revealed no polymorphisms among select fig mutants that ori...

  1. Urbanized landscapes favored by fig-eating birds increase invasive but not native juvenile strangler fig abundance.

    Science.gov (United States)

    Caughlin, Trevor; Wheeler, Jessica H; Jankowski, Jill; Lichstein, Jeremy W

    2012-07-01

    Propagule pressure can determine the success or failure of invasive plant range expansion. Range expansion takes place at large spatial scales, often encompassing many types of land cover, yet the effect of landscape context on propagule pressure remains largely unknown. Many studies have reported a positive correlation between invasive plant abundance and human land use; increased propagule pressure in these landscapes may be responsible for this correlation. We tested the hypothesis that increased rates of seed dispersal by fig-eating birds, which are more common in urban habitats, result in an increase in invasive strangler fig abundance in landscapes dominated by human land use. We quantified abundance of an invasive species (Ficus microcarpa) and a native species (F. aurea) of strangler fig in plots spanning the entire range of human land use in South Florida, USA, from urban parking lots to native forest. We then compared models that predicted juvenile fig abundance based on distance to adult fig seed sources and fig-eating bird habitat quality with models that lacked one or both of these terms. The best model for juvenile invasive fig abundance included both distance to adult and fig-eating bird habitat terms, suggesting that landscape effects on invasive fig abundance are mediated by seed-dispersing birds. In contrast, the best model for juvenile native fig abundance included only presence/absence of adults, suggesting that distance from individual adult trees may have less effect on seed limitation for a native species compared to an invasive species undergoing range expansion. However, models for both species included significant effects of adult seed sources, implying that juvenile abundance is limited by seed arrival. This result was corroborated by a seed addition experiment that indicated that both native and invasive strangler figs were strongly seed limited. Understanding how landscape context affects the mechanisms of plant invasion may lead to

  2. ALA Pretreatment Improves Waterlogging Tolerance of Fig Plants.

    Directory of Open Access Journals (Sweden)

    Yuyan An

    Full Text Available 5-aminolevulinic acid (ALA, a natural and environmentally friendly plant growth regulator, can improve plant tolerance to various environmental stresses. However, whether ALA can improve plant waterlogging tolerance is unknown. Here, we investigated the effects of ALA pretreatment on the waterlogging-induced damage of fig (Ficus carica Linn. plants, which often suffer from waterlogging stress. ALA pretreatment significantly alleviated stress-induced morphological damage, increased leaf relative water content (RWC, and reduced leaf superoxide anion ([Formula: see text] production rate and malonaldehyde (MDA content in fig leaves, indicating ALA mitigates waterlogging stress of fig plants. We further demonstrated that ALA pretreatment largely promoted leaf chlorophyll content, photosynthetic electron transfer ability, and photosynthetic performance index, indicating ALA significantly improves plant photosynthetic efficiency under waterlogging stress. Moreover, ALA pretreatment significantly increased activities of leaf superoxide dismutase (SOD and peroxidase (POD, root vigor, and activities of root alcohol dehydrogenase (ADH, and lactate dehydrogenase (LDH, indicating ALA also significantly improves antioxidant ability and root function of fig plants under waterlogging stress. Taken together, ALA pretreatment improves waterlogging tolerance of fig plants significantly, and the promoted root respiration, leaf photosynthesis, and antioxidant ability may contribute greatly to this improvement. Our data firstly shows that ALA can improve plant waterlogging tolerance.

  3. Efeito de vespas não-polinizadoras sobre o mutualismo Ficus - vespas de figos Effect of non-pollinating fig wasps over fig-fig wasp mutualism

    Directory of Open Access Journals (Sweden)

    Larissa G. Elias

    Full Text Available Relações ecológicas interespecíficas, que resultam em benefício para todos os organismos participantes, são conhecidas como mutualismo. No entanto, tal cooperação abre espaço para o surgimento de estratégias oportunistas (ou de trapaça, representadas por indivíduos parasitas do mutualismo, que recebem o benefício de um dos parceiros sem oferecer nada em troca. A interação figueiras - vespas - de - figo é um sistema adequado para o estudo do mutualismo e de estratégias oportunistas (parasitas de mutualismos. Representantes do gênero Ficus (Moraceae apresentam uma relação mutualística com pequenas vespas polinizadoras (Agaonidae e são explorados por outras espécies de vespas não-polinizadoras. Esse trabalho teve como objetivo avaliar o impacto das vespas não-polinizadoras sobre o mutualismo Ficus citrifolia e suas vespas polinizadoras, Pegoscapus tonduzi Grandi, 1919. Para tal, foi comparada a produção de aquênios (função feminina e de fêmeas da espécie polinizadora (função masculina entre amostras de sicônios altamente infestados e pouco infestados por vespas não-polinizadoras, coletadas nos municípios de Londrina (Paraná, Campinas e Ribeirão Preto (São Paulo, Brasil. Nossos resultados apontaram que as vespas não-polinizadoras exercem impacto negativo nos componentes feminino e masculino da planta, sendo maior no masculino. A produção de vespas polinizadoras foi cerca de sete vezes menor nos figos infestados, ao passo que a produção de aquênios foi 1,5 vez menor nesses mesmos figos. Hipóteses sobre a estabilidade do mutualismo na presença das espécies oportunistas são discutidas.Mutualism is the name given to interspecific interactions which result in benefit for all partners involved. However, such cooperation is open to opportunistic strategies: individuals that extract the benefit from the partner, but do not offer any benefit in exchange. The fig-fig wasp interaction is an appropriate case to

  4. Interference competition and high temperatures reduce the virulence of fig wasps and stabilize a fig-wasp mutualism.

    Directory of Open Access Journals (Sweden)

    Rui-Wu Wang

    2009-11-01

    Full Text Available Fig trees are pollinated by fig wasps, which also oviposit in female flowers. The wasp larvae gall and eat developing seeds. Although fig trees benefit from allowing wasps to oviposit, because the wasp offspring disperse pollen, figs must prevent wasps from ovipositing in all flowers, or seed production would cease, and the mutualism would go extinct. In Ficus racemosa, we find that syconia ('figs' that have few foundresses (ovipositing wasps are underexploited in the summer (few seeds, few galls, many empty ovules and are overexploited in the winter (few seeds, many galls, few empty ovules. Conversely, syconia with many foundresses produce intermediate numbers of galls and seeds, regardless of season. We use experiments to explain these patterns, and thus, to explain how this mutualism is maintained. In the hot summer, wasps suffer short lifespans and therefore fail to oviposit in many flowers. In contrast, cooler temperatures in the winter permit longer wasp lifespans, which in turn allows most flowers to be exploited by the wasps. However, even in winter, only in syconia that happen to have few foundresses are most flowers turned into galls. In syconia with higher numbers of foundresses, interference competition reduces foundress lifespans, which reduces the proportion of flowers that are galled. We further show that syconia encourage the entry of multiple foundresses by delaying ostiole closure. Taken together, these factors allow fig trees to reduce galling in the wasp-benign winter and boost galling (and pollination in the wasp-stressing summer. Interference competition has been shown to reduce virulence in pathogenic bacteria. Our results show that interference also maintains cooperation in a classic, cooperative symbiosis, thus linking theories of virulence and mutualism. More generally, our results reveal how frequency-dependent population regulation can occur in the fig-wasp mutualism, and how a host species can 'set the rules of the

  5. Provisional host catalogue of Fig wasps (Hymenoptera, Chalcidoidea)

    NARCIS (Netherlands)

    Wiebes, J.T.

    1966-01-01

    INTRODUCTION In this catalogue — entitled "provisional" because our knowledge of the subject is still so evidently incomplete — all species of Ficus mentioned as hosts of fig wasps, are listed with the Hymenoptera Chalcidoidea reared from their receptacles. The names used for the Agaonidae are in

  6. Search for methylation-sensitive amplification polymorphisms in mutant figs.

    Science.gov (United States)

    Rodrigues, M G F; Martins, A B G; Bertoni, B W; Figueira, A; Giuliatti, S

    2013-07-08

    Fig (Ficus carica) breeding programs that use conventional approaches to develop new cultivars are rare, owing to limited genetic variability and the difficulty in obtaining plants via gamete fusion. Cytosine methylation in plants leads to gene repression, thereby affecting transcription without changing the DNA sequence. Previous studies using random amplification of polymorphic DNA and amplified fragment length polymorphism markers revealed no polymorphisms among select fig mutants that originated from gamma-irradiated buds. Therefore, we conducted methylation-sensitive amplified polymorphism analysis to verify the existence of variability due to epigenetic DNA methylation among these mutant selections compared to the main cultivar 'Roxo-de-Valinhos'. Samples of genomic DNA were double-digested with either HpaII (methylation sensitive) or MspI (methylation insensitive) and with EcoRI. Fourteen primer combinations were tested, and on an average, non-methylated CCGG, symmetrically methylated CmCGG, and hemimethylated hmCCGG sites accounted for 87.9, 10.1, and 2.0%, respectively. MSAP analysis was effective in detecting differentially methylated sites in the genomic DNA of fig mutants, and methylation may be responsible for the phenotypic variation between treatments. Further analyses such as polymorphic DNA sequencing are necessary to validate these differences, standardize the regions of methylation, and analyze reads using bioinformatic tools.

  7. Storage stability of standard and diet figs canned in syrup

    Directory of Open Access Journals (Sweden)

    Priscilla Kárim CAETANO

    Full Text Available Abstract The current study aimed to evaluate the physicochemical, microbiological and sensory quality of traditional and diet figs canned in syrup, as well as verify their storage stability. Therefore, it was used green figs from the cultivar Roxo de Valinhos. Two treatments were held: standard sucrose syrup and sweetener blends: sodium cyclamate, sucralose and sodium saccharin. The syrups were previously prepared; being 25 °Brix for sucrose syrup; and by dividing the quantity of sucrose potency (100 to the blend of sweeteners potency (125 for sweetener blends. The products were stored at room temperature for 180 days and evaluated once a month through pH, soluble solids, titratable acidity, texture, vacuum and sensory evaluation (i.e. affective test; except for the commercial sterility test that was conducted at 0 to 180 days. Both canned figs in syrup showed no significant difference for pH, titratable acidity, soluble solids, vacuum and texture; therefore, both were considered commercially sterile and kept their sensory characteristics throughout storage.

  8. Rooting of stem segments from fig tree cultivars

    Directory of Open Access Journals (Sweden)

    Rayane Barcelos Bisi

    2016-06-01

    Full Text Available Although Brazil is the largest fig (Ficus carica L. producer in the Southern Hemisphere, it mainly uses only one cultivar, ‘Roxo de Valinhos’. In addition, propagation is almost entirely through hardwood cuttings. Therefore, the aim of this study was to establish a propagation method that provides more successful rooting of stem segments of fig cultivars for the purpose of expanding the genetic base of the fig tree. The cultivars used were ‘Brunswick’, ‘Calabacita’, ‘Negro de Bursa’, ‘Mini Figo’, ‘Lampa Preta’, ‘Lemon’, ‘Troiano’,’ Nazaré’, ‘Três num Prato’, ‘Princesa’, ‘Colo de Dama’, ‘Montes’, ‘Bêbera Branca’, ‘Pingo de Mel’, and ‘Roxo de Valinhos’. The propagation methods used were layering, hardwood cuttings, nodal segments, herbaceous cuttings originating from the removal of sprouts, and herbaceous cuttings obtained during growth. We found that the propagation method influences the rooting of stem segments, and cultivars differ in their rooting potential.

  9. First Report of the Fig Cyst Nematode, Heterodera fici Kirjanova, on Fig Tree, Ficus carica, in Ontario, Canada.

    Science.gov (United States)

    Sun, Fengcheng; Henry, Neil; Yu, Qing

    2017-06-01

    Although fig trees are a popular ornamental fruit tree in subtropical regions, some hardy species, such as Ficus carica , have been grown in the west coast of British Columbia and southern Ontario in Canada. The fig cyst nematode, Heterodera fici Kirjanova, is a pest on fig plants, and the heavy infestation can cause retarded growth and yellowing of leaves (Maqbool et al., 1987). In the spring of 2016, a sample of rhizosphere from a potted fig ( F. carica ) seedling was submitted to the Nematology Laboratory, Canadian Food Inspection Agency. The sample was collected from a nursery in Niagara-on-the-Lake, Ontario, Canada, during an inspection to support export certification. The fig trees in the nursery had been grown in the outside fields during the growing seasons and potted and moved to indoor during the winters for last 3 years. The sample was subjected to a nematode extraction process, including decanting and sieving and misting, and lemon-shaped cysts and second-stage juveniles of Heterodera sp. were recovered from the sample examined. The morphological and molecular analyses of the cysts, vulval cone, and second-stage juveniles from both the roots and the crushed cysts identified the species as Heterodera fici Kirjanova. The cysts were characterized by their dark brown color and lemon shape, as well as distinct necks and vulval cones. The vulval cones were observed having an ambifenestrate fenestra (Fig. 1AFig. 1Photomicrographs of Heterodera fici on fig tree from Ontario, Canada. A, B. Cyst vulval cones with the ambifenestrate fenestra in A) and well-developed underbridge and bullae in B). C-E. The second-stage juveniles from a crushed cyst with the whole body in C), the anterior region in D) and the posterior region in E).), dome-shaped bullae scattered around the underbridge plane (Fig. 1B), well-developed underbridge (Fig. 1B), and coarse zig-zag ridges surrounding the fenestra on the surface. The cyst measurements ( n = 3) were length 608.7 ± 91.6 (506

  10. Detection of differentially methylated regions of irradiated fig tree selections

    Directory of Open Access Journals (Sweden)

    Maria Gabriela Fontanetti Rodrigues

    Full Text Available ABSTRACT Fig tree (Ficus carica L. breeding programs using conventional methods, such as directed crosses, to obtain new cultivars, are unworkable in many countries, including Brazil. Consequently, genetic breeding through mutagenesis has emerged as an important line of research that can improve this crop, and be a significant source of information about this species and assist in the implementation of propagation projects and appropriate management. The aim of this study was to verify the existence of epigenetic variability attributable to DNA methylation in irradiated fig selections when compared both to each other and to the main commercial cultivar, “Roxo-de-Valinhos”, which had previously used methylation-sensitive amplified polymorphism (MSAP and DNA sequencing to detect the position of polymorphic regions, analyzable by bioinformatic tools. The sequencing of DNA, isolated from the differentially methylated sites, makes it possible to observe different patterns of methylation by sequencing the treated DNA with sodium bisulfite in the coding regions of regulatory genes active in the development, and fruit ripening stages. Furthermore, they have been found in the mitochondrial DNA of treatments which regulate the supply of energy in Adenosine triphosphate (ATP form in plants. Closely related to their development, they justify the different phenotypes found in both fruit and plant growth that have suffered stress due to exposure to gamma radiation. Thus, future studies on gene expression in treatments have emerged as an extremely important strategy for understanding these complex regulatory systems, which may lead to the identification of genes of agricultural interest for the fig tree crop, and allow for manipulation and subsequent propagation of improved crops for commercial purposes.

  11. Detection of differentially methylated regions of irradiated fig tree selections

    International Nuclear Information System (INIS)

    Rodrigues, Maria Gabriela Fontanetti; Soares, Murilo Racy; Gimenez, Daniele Fernanda Jovino; Fonseca, Larissa Fernanda Simielli; Torrieri, Erico; Ramos, Ester Silveira; Giuliatti, Silvana; Universidade de Sao Paulo; Universidade Estadual Paulista Julio de Mesquita Filho

    2017-01-01

    Fig tree (Ficus carica L.) breeding programs using conventional methods, such as directed crosses, to obtain new cultivars, are unworkable in many countries, including Brazil. Consequently, genetic breeding through mutagenesis has emerged as an important line of research that can improve this crop, and be a significant source of information about this species and assist in the implementation of propagation projects and appropriate management. The aim of this study was to verify the existence of epigenetic variability attributable to DNA methylation in irradiated fig selections when compared both to each other and to the main commercial cultivar, 'Roxo-de-Valinhos', which had previously used methylation-sensitive amplified polymorphism (MSAP) and DNA sequencing to detect the position of polymorphic regions, analyzable by bioinformatic tools. The sequencing of DNA, isolated from the differentially methylated sites, makes it possible to observe different patterns of methylation by sequencing the treated DNA with sodium bisulfite in the coding regions of regulatory genes active in the development, and fruit ripening stages. Furthermore, they have been found in the mitochondrial DNA of treatments which regulate the supply of energy in Adenosine triphosphate (ATP) form in plants. Closely related to their development, they justify the different phenotypes found in both fruit and plant growth that have suffered stress due to exposure to gamma radiation. Thus, future studies on gene expression in treatments have emerged as an extremely important strategy for understanding these complex regulatory systems, which may lead to the identification of genes of agricultural interest for the fig tree crop, and allow for manipulation and subsequent propagation of improved crops for commercial purposes. (author)

  12. Detection of differentially methylated regions of irradiated fig tree selections

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Maria Gabriela Fontanetti; Soares, Murilo Racy; Gimenez, Daniele Fernanda Jovino; Fonseca, Larissa Fernanda Simielli; Torrieri, Erico; Ramos, Ester Silveira; Giuliatti, Silvana, E-mail: mariagabriela@dracena.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Dracena, SP (Brazil). Faculdade de Agricultura e Ciencias Tecnologicas; Universidade de Sao Paulo (FMRP/USP), Ribeirao Preto, SP (Brazil). Dept. de Genetica; Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Jaboticabal, SP (Brazil). Faculdade de Agricultura e Ciencias Veterinarias

    2017-07-15

    Fig tree (Ficus carica L.) breeding programs using conventional methods, such as directed crosses, to obtain new cultivars, are unworkable in many countries, including Brazil. Consequently, genetic breeding through mutagenesis has emerged as an important line of research that can improve this crop, and be a significant source of information about this species and assist in the implementation of propagation projects and appropriate management. The aim of this study was to verify the existence of epigenetic variability attributable to DNA methylation in irradiated fig selections when compared both to each other and to the main commercial cultivar, 'Roxo-de-Valinhos', which had previously used methylation-sensitive amplified polymorphism (MSAP) and DNA sequencing to detect the position of polymorphic regions, analyzable by bioinformatic tools. The sequencing of DNA, isolated from the differentially methylated sites, makes it possible to observe different patterns of methylation by sequencing the treated DNA with sodium bisulfite in the coding regions of regulatory genes active in the development, and fruit ripening stages. Furthermore, they have been found in the mitochondrial DNA of treatments which regulate the supply of energy in Adenosine triphosphate (ATP) form in plants. Closely related to their development, they justify the different phenotypes found in both fruit and plant growth that have suffered stress due to exposure to gamma radiation. Thus, future studies on gene expression in treatments have emerged as an extremely important strategy for understanding these complex regulatory systems, which may lead to the identification of genes of agricultural interest for the fig tree crop, and allow for manipulation and subsequent propagation of improved crops for commercial purposes. (author)

  13. Fig volatile compounds--a first comparative study.

    Science.gov (United States)

    Grison-Pigé, Laure; Hossaert-McKey, Martine; Greeff, Jaco M; Bessière, Jean-Marie

    2002-09-01

    We analysed the compounds of volatile blends released by receptive figs of twenty Ficus species to attract their specific pollinating wasps. In all, 99 different compounds were identified. The compounds are mainly terpenoids, aliphatic compounds and products from the shikimic acid pathway. In each species blend, there are few major compounds, which are generally common among floral fragrances. Most species blends also include rare compounds, but generally their proportion in the blend is low. A possible basis for species-specificity of Ficus-wasp interactions is discussed in relation to the patterns of volatiles found in this interspecies comparison. Copyright 2002 Elsevier Science Ltd.

  14. Acclimatization and leaf anatomy of micropropagated fig plantlets

    Directory of Open Access Journals (Sweden)

    Chrystiane Fráguas Chirinéa

    2012-12-01

    Full Text Available The survival of micropropagated plants during and after acclimatization is a limiting process to plant establishment. There is little information on how the anatomy of vegetative organs of Ficus carica can be affected by culture conditions and acclimatization. The present research aimed to study the effects of time on culture medium and substrates during the acclimatization of fig tree plantlets produced in vitro, characterizing some leaf anatomy aspects of plantlets cultured in vitro and of fig trees produced in field. Plantlets previously multiplied in vitro were separated and transferred into Wood Plant Medium (WPM where they were kept for 0, 15, 30, 45 and 60 days. Different substrates were tested and studies on leaf anatomy were performed in order to compare among plantlets grown in vitro, plantlets under 20, 40 and 60 days of acclimatization, and field grown plants. Keeping plantlets for 30 days in WPM allowed better development in Plantmax during acclimatization. Field grown plants presented higher number of stomata, greater epicuticular wax thickness and greater leaf tissue production compared to in vitro ones. The leaf tissues of in vitro plantlets show little differentiation and have great stomata number compared with acclimatized plants, which reduce the number of stomata during the acclimatization process.

  15. Expression and evolutionary divergence of the non-conventional olfactory receptor in four species of fig wasp associated with one species of fig

    Directory of Open Access Journals (Sweden)

    Xiao Jinhua

    2009-02-01

    Full Text Available Abstract Background The interactions of fig wasps and their host figs provide a model for investigating co-evolution. Fig wasps have specialized morphological characters and lifestyles thought to be adaptations to living in the fig's syconium. Although these aspects of natural history are well documented, the genetic mechanism(s underlying these changes remain(s unknown. Fig wasp olfaction is the key to host-specificity. The Or83b gene class, an unusual member of olfactory receptor family, plays a critical role in enabling the function of conventional olfactory receptors. Four Or83b orthologous genes from one pollinator (PFW (Ceratosolen solmsi and three non-pollinator fig wasps (NPFWs (Apocrypta bakeri, Philotrypesis pilosa and Philotrypesis sp. associated with one species of fig (Ficus hispida can be used to better understand the molecular mechanism underlying the fig wasp's adaptation to its host. We made a comparison of spatial tissue-specific expression patterns and substitution rates of one orthologous gene in these fig wasps and sought evidence for selection pressures. Results A newly identified Or83b orthologous gene was named Or2. Expressions of Or2 were restricted to the heads of all wingless male fig wasps, which usually live in the dark cavity of a fig throughout their life cycle. However, expressions were widely detected in the antennae, legs and abdomens of all female fig wasps that fly from one fig to another for oviposition, and secondarily pollination. Weak expression was also observed in the thorax of PFWs. Compared with NPFWs, the Or2 gene in C. solmsi had an elevated rate of substitutions and lower codon usage. Analyses using Tajima's D, Fu and Li's D* and F* tests indicated a non-neutral pattern of nucleotide variation in all fig wasps. Unlike in NPFWs, this non-neutral pattern was also observed for synonymous sites of Or2 within PFWs. Conclusion The sex- and species-specific expression patterns of Or2 genes detected beyond

  16. Phenological adaptations in Ficus tikoua exhibit convergence with unrelated extra-tropical fig trees.

    Directory of Open Access Journals (Sweden)

    Ting-Ting Zhao

    Full Text Available Flowering phenology is central to the ecology and evolution of most flowering plants. In highly-specific nursery pollination systems, such as that involving fig trees (Ficus species and fig wasps (Agaonidae, any mismatch in timing has serious consequences because the plants must balance seed production with maintenance of their pollinator populations. Most fig trees are found in tropical or subtropical habitats, but the dioecious Chinese Ficus tikoua has a more northerly distribution. We monitored how its fruiting phenology has adapted in response to a highly seasonal environment. Male trees (where fig wasps reproduce had one to three crops annually, whereas many seed-producing female trees produced only one fig crop. The timing of release of Ceratosolen fig wasps from male figs in late May and June was synchronized with the presence of receptive figs on female trees, at a time when there were few receptive figs on male trees, thereby ensuring seed set while allowing remnant pollinator populations to persist. F. tikoua phenology has converged with those of other (unrelated northern Ficus species, but there are differences. Unlike F. carica in Europe, all F. tikoua male figs contain male flowers, and unlike F. pumila in China, but like F. carica, it is the second annual generation of adult wasps that pollinate female figs. The phenologies of all three temperate fig trees generate annual bottlenecks in the size of pollinator populations and for female F. tikoua also a shortage of fig wasps that results in many figs failing to be pollinated.

  17. Sensory profiles for dried fig (Ficus carica L.) cultivars commercially grown and processed in California.

    Science.gov (United States)

    Haug, Megan T; King, Ellena S; Heymann, Hildegarde; Crisosto, Carlos H

    2013-08-01

    A trained sensory panel evaluated the 6 fig cultivars currently sold in the California dried fig market. The main flavor and aroma attributes determined by the sensory panel were "caramel," "honey," "raisin," and "fig," with additional aroma attributes: "common date," "dried plum," and "molasses." Sensory differences were observed between dried fig cultivars. All figs were processed by 2 commercial handlers. Processing included potassium sorbate as a preservative and SO2 application as an antibrowning agent for white cultivars. As a consequence of SO2 use during processing, high sulfite residues affected the sensory profiles of the white dried fig cultivars. Significant differences between dried fig cultivars and sources demonstrate perceived differences between processing and storage methods. The panel-determined sensory lexicon can help with California fig marketing. © 2013 The Regents of California, Davis Campus Department of Plant Sciences.

  18. Tracking the elusive history of diversification in plant-herbivorous insect-parasitoid food webs: insights from figs and fig wasps.

    Science.gov (United States)

    Kjellberg, Finn; Proffit, Magali

    2016-02-01

    The food webs consisting of plants, herbivorous insects and their insect parasitoids are a major component of terrestrial biodiversity. They play a central role in the functioning of all terrestrial ecosystems, and the number of species involved is mind-blowing (Nyman et al. 2015). Nevertheless, our understanding of the evolutionary and ecological determinants of their diversity is still in its infancy. In this issue of Molecular Ecology, Sutton et al. (2016) open a window into the comparative analysis of spatial genetic structuring in a set of comparable multitrophic models, involving highly species-specific interactions: figs and fig wasps. This is the first study to compare genetic structure using population genetics tools in a fig-pollinating wasp (Pleistodontes imperialis sp1) and its main parasitoid (Sycoscapter sp.A). The fig-pollinating wasp has a discontinuous spatial distribution that correlates with genetic differentiation, while the parasitoid bridges the discontinuity by parasitizing other pollinator species on the same host fig tree and presents basically no spatial genetic structure. The full implications of these results for our general understanding of plant-herbivorous insect-insect parasitoids diversification become apparent when envisioned within the framework of recent advances in fig and fig wasp biology. © 2016 John Wiley & Sons Ltd.

  19. Philippine Fig wasps 1. Records and descriptions of Otitesellini (Hymenoptera Chalcidoidea, Torymidae)

    NARCIS (Netherlands)

    Wiebes, J.T.

    1974-01-01

    In 1964, by awarding to me that year's proceeds of the "Pieter Langerhuizen Fonds", the Hollandsche Maatschappij der Wetenschappen enabled me to study figs and fig wasps in the Philippines. While several Philippine fig wasps are already known from the papers by Ashmead (1904, 1905), Brown (1906),

  20. FigS7.txt

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is an ascii file with georeferencing information containing the data plotted in Figure S7 of the supplemental information manuscript section. This dataset is...

  1. FigS8.txt

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is an ASCII file with georeferencing information containing data plotted in Figure S8 of the supplemental information section of the manuscript. This dataset is...

  2. Efficacy of Tissue Culture in Virus Elimination from Caprifig and Female Fig Varieties (Ficus carica L.

    Directory of Open Access Journals (Sweden)

    Chokri Bayoudh

    2017-06-01

    Full Text Available Fig mosaic disease (FMD is a viral disease that spreads in all Tunisian fig (Ficus carica L. orchards. RT-PCR technique was applied to leaf samples of 29 fig accessions of 15 fig varieties from the fig germplasm collection of High Agronomic Institute (I.S.A of Chatt-Mariem, to detect viruses associated to FMD. Analysis results show that 65.5% of the accessions (19/29 and 80.0% (12/15 of the fig varieties are infected by FMD-associated viruses. From all fig accessions, 41.4% of them are with single infection (one virus and 24.1% are with multi-infections (2 virus and more. Viruses infecting fig leaf samples are Fig mosaic virus (FMV (20.7%, Fig milde-mottle-associated virus (FMMaV (17.25%, Fig fleck associated virus (FFkaV (3.45%, and Fig cryptic virus (FCV (55.17%. A reliable protocol for FCV and FMMaV elimination from 4 local fig varieties Zidi (ZDI, Soltani (SNI, Bither Abiadh (BA, and Assafri (ASF via in vitro culture of 3 meristem sizes was established and optimized. With this protocol, global sanitation rates of 79.46%, 65.55%, 68.75%, and 70.83% respectively for ZDI, SNI, BA, and ASF are achieved. For all sanitized varieties, the effectiveness of meristem culture for the elimination of FCV and FMMaV viruses was related to meristem size. Meristem size 0.5 mm provides the highest sanitation rates ranging from 70% to 90%.

  3. Partial avoidance of female inflorescences of a dioecious fig by their mutualistic pollinating wasps

    Science.gov (United States)

    Anstett, M. C.; Gibernau, M.; Hossaert-McKey, M.

    1998-01-01

    Every dioecious species of fig is pollinated by a specific wasp that only reproduces within the inflorescences of male trees. Pollinators usually die within the closed urn-shaped inflorescence (fig or syconium) they visit. Thus pollinators that enter female syconia allow seed production but die without reproducing. In a previous study, pollinators of one dioecious fig where male and female trees flower synchronously, Ficus hispida, did not exhibit differential attraction or choice between inflorescences of the two sexes. Here we show that Blastophaga psenes, the pollinator of another dioecious species of different lineage, the common fig (F. carica), significantly avoided female syconia, when we experimentally induce a situation of choice. Paradoxically, choosiness can be demonstrated in F. carica where usually wasps do not face a choice because male and female trees do not flower synchronously. We discuss how the mutualism may be stable despite this discrimination and hypothesize why the two species of fig-pollinators exhibit different behaviour on dioecious figs.

  4. Fig juice Fortified with Inulin and Lactobacillus Delbrueckii: A Promising Functional Food

    Directory of Open Access Journals (Sweden)

    Sima Khezri

    2018-03-01

    Full Text Available Background and Objective: Nowadays, consumption of functional foods is favored because of their health promoting characteristics. Also there is an increasing demand for nondairy products because of lactose intolerance in dairies. Fig juice as a source of dietary fiber and other nutrients would be a functional food. Adding probiotics and prebiotics makes it more functional for daily use. No study has yet been done on synbiotic fig juice. Accordingly, the aim of this study was to characterize synbiotic fig juice prepared by Lactobacillus delbrueckii and inulin.Material and Methods: Samples consisted of control fig juice; fig juice fermented by Lactobacillus delbrueckii (probiotic and fig juice containing inulin fermented by Lactobacillus delbrueckii (synbiotic were produced. Physico-chemical parameters, total phenolic content, antioxidant capacity and microbial survival aspects were analyzed during the fermentation period. Aforementioned parameters were also evaluated in 4 weeks with one-week time intervals. Sensory characteristics of fig juices were assessed in the second week of storage.Results and Conclusion: The results showed significant differences among treatments (p≤0.05 in physico-chemical indices during incubation and storage time. Total phenolic content and antioxidant capacity of fermented fig juices were significantly increased in comparison to the control samples (p≤0.05. Viability of Lactobacillus delbrueckii was increased in both probiotic and synbiotic treatments during incubation; but a significant reduction was observed during storage time. Sensory analysis revealed that there were significant differences in terms of odor, taste and overall acceptance between the fermented fig juices and control (p≤0.05 and the highest scores were obtained for control. Considering viable counts of Lactobacillus delbrueckii depicted that fermented fig juice could be a suitable medium for survival and proliferation of Lactobacillus

  5. Codivergence and multiple host species use by fig wasp populations of the Ficus pollination mutualism

    Directory of Open Access Journals (Sweden)

    McLeish Michael J

    2012-01-01

    Full Text Available Abstract Background The interaction between insects and plants takes myriad forms in the generation of spectacular diversity. In this association a species host range is fundamental and often measured using an estimate of phylogenetic concordance between species. Pollinating fig wasps display extreme host species specificity, but the intraspecific variation in empirical accounts of host affiliation has previously been underestimated. In this investigation, lineage delimitation and codiversification tests are used to generate and discuss hypotheses elucidating on pollinating fig wasp associations with Ficus. Results Statistical parsimony and AMOVA revealed deep divergences at the COI locus within several pollinating fig wasp species that persist on the same host Ficus species. Changes in branching patterns estimated using the generalized mixed Yule coalescent test indicated lineage duplication on the same Ficus species. Conversely, Elisabethiella and Alfonsiella fig wasp species are able to reproduce on multiple, but closely related host fig species. Tree reconciliation tests indicate significant codiversification as well as significant incongruence between fig wasp and Ficus phylogenies. Conclusions The findings demonstrate more relaxed pollinating fig wasp host specificity than previously appreciated. Evolutionarily conservative host associations have been tempered by horizontal transfer and lineage duplication among closely related Ficus species. Independent and asynchronistic diversification of pollinating fig wasps is best explained by a combination of both sympatric and allopatric models of speciation. Pollinator host preference constraints permit reproduction on closely related Ficus species, but uncertainty of the frequency and duration of these associations requires better resolution.

  6. KARAKTERISTIK MORFOLOGI SERTA PERKEMBANGAN FIG NYAWAI (Ficus variegata Blume DI KEBUN RAYA CIBODAS

    Directory of Open Access Journals (Sweden)

    Agus Astho Pramono

    2015-12-01

    Full Text Available Nyawai (Ficus variegata Blume merupakan salah satu jenis pohon yang memiliki prospek yang baik untuk hutan tanaman. Informasi tentang aspek biologi reproduksinya masih terbatas. Penelitian ini bertujuan untuk mengetahui karakteristik morfologi bunga dan buah nyawai, serta tahapan perkembangan fig. Penelitian dilakukan di Kebun Raya Cibodas, Jawa Barat. Kegiatan penelitian meliputi: 1 pengamatan morfologi bunga dan buah, dan 2 pengamatan perkembangan fig. Hasil penelitian menunjukkan bahwa karakteristik morfologi fig nyawai yang dijumpai di Kebun Raya Cibodas, memiliki variasi yang tinggi dalam hal ukuran dan warna. Berdasarkan karakteristik morfologi bunga, secara individual ditemui dua tipe pohon yang mencirikan sebagai pohon menghasilkan bunga jantan dan penghasil bunga betina. Perbedaan antara tahap bunga, buah muda, dan buah matang tidak dapat dibakukan berdasarkan karakteristik morfologi eksternal dari fig. Tingkat kematangan buah nyawai dapat dilakukan dengan membelah fig. Nyawai tahap kuncup bunga berakhir sekitar 6-11 hari setelah munculya tunas fig, dan tahap bunga berakhir 11-26 hari. Perkembangan kuncup bunga menjadi buah yang matang memakan waktu sekitar 2-3 bulan. Hasil penelitian menyarankan untuk tidak mengumpulkan benih dari fig yang berukuran kecil, meskipun mereka memiliki karakteristik fisik fig yang matang.

  7. Competitive exclusion among fig wasps achieved via entrainment of host plant flowering phenology.

    Directory of Open Access Journals (Sweden)

    Min Liu

    Full Text Available Molecular techniques are revealing increasing numbers of morphologically similar but co-existing cryptic species, challenging the niche theory. To understand the co-existence mechanism, we studied phenologies of morphologically similar species of fig wasps that pollinate the creeping fig (F. pumila in eastern China. We compared phenologies of fig wasp emergence and host flowering at sites where one or both pollinators were present. At the site where both pollinators were present, we used sticky traps to capture the emerged fig wasps and identified species identity using mitochondrial DNA COI gene. We also genotyped F. pumila individuals of the three sites using polymorphic microsatellites to detect whether the host populations were differentiated. Male F. pumila produced two major crops annually, with figs receptive in spring and summer. A small partial third crop of receptive figs occurred in the autumn, but few of the second crop figs matured at that time. Hence, few pollinators were available to enter third crop figs and they mostly aborted, resulting in two generations of pollinating wasps each year, plus a partial third generation. Receptive figs were produced on male plants in spring and summer, timed to coincide with the release of short-lived adult pollinators from the same individual plants. Most plants were pollinated by a single species. Plants pollinated by Wiebesia sp. 1 released wasps earlier than those pollinated by Wiebesia sp. 3, with little overlap. Plants occupied by different pollinators were not spatially separated, nor genetically distinct. Our findings show that these differences created mismatches with the flight periods of the other Wiebesia species, largely 'reserving' individual plants for the resident pollinator species. This pre-emptive competitive displacement may prevent long term co-existence of the two pollinators.

  8. Water availability determines the richness and density of fig trees within Brazilian semideciduous forest landscapes

    Science.gov (United States)

    Coelho, Luís Francisco Mello; Ribeiro, Milton Cezar; Pereira, Rodrigo Augusto Santinelo

    2014-05-01

    The success of fig trees in tropical ecosystems is evidenced by the great diversity (+750 species) and wide geographic distribution of the genus. We assessed the contribution of environmental variables on the species richness and density of fig trees in fragments of seasonal semideciduous forest (SSF) in Brazil. We assessed 20 forest fragments in three regions in Sao Paulo State, Brazil. Fig tree richness and density was estimated in rectangular plots, comprising 31.4 ha sampled. Both richness and fig tree density were linearly modeled as function of variables representing (1) fragment metrics, (2) forest structure, and (3) landscape metrics expressing water drainage in the fragments. Model selection was performed by comparing the AIC values (Akaike Information Criterion) and the relative weight of each model (wAIC). Both species richness and fig tree density were better explained by the water availability in the fragment (meter of streams/ha): wAICrichness = 0.45, wAICdensity = 0.96. The remaining variables related to anthropic perturbation and forest structure were of little weight in the models. The rainfall seasonality in SSF seems to select for both establishment strategies and morphological adaptations in the hemiepiphytic fig tree species. In the studied SSF, hemiepiphytes established at lower heights in their host trees than reported for fig trees in evergreen rainforests. Some hemiepiphytic fig species evolved superficial roots extending up to 100 m from their trunks, resulting in hectare-scale root zones that allow them to efficiently forage water and soil nutrients. The community of fig trees was robust to variation in forest structure and conservation level of SSF fragments, making this group of plants an important element for the functioning of seasonal tropical forests.

  9. Land use history and population dynamics of free-standing figs in a maturing forest.

    Directory of Open Access Journals (Sweden)

    Larissa Albrecht

    Full Text Available Figs (Ficus sp. are often considered as keystone resources which strongly influence tropical forest ecosystems. We used long-term tree-census data to track the population dynamics of two abundant free-standing fig species, Ficus insipida and F. yoponensis, on Barro Colorado Island (BCI, a 15.6-km2 island in Lake Gatún, Panama. Vegetation cover on BCI consists of a mosaic of old growth (>400 years and maturing (about 90-150 year old secondary rainforest. Locations and conditions of fig trees have been mapped and monitored on BCI for more than 35 years (1973-2011, with a focus on the Lutz Catchment area (25 ha. The original distribution of the fig trees shortly after the construction of the Panama Canal was derived from an aerial photograph from 1927 and was compared with previous land use and forest status. The distribution of both fig species (~850 trees is restricted to secondary forest. Of the original 119 trees observed in Lutz Catchment in 1973, >70% of F. insipida and >90% of F. yoponensis had died by 2011. Observations in other areas on BCI support the trend of declining free-standing figs. We interpret the decline of these figs on BCI as a natural process within a maturing tropical lowland forest. Senescence of the fig trees appears to have been accelerated by severe droughts such as the strong El Niño event in the year 1982/83. Because figs form such an important food resource for frugivores, this shift in resource availability is likely to have cascading effects on frugivore populations.

  10. FiGS: a filter-based gene selection workbench for microarray data

    Directory of Open Access Journals (Sweden)

    Yun Taegyun

    2010-01-01

    Full Text Available Abstract Background The selection of genes that discriminate disease classes from microarray data is widely used for the identification of diagnostic biomarkers. Although various gene selection methods are currently available and some of them have shown excellent performance, no single method can retain the best performance for all types of microarray datasets. It is desirable to use a comparative approach to find the best gene selection result after rigorous test of different methodological strategies for a given microarray dataset. Results FiGS is a web-based workbench that automatically compares various gene selection procedures and provides the optimal gene selection result for an input microarray dataset. FiGS builds up diverse gene selection procedures by aligning different feature selection techniques and classifiers. In addition to the highly reputed techniques, FiGS diversifies the gene selection procedures by incorporating gene clustering options in the feature selection step and different data pre-processing options in classifier training step. All candidate gene selection procedures are evaluated by the .632+ bootstrap errors and listed with their classification accuracies and selected gene sets. FiGS runs on parallelized computing nodes that capacitate heavy computations. FiGS is freely accessible at http://gexp.kaist.ac.kr/figs. Conclusion FiGS is an web-based application that automates an extensive search for the optimized gene selection analysis for a microarray dataset in a parallel computing environment. FiGS will provide both an efficient and comprehensive means of acquiring optimal gene sets that discriminate disease states from microarray datasets.

  11. Fig Juice Fermented with Lactic Acid Bacteria as a Nutraceutical Product

    Directory of Open Access Journals (Sweden)

    Sima Khezri 1, Parvin Dehghan 2 * , Razzagh Mahmoudi 3, Mahdi Jafarlou 4

    2016-12-01

    Full Text Available Background: Probiotics are live microorganisms bringing useful effects to the host through balancing intestine microbiota. This research was undertaken to determine the suitability of fig juice as raw material for production of probiotic juice by three species of lactic acid bacteria (Lactobacillus casei, Lactobacillus plantarum and Lactobacillus delbrueckii. Methods: Heat treated fig juices were inoculated (6 log CFU/ml by three species inocula separately and incubated at 30 °C for 72 h. Changes in the pH, acidity, reducing sugar content and viable cell counts during the fermentation were monitored. Sensory characteristics of probiotic fig juice were also evaluated. Results: L. delbrueckii grew well on fig juice; reached nearly 9 log CFU/ml after 48 h of fermentation at 30 °C. After 4 weeks of cold storage at 4 °C, the viable cell counts of L. delbrueckii and L. plantarum were still 6 and 5 log CFU/ml, respectively, in fermented fig juice; but L. casei was just survived until 2th week of cold storage time, reduced from 9 to 3 log CFU/ml. The results of the sensory evaluation showed that fermented fig juice samples were significantly different (P<0.05 from the control sample in taste, odor, consistency and overall acceptability. L. casei was more acceptable comparing to the others. Conclusion: L. delbrueckii was the most suitable strain from the point of survivability among other species at the consumption time. Therefore, probiotic fig juice can serve as healthy beverage for vegetarians and consumers with lactose-allergy.

  12. Why mutualist partners vary in quality: mutation-selection balance and incentives to cheat in the fig tree-fig wasp mutualism.

    Science.gov (United States)

    Jandér, K Charlotte; Steidinger, Brian S

    2017-07-01

    Mutualisms between species are ecologically ubiquitous but evolutionarily puzzling. Host discrimination mechanisms that reduce the fitness of uncooperative symbionts can stabilise mutualism against collapse, but also present a paradox - if discrimination is effective, why do uncooperative symbionts persist? Here, we test whether mutations or fitness benefits of cheating best explain the prevalence of uncooperative wasps in the fig tree-fig wasp mutualism. By combining theory with field-collected data we demonstrate that the proportions of pollen-free wasps of strongly discriminating hosts are reached with reasonable mutation rates. In contrast, in weakly discriminating hosts, the required mutation rates, assuming a single locus, are untenably high, but the required cheater advantages fall within expected ranges. We propose that when discrimination is weak, uncooperative symbionts proliferate until they reach the equilibrium proportion that balances costs and benefits of cheating. Our results suggest that mechanisms that resolve the paradox of uncooperative symbionts differ among host species. © 2017 John Wiley & Sons Ltd/CNRS.

  13. PHENOLOGY AND YIELD OF THE ‘ROXO DE VALINHOS’ FIG CULTIVAR IN WESTERN POTIGUAR

    Directory of Open Access Journals (Sweden)

    FRANCISCO SIDENE OLIVEIRA SILVA

    2017-01-01

    Full Text Available The ‘Roxo de Valinhos’ fig is one of the most widely grown varieties in the world, however, there are still few studies on the phenology and yield of fig trees, especially in semi-arid regions. This study evaluated the phenology and yield aspects of the ‘Roxo de Valinhos’ fig cultivar in Western Potiguar. The experiment was carried out from July to December 2015 in the didactic orchard of the Federal Rural University of the Semi-Arid, UFERSA. The following phenological aspects were analyzed: pruning at the beginning of budding, emergence and maturity of the first fruit, beginning of harvest, length and diameter of branches, number of fruits per branch, length and diameter of fruits, absolute growth rate, yield per plant, number of fruits per plant, and fruit weight. We used descriptive statistics; for quantitative and qualitative characteristics, we used regression analysis and means test, through Tukey´s test at 5% probability. Fig trees showed good adaptability to semi-arid regions and precocity when compared to fig trees from temperate regions, in all phenological stages; the studied cultivar showed promising results for cultivation in this region.

  14. Metatranscriptome Analysis of Fig Flowers Provides Insights into Potential Mechanisms for Mutualism Stability and Gall Induction.

    Directory of Open Access Journals (Sweden)

    Ellen O Martinson

    Full Text Available A striking property of the mutualism between figs and their pollinating wasps is that wasps consistently oviposit in the inner flowers of the fig syconium, which develop into galls that house developing larvae. Wasps typically do not use the outer ring of flowers, which develop into seeds. To better understand differences between gall and seed flowers, we used a metatranscriptomic approach to analyze eukaryotic gene expression within fig flowers at the time of oviposition choice and early gall development. Consistent with the unbeatable seed hypothesis, we found significant differences in gene expression between gall- and seed flowers in receptive syconia prior to oviposition. In particular, transcripts assigned to flavonoids and carbohydrate metabolism were significantly up-regulated in gall flowers relative to seed flowers. In response to oviposition, gall flowers significantly up-regulated the expression of chalcone synthase, which previously has been connected to gall formation in other plants. We propose several genes encoding proteins with signal peptides or associations with venom of other Hymenoptera as candidate genes for gall initiation or growth. This study simultaneously evaluates the gene expression profile of both mutualistic partners in a plant-insect mutualism and provides insight into a possible stability mechanism in the ancient fig-fig wasp association.

  15. Studies of maturation fig (Ficus carica L.) treated with ionizing radiation

    International Nuclear Information System (INIS)

    Domarco, Rachel E.; Spotp, Maria H.F.; Blumer, Lucimara; Walder, Julio M.M.; Matraia, Clarice

    1997-01-01

    The effect of irradiation dose, temperature and periods of storage were analized on figs type Ramy (harvest in post-climateric stage) and type Exportation (harvest on climate stage). The figs were packed in carton boxes and irradiated with 0.0 and 1,5 kGy, a source of Cobalt-60, type Gammabeam-650, was utilized. After the irradiation, the samples were stored at room temperature (± 22 0 C) and under refrigeration ±8 0 C). The samples were analised by physic and chemical analysis (soluble solids, pH, titulable acidity and ratio) after 3, 7, 13, 20 and 26 days of storage. The Rami showed higher soluble solids, pH and ratio, of type Exportation. The radiation dose effects caused small variations in all caracteristics. The soluble solids, pH and ratio increased with radiation dose, but titulable acidity decreased for both types of figs. It was observed an increased on soluble solids, titulable acidity and pH for Ramy and Exportation. The color was influenced by type of fig, radiation dose and storage period of storage. There was change in coler with high radiation dose. (author). 5 refs., 7 figs

  16. Radiation processing as a post-harvest quarantine control for raisins, dried figs and dried apricots

    International Nuclear Information System (INIS)

    Cetinkaya, N.; Ozyardimci, B.; Denli, E.; Ic, E.

    2006-01-01

    The commercially packed samples of raisins, dried figs and dried apricots were irradiated using doses in the range of 0.5-1.0 kGy for disinfestation and 0.5-5.0 kGy for sensory analysis with the dose rate ranging from 1.44 to 1.92 kGy/h. Pests on dried fruits were evaluated after 0, 1, 2 and 3 months of storage for irradiated dried figs and 1, 3, 6 and 12 months of storage for raisins and dried apricots. Sensory analysis of dried figs, dried apricots and raisins were carried out after 0, 1, 3, 6 and 12 months of storage. The results indicated that radiation processing at low doses (∼1.0 kGy) is an effective post-harvest treatment and quarantine control for these products with no adverse effects on sensory (marketing) attributes

  17. Radiation processing as a post-harvest quarantine control for raisins, dried figs and dried apricots

    Energy Technology Data Exchange (ETDEWEB)

    Cetinkaya, N. [TAEA, Ankara Nuclear Research Center in Agriculture and Animal Sciences, 06983 Ankara (Turkey)]. E-mail: nurcet@taek.gov.tr; Ozyardimci, B. [TAEA, Ankara Nuclear Research Center in Agriculture and Animal Sciences, 06983 Ankara (Turkey); Denli, E. [TAEA, Ankara Nuclear Research Center in Agriculture and Animal Sciences, 06983 Ankara (Turkey); Ic, E. [TAEA, Ankara Nuclear Research Center in Agriculture and Animal Sciences, 06983 Ankara (Turkey)

    2006-03-15

    The commercially packed samples of raisins, dried figs and dried apricots were irradiated using doses in the range of 0.5-1.0 kGy for disinfestation and 0.5-5.0 kGy for sensory analysis with the dose rate ranging from 1.44 to 1.92 kGy/h. Pests on dried fruits were evaluated after 0, 1, 2 and 3 months of storage for irradiated dried figs and 1, 3, 6 and 12 months of storage for raisins and dried apricots. Sensory analysis of dried figs, dried apricots and raisins were carried out after 0, 1, 3, 6 and 12 months of storage. The results indicated that radiation processing at low doses ({approx}1.0 kGy) is an effective post-harvest treatment and quarantine control for these products with no adverse effects on sensory (marketing) attributes.

  18. Ficus religiosa L. (English: Peepal tree or sacred fig; Hindi: Pippal ...

    Indian Academy of Sciences (India)

    Fruits are fig-like, globose, small and purplish when ripe. The bark is astringent, sweet, aphrodisiac and the aqueous extract of it is antibacterial. Leaves and tender shoots are recommended for wounds and skin diseases. Pulverised dried fruit taken in water cures asthma. The latex is good for neuralgia, inflammations and ...

  19. Red barons or robber barons? : governance and financing in Russian FIGS

    NARCIS (Netherlands)

    Perotti, E.C.; Gelfer, S.

    1999-01-01

    We study the governance role of Russian Financial-Industrial Groups (FIG) and their impact on financing of investment. We compare member firms of a group with a control set of large firms categorized by dispersed ownership or/and management and employee control. We find that investment is sensitive

  20. Ficus religiosa L. (English: Peepal tree or sacred fig; Hindi: Pippal ...

    Indian Academy of Sciences (India)

    Ficus religiosa L. (English: Peepal tree or sacred fig; Hindi: Pippal) of Moraceae is a large deciduous tree that grows wild as well as cultivated. The picture shows the tree with fresh flush of leaves. The tree is planted chiefly near the temples by Hindus and Buddhists who regard it as sacred. The characteristic heart-shaped ...

  1. Chlorophyll metabolism in pollinated vs. parthenocarpic fig fruits throughout development and ripening.

    Science.gov (United States)

    Rosianskey, Yogev; Dahan, Yardena; Yadav, Sharawan; Freiman, Zohar E; Milo-Cochavi, Shira; Kerem, Zohar; Eyal, Yoram; Flaishman, Moshe A

    2016-08-01

    Expression of 13 genes encoding chlorophyll biosynthesis and degradation was evaluated. Chlorophyll degradation was differentially regulated in pollinated and parthenocarpic fig fruits, leading to earlier chlorophyll degradation in parthenocarpic fruits. Varieties of the common fig typically yield a commercial summer crop that requires no pollination, although it can be pollinated. Fig fruit pollination results in larger fruit size, greener skin and darker interior inflorescence color, and slows the ripening process compared to non-pollinated fruits. We evaluated the effect of pollination on chlorophyll content and levels of transcripts encoding enzymes of the chlorophyll metabolism in fruits of the common fig 'Brown Turkey'. We cloned and evaluated the expression of 13 different genes. All 13 genes showed high expression in the fruit skin, inflorescences and leaves, but extremely low expression in roots. Pollination delayed chlorophyll breakdown in the ripening fruit skin and inflorescences. This was correlated with the expression of genes encoding enzymes in the chlorophyll biosynthesis and degradation pathways. Expression of pheophorbide a oxygenase (PAO) was strongly negatively correlated with chlorophyll levels during ripening in pollinated fruits; along with its high expression levels in yellow leaves, this supports a pivotal role for PAO in chlorophyll degradation in figs. Normalizing expression levels of all chlorophyll metabolism genes in the pollinated and parthenocarpic fruit skin and inflorescences showed three synthesis (FcGluTR1, FcGluTR2 and FcCLS1) and three degradation (FcCLH1, FcCLH2 and FcRCCR1) genes with different temporal expression in the pollinated vs. parthenocarpic fruit skin and inflorescences. FcCAO also showed different expressions in the parthenocarpic fruit skin. Thus, chlorophyll degradation is differentially regulated in the pollinated and parthenocarpic fruit skin and inflorescences, leading to earlier and more sustained

  2. Semivariogram models for estimating fig fly population density throughout the year

    Directory of Open Access Journals (Sweden)

    Mauricio Paulo Batistella Pasini

    2014-07-01

    Full Text Available The objective of this work was to select semivariogram models to estimate the population density of fig fly (Zaprionus indianus; Diptera: Drosophilidae throughout the year, using ordinary kriging. Nineteen monitoring sites were demarcated in an area of 8,200 m2, cropped with six fruit tree species: persimmon, citrus, fig, guava, apple, and peach. During a 24 month period, 106 weekly evaluations were done in these sites. The average number of adult fig flies captured weekly per trap, during each month, was subjected to the circular, spherical, pentaspherical, exponential, Gaussian, rational quadratic, hole effect, K-Bessel, J-Bessel, and stable semivariogram models, using ordinary kriging interpolation. The models with the best fit were selected by cross-validation. Each data set (months has a particular spatial dependence structure, which makes it necessary to define specific models of semivariograms in order to enhance the adjustment to the experimental semivariogram. Therefore, it was not possible to determine a standard semivariogram model; instead, six theoretical models were selected: circular, Gaussian, hole effect, K-Bessel, J-Bessel, and stable.

  3. Interlaboratory comparison of fig (Ficus carica L. microsatellite genotyping data and determination of reference alleles

    Directory of Open Access Journals (Sweden)

    Matjaž HLADNIK

    2018-04-01

    Full Text Available Microsatellites have been identified as the marker of choice in plant genotyping projects. However, due to length discrepancies obtained between different laboratories for the same allele, interlaboratory comparison of fingerprinting results is often a difficult task. The objectives of this study were to compare genotyping results of two laboratories, to evaluate genetic parameters of microsatellite markers and to determine reference allele sizes for fig cultivars from the Istrian peninsula.Genotyping results of ninety fig (Ficus carica L. accessions were comparable between the laboratories despite differences observed when comparing electropherograms of different capillary electrophoresis systems. Differences in lengths of the same alleles were detected due to different PCR methods and laboratory equipment, but the distances between alleles of the same locus were preserved. However, locus FSYC01 exhibited one allele dropout which led to misidentification of 28 heterozygotes as homozygote individuals suggesting this locus as unreliable. Allele dropout was assigned to the tail PCR technology or to a touchdown PCR protocol.Genotypes of twenty-four reference cultivars from the Istrian peninsula were confirmed by both laboratories. These results will contribute to the usage of markers with greater reliability, discrimination power and consequently, to more reliable standardization with other fig genotyping projects.

  4. YIELD OF COMMON FIG FERTIGATED WITH BOVINE BIOFERTILIZER IN THE SEMIARID REGION OF CEARÁ

    Directory of Open Access Journals (Sweden)

    FRANCISCO LIMEIRA DA SILVA

    2016-01-01

    Full Text Available The objective was to evaluate the productivity of the fig tree the organic fertirrigation cattle under different environmental conditions in Ceará semiarid region. The experiment was conducted in the experimental area of the Teaching Unit, Research and Extension, the IFCE, North Lemon Tree, EC. The experimental design was a randomized complete block design with split plots, with four replications and three plants per plot. The plots consisted of three rooms (full sun - PS; trellis - LT and greenhouse - EST, the subplots, the concentrations of bovine biofertilizer diluted in water in the following concentrations: T0 (0% of biofertilizer + 100% water; T1 (20% biofertilizer 80 +% water; T2 (40% biofertilizer + 60% water, T3 (60% biofertiliante + 40% water and subsubplot, the production cycles. The variables were evaluated: average fruit weight, fruit diameter, number of fruits per plant and yield. The cultivation environments (greenhouse and trellis promote better performance on average mass and diameter of the fruit compared to plants grown in full sun during the production cycles of the fig crop grown in Ceará semiarid region. The bovine biofertilizer in the concentration of 60% promoted the highest mass, diameter, number of fruits per plant and the fig crop yield.

  5. FigSum: automatically generating structured text summaries for figures in biomedical literature.

    Science.gov (United States)

    Agarwal, Shashank; Yu, Hong

    2009-11-14

    Figures are frequently used in biomedical articles to support research findings; however, they are often difficult to comprehend based on their legends alone and information from the full-text articles is required to fully understand them. Previously, we found that the information associated with a single figure is distributed throughout the full-text article the figure appears in. Here, we develop and evaluate a figure summarization system - FigSum, which aggregates this scattered information to improve figure comprehension. For each figure in an article, FigSum generates a structured text summary comprising one sentence from each of the four rhetorical categories - Introduction, Methods, Results and Discussion (IMRaD). The IMRaD category of sentences is predicted by an automated machine learning classifier. Our evaluation shows that FigSum captures 53% of the sentences in the gold standard summaries annotated by biomedical scientists and achieves an average ROUGE-1 score of 0.70, which is higher than a baseline system.

  6. Figs Are More Than Fallback Foods: The Relationship between Ficus and Cebus in a Tropical Dry Forest

    Directory of Open Access Journals (Sweden)

    Nigel A. Parr

    2011-01-01

    Full Text Available In many studies on primate feeding ecology, figs (Ficus spp. are characterized as fallback foods, utilized only when preferred sources of food are unavailable. However, for white-faced capuchin monkeys (Cebus capucinus living in northwestern Costa Rica, figs are a consistently important resource and may increase groupwide energy intake. We investigated whether visits to figs affect ranging and behavioural patterns of capuchins. Although daily range length and average travel speed do not differ on days when fig trees are visited, capuchins spend more time in directed travel and more time stationary on “fig days”. Capuchins also increase time spent foraging for fruit and decrease time spent foraging for invertebrates on days when figs trees are visited. Capuchins experience higher energy intake and lower energy output on “fig” days. Thus, the patterns of foraging for figs support an energy-maximization strategy and constitute an important nutritional resource for capuchins.

  7. Physical-chemical characteristics of figs (Ficus carica) preready to submitted to ionizing radiation

    International Nuclear Information System (INIS)

    Silva, Lucia C.A.S.; Harder, Marcia N.C.; Arthur, Paula B.; Lima, Roberta B.; Modlo, Debora M.; Arthur, Valter

    2009-01-01

    Fig (Ficus carica) is the fruit of the fig tree, original of Mediterranean, has fleshy and succulent pulp, besides being sweetened slightly. It is very appreciated for dessert. The immature form (green) can be used for make a sweet home-made. The aim of the present work was irradiate samples of fruits of pre-ready green fig, seeking the increase of the useful shelf-life. The samples were washed, made hygienic and submitted the cooking by a period of 15 minutes, after the cooking they were put in an drainer to expect cooling the fruits and after that process they were wrapped in plastic sack of 15x30cm and sealed in a manual sealing and stored at 8 deg C in a OBD camera for 7 days. Later samples were irradiated with doses of: 0 (control); 1.0 and 2.0 kGy, under a rate of dose of 0.601 kGy/h, in a Gammacell-220 irradiator and stored by 24 hours to 8 deg C in OBD. Each treatment was consisted with 3 repetitions with 10 fruits each. The samples were appraised, immediately after the irradiation, as for the parameters pH, soluble solids content, color peel, color pulp, texture, chlorophyll A, chlorophyll B and total carotenoids. The statistical analysis of the results was accomplished, through outline entirely randomized by test F for variance analysis and when significant compared by Tuckey test. By the obtained results was concluded that there was not significant difference between the treatments and the control. After four days the samples presented microbiological contamination, they went desecrated. (author)

  8. Rooting of hardwood cuttings of Roxo de Valinhos fig (Ficus carica L. with different propagation strategies

    Directory of Open Access Journals (Sweden)

    Gilmar Antônio Nava

    2014-12-01

    Full Text Available The objective of this study was to evaluate the substrate, cuttings collection time, the position and the cutting depth, and the propagation environment on rooting of 'Purple Valinhos' fig tree cuttings in Southwestern Paraná, Brazil. Two experiments were carried out at UTFPR, Câmpus Dois Vizinhos, with hardwoods cuttings from Roxo de Valinhos fig tree. The first experiment used a randomized block design, in 3 x 3 x 2 factorial (substrate x environment x collection time, with four replications of 10 cuttings per plot. The cuttings were collected in the first fifteen days of July and August. The substrates were sand, soil and the mixture of these [1:1 (v / v]. The environments used were open sky, tunnel with plastic cover and tunnel with half-shade black net cover. The second experiment used a randomized block design, 2 x 2 x 3 factorial (shoot cutting position x soil cover x shoot cutting depth, with four replications of 12 cuttings per plot. In the factor position, the vertically (0 º inclination and inclined (45 º inclination shoot cuttings were evaluated. Soil cover was tested with mulching plastic cover or not. The tested depths were 1/3, 1/2 and 2/3 in relation to the total length of the shoot cutting. In both experiments, the following were analyzed: rooting and mortality indices, number of leaves and primary shoots, length of the three largest roots per cutting. It was conclude that, the protected environment with plastic cover on sand as substrate must recommended for the rooting of fig estaca, collecting them in the first half of July. The inclination position and cutting depth of the estaca and the substrate coverage with plastic mulching did not influence the results.

  9. Rapid analysis of fungal cultures and dried figs for secondary metabolites by LC/TOF-MS

    Energy Technology Data Exchange (ETDEWEB)

    Senyuva, Hamide Z. [Ankara Test and Analysis Laboratory, Scientific and Technological Research Council of Turkey, Ankara 06330 (Turkey)], E-mail: hamide.senyuva@tubitak.gov.tr; Gilbert, John [Central Science Laboratory, Sand Hutton, York YO41 1LZ (United Kingdom); Oztuerkoglu, Sebnem [Ankara Test and Analysis Laboratory, Scientific and Technological Research Council of Turkey, Ankara 06330 (Turkey)

    2008-06-09

    A liquid chromatography-time-of-flight mass spectrometry (LC/TOF-MS) method has been developed for profiling fungal metabolites. The performance of the procedure in terms of mass accuracy, selectivity (specificity) and repeatability was established by spiking aflatoxins, ochratoxins, trichothecenes and other metabolites into blank growth media. After extracting, and carrying out LC/TOF-MS analysis, the standards were correctly identified by searching a specially constructed database of 465 secondary metabolites. To demonstrate the viability of this approach 11 toxigenic and four non-toxigenic fungi from reference collections were grown on various media, for 7-14 days. The method was also applied to two toxigenic fungi, A. flavus (200-138) and A. parasiticus (2999-465) grown on gamma radiation sterilised dried figs, for 7-14 days. The fungal hyphae plus a portion of growth media or portions of dried figs were solvent extracted and analysed by LC/TOF-MS using a rapid resolution microbore LC column. Data processing based on cluster analysis, showed that electrospray ionization (ESI)-TOF-MS could be used to unequivocally identify metabolites in crude extracts. Using the elemental metabolite database, it was demonstrated that from culture collection isolates, anticipated metabolites. The speed and simplicity of the method has meant that levels of these metabolites could be monitored daily in sterilised figs. Over a 14-day period, levels of aflatoxins and kojic acid maximised at 5-6 days, whilst levels of 5-methoxysterigmatocystin remained relatively constant. In addition to the known metabolites expected to be produced by these fungi, roquefortine A, fumagillin, fumigaclavine B, malformins (peptides), aspergillic acid, nigragillin, terrein, terrestric acid and penicillic acid were also identified.

  10. Purification and autolysis of the ficin isoforms from fig (Ficus carica cv. Sabz) latex.

    Science.gov (United States)

    Zare, Hamid; Moosavi-Movahedi, Ali Akbar; Salami, Maryam; Mirzaei, Morteza; Saboury, Ali Akbar; Sheibani, Nader

    2013-03-01

    Ficin (EC 3.4.22.3), a cysteine endoproteolytic protease in fig trees' latex, has multiple isoforms. Until now, no data on autolysis of individual ficins (ficin isoforms) are available. Following purification, ficins' autolysis was determined by HPLC chromatogram changes and ultrafiltrations at different temperatures and storage times. These results showed that the number of HPLC peaks in latex proteins purification of Ficus carica cv. Sabz varied from previous fig varieties or cultivars. Proteolytic activity of ficins was inhibited by specific cysteine protease inhibitors, confirming the participation of the cysteine residue in the active site. The zeta potential of the first two eluted peaks (I and II) was negative, while that of other peaks were positive. All ficins were susceptible to autolysis when stored at high temperatures. In contrast, only the last two ficins (B, C) were prone to autolysis at cold temperature after long storage period. The rate of degradation of the ficins was significantly increased with the increased storage time. The ficin (A) related to peak (III) had the highest and the lowest surface hydrophobic patches and ratio of autolytic to proteolytic activity, respectively. Copyright © 2012 Elsevier Ltd. All rights reserved.

  11. Electrophoretic Ink Display Prepared by Jelly Fig Pectin/Gelatin Microspheres

    Directory of Open Access Journals (Sweden)

    Wing-Ming Chou

    2015-05-01

    Full Text Available A brand new Bio-Electronic ink (Bio-E ink display device was prepared and characterized in this study. Semiconductor material, copper phthalocyanine (CuPc was modified by cationic surfactants, cetylpyridinium chloride (CPC, as the core material, and the shell of capsule was prepared by jelly fig pectin, gelatin and sodium dodecyl sulphate (SDS. Here, jelly fig pectin was provided as the shell material for the first time. Chemical structure of the modified CuPc was characterized by Fourier Transform Infrared Spectrometer (FTIR. The core-shell microcapsules were achieved by coacervation method in an oil/water (O/W emulsion system. The particle size and morphology of microcapsules were affected by the concentrations of SDS and pH values of the O/W emulsion system. A new microcapsule-based electrophoretic display device was presented. Its image display ability of the microcapsules electrophoretic device was presented as appropriated electric power was applied, and the response time was 0.06 sec under 0.1 V/mm of electric field. Moreover, we found that its image contrast ratio of display device was influenced by the particle sizes of the microcapsules.

  12. Pectin Methyl Esterase Activity Change in Intermediate Moisture Sun-Dried Figs after Storage

    Directory of Open Access Journals (Sweden)

    Dilek Demirbüker Kavak

    2015-12-01

    Full Text Available Intermediate moisture fruits can be obtained by rehydrating dried fruits. Intermediate moisture fruits are suitable for direct consumption compared to dry fruits and can be directly used in the production of various products such as bakery products, dairy products and candies. Aim of this study is to compare the pectin methyl esterase (PME activity of intermediate moisture figs which causes softening of the texture and to compare their microbial stability after 3 months storage period. For this purpose, dried figs were rehydrated in 30 and 80° C water until they reach 30% moisture content. Rehydrated samples were stored for 3 months at +4°C. Results showed that there was no statistically significant difference between the control samples and the samples rehydrated at 80°C according to the total viable counts. At the end of the storage period, results of residual PME activity in control samples was 24.1 μmol COOH min-1g-1, while it was found 17.4 μmol COOH min-1g-1 in samples rehydrated at 80°C. As a result rehydration conducted at 80°C provided 28% reduction in PME activity compared to the control samples rehydrated at 30°C, although it did not affect the microbial load significantly after storage.

  13. Complete sequence of Fig fleck-associated virus, a novel member of the family Tymoviridae.

    Science.gov (United States)

    Elbeaino, Toufic; Digiaro, Michele; Martelli, Giovanni P

    2011-11-01

    The complete nucleotide sequence and the genome organization were determined of a novel virus, tentatively named Fig fleck-associated virus (FFkaV). The viral genome is a positive-sense, single-stranded RNA 7046 nucleotides in size excluding the 3'-terminal poly(A) tract, and comprising two open reading frames. ORF1 encodes a polypeptide of 2161 amino acids (p240), which contains the signatures of replication-associated proteins and the coat protein cistron (p24) at its 3' end. ORF2 codes for a 461 amino acid protein (p50) identified as a putative movement proteins (MP). In phylogenetic trees constructed with sequences of the putative polymerase and CP proteins FFkaV consistently groups with members of the genus Maculavirus, family Tymoviridae. However, the genome organization diverges from that of the two completely sequenced maculaviruses, Grapevine fleck virus (GFkV) and Bombix mori Macula-like virus (BmMLV), as it exhibits a structure resembling that of Maize rayado fino virus (MRFV), the type species of the genus Marafivirus and of Olive latent virus 3 (OLV-3), an unclassified virus in the family Tymoviridae. FFkaV was found in field-grown figs from six Mediterranean countries with an incidence ranging from 15% to 25%. Copyright © 2011 Elsevier B.V. All rights reserved.

  14. Premature attraction of pollinators to inaccessible figs of Ficus altissima: a search for ecological and evolutionary consequences.

    Directory of Open Access Journals (Sweden)

    Yuan Zhang

    Full Text Available Adult life spans of only one or two days characterise life cycles of the fig wasps (Agaonidae that pollinate fig trees (Ficus spp., Moraceae. Selection is expected to favour traits that maximise the value of the timing of encounters between such mutualistic partners, and fig wasps are usually only attracted to their hosts by species- and developmental-stage specific volatiles released from figs at the time when they are ready to be entered, oviposited in and pollinated. We found that Ficus altissima is exceptional, because it has persistent tight-fitting bud covers that prevent its Eupristina altissima pollinator (and a second species of 'cheater' agaonid from entering its figs for several days after they start to be attracted. We examined the consequences of delayed entry for the figs and fig wasps and tested whether delayed entry has been selected to increase adult longevity. We found that older pollinators produced fewer and smaller offspring, but seed production was more efficient. Pollinator offspring ratios also varied depending on the age of figs they entered. The two agaonids from F. altissima lived slightly longer than six congeners associated with typical figs, but this was explainable by their larger body sizes. Delayed entry generates reproductive costs, especially for the pollinator. This opens an interesting perspective on the coevolution of figs and their pollinators and on the nature of mutualistic interactions in general.

  15. Autolysis control and structural changes of purified ficin from Iranian fig latex with synthetic inhibitors.

    Science.gov (United States)

    Zare, H; Moosavi-Movahedi, A A; Salami, M; Sheibani, N; Khajeh, K; Habibi-Rezaei, M

    2016-03-01

    The fig's ficin is a cysteine endoproteolytic enzyme, which plays fundamental roles in many plant physiological processes, and has many applications in different industries such as pharmaceutical and food. In this work, we report the inhibition and activation of autolysis and structural changes associated with reaction of ficin with iodoacetamide and tetrathionate using high-performance liquid chromatography (HPLC), ultra filtration membrane, and dynamic light scattering (DLS) methods. The ficin structural changes were also determined using UV-absorption, circular dichroism (CD), fluorescence spectroscopy, and differential scanning calorimetry (DSC) techniques. These techniques demonstrated that iodoacetamide completely inhibited ficin autolysis, which was irreversible. However, tetrathionate partially and reversibility inhibited its autolysis. The ficin structural changes with two synthetic inhibitors were associated with secondary structural changes related to decreased alpha-helix and increased beta sheet and random coil conformations, contributing to its aggregation. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Effects of Deficient Irrigation on Some of the Morpho-physiological Characteristics of Four Fig Cultivars

    Directory of Open Access Journals (Sweden)

    Gh. Davarynejad

    2016-07-01

    Full Text Available Introduction: The amount of water available to plants includes one of the most important factors that affect the growth of plants. The objective of the present study was to investigate and compare the tolerance of different fig types (Ficus carica L. to different low irrigation treatments. Materials and Methods: A factorial trial based on a completely randomized design with 3 replications was carried out in Ferdowsi University of Mashhad. The treatments of this experiment were four levels of irrigation including; supplying enough water to pots (100% field capacity, mild stress (75% field capacity, average stress (50% field capacity and severe stress (25% field capacity on Green, Black, Shah Fig and Matthew cultivars. Some of morphological and physiological traits like stem growth, leaf umber, leaf area, root length, root area, fresh and dry weight of shoot and root, root to shoot ratio, relative water content, electrolyte leakage, total chlorophyll and proline were measured. Results and Discussion: According to the results, significant differences were observed between different irrigation treatments for all measured parameters. The highest level of stem growth, leaf umber and leaf area were detected in control treatment (100% field capacity, while the lowest contents were observed in severe stress (25% field capacity. The results showed that the fresh and dry weight of shoot and root decreased with increasing drought stress, so that the lowest amounts were observed in severe stress treatment (25% field capacity. The levels of relative water content was significantly affected by different irrigation treatments, since treated plants with severe stress treatment (25% field capacity had the lowest relative water values, while the highest levels was observed in control treatment (100% field capacity. The highest and lowest of total chlorophyll content was observed in control treatments (100% field capacity and severe stress (25% field capacity

  17. 75 FR 6344 - Notice of Availability of Pest Risk Analyses for Importation of Fresh Figs, Pomegranates, and...

    Science.gov (United States)

    2010-02-09

    ...] Notice of Availability of Pest Risk Analyses for Importation of Fresh Figs, Pomegranates, and Baby Kiwi...: Notice. SUMMARY: We are advising the public that we have prepared two pest risk analyses, one with... the risks of introducing or disseminating plant pests or noxious weeds via the importation of figs...

  18. Chronic Dietary Supplementation of 4% Figs on the Modification of Oxidative Stress in Alzheimer’s Disease Transgenic Mouse Model

    Directory of Open Access Journals (Sweden)

    Selvaraju Subash

    2014-01-01

    Full Text Available We assessed the changes in the plasma Aβ, oxidative stress/antioxidants, and membrane bound enzymes in the cerebral cortex and hippocampus of Alzheimer’s disease (AD transgenic mice (Tg2576 after dietary supplementation of Omani figs fruits for 15 months along with spatial memory and learning test. AD Tg mice on control diet without figs showed significant impairment in spatial learning ability compared to the wild-type mice on same diet and figs fed Tg mice as well. Significant increase in oxidative stress and reduced antioxidant status were observed in AD Tg mice. 4% figs treated AD Tg mice significantly attenuated oxidative damage, as evident by decreased lipid peroxidation and protein carbonyls and restoration of antioxidant status. Altered activities of membrane bound enzymes (Na+ K+ ATPase and acetylcholinesterase (AChE in AD Tg mice brain regions and was restored by figs treatment. Further, figs supplementation might be able to decrease the plasma levels of Aβ (1–40, 1–42 significantly in Tg mice suggesting a putative delay in the formation of plaques, which might be due to the presence of high natural antioxidants in figs. But this study warrants further extensive investigation to find a novel lead for a therapeutic target for AD from figs.

  19. Effects of ionizing radiation on the boreal forest: Canada's FIG experiment, with implications for radionuclides

    International Nuclear Information System (INIS)

    Amiro, B.D.; Sheppard, S.C.

    1994-01-01

    The Field-Irradiator Gamma (FIG) experiment chronically irradiated a section of the Canadian boreal forest over a period of 14 years. Forest trees were affected at dose rates >0.1 mGy·h -1 , but a berbaceous plant community thrived at dose rates up to 65 mGy·h -1 . Irradiation resulted in the establishment of four zones of vegetation: a herbaceous community, a shrub community, a narrow zone of dying trees, and a zone with no apparent impacts. Concentrations of 14 C, 99 Tc, 129 I, 137 Cs and 226 Ra that could cause a dose rate of 0.1 mGy·h -1 within vegetation were calculated. Chemical toxic effects on plants would be caused by 99 Tc and 129 I before radiological effects are predicted to occur. The calculated 226 Ra concentration is about a factor of 10 greater than that measured at some natural sites. Sufficiently high concentrations of 14 C and 137 Cs to cause an impact are unlikely unless a site is severely contaminated. (author)

  20. Effects of ionizing radiation on the boreal forest: Canada's FIG experiment, with implications for radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Amiro, B D; Sheppard, S C

    1994-07-01

    The Field-Irradiator Gamma (FIG) experiment chronically irradiated a section of the Canadian boreal forest over a period of 14 years. Forest trees were affected at dose rates >0.1 mGy{center_dot}h{sup -1}, but a berbaceous plant community thrived at dose rates up to 65 mGy{center_dot}h{sup -1}. Irradiation resulted in the establishment of four zones of vegetation: a herbaceous community, a shrub community, a narrow zone of dying trees, and a zone with no apparent impacts. Concentrations of {sup 14}C, {sup 99}Tc, {sup 129}I, {sup 137}Cs and {sup 226}Ra that could cause a dose rate of 0.1 mGy{center_dot}h{sup -1} within vegetation were calculated. Chemical toxic effects on plants would be caused by {sup 99}Tc and {sup 129}I before radiological effects are predicted to occur. The calculated {sup 226}Ra concentration is about a factor of 10 greater than that measured at some natural sites. Sufficiently high concentrations of {sup 14}C and {sup 137}Cs to cause an impact are unlikely unless a site is severely contaminated. (author)

  1. Pectinesterase inhibitor from jelly-fig (Ficus awkeotsang Makino) achenes reduces methanol content in carambola wine.

    Science.gov (United States)

    Wu, James Swi-Bea; Wu, Ming-Chang; Jiang, Chii-Ming; Hwang, Ya-Ping; Shen, Szu-Chuan; Chang, Hung-Min

    2005-11-30

    Crude pectinesterase (PE) inhibitor (PEI) extracted from jelly-fig achenes (JFA) (Ficus awakeosang Makino) was added to carambola (Averrhoa carambola L.) puree to determine the change in methanol production during fermentation. Addition of pectin or microbial pectic enzyme to puree increased dose-dependently the methanol content in fermented products. Decreasing ratio (from 1:0 to 1:19, v:v) of pectic enzyme to diluted crude PEI solution in the puree-enzyme mixture decreased the PE activity remarkably. Except for transmittance (%T), addition of crude PEI to puree did not affect apparently the physical and chemical properties of wine; however, it reduced methanol content in the control from 256 to 58 ppm. The degree of esterification (DE) of pectin in starting puree was approximately 70%. It decreased to approximately 27% in the control group and reduced slightly to approximately 67% in fermented puree with crude PEI added after 14 days of fermentation. This reveals that crude PEI solution was potent in inhibiting intrinsic carambola PE activity and appeared to be a potential alternative for methanol reduction in wines.

  2. Phylogenetic analyses suggest a hybrid origin of the figs (Moraceae: Ficus) that are endemic to the Ogasawara (Bonin) Islands, Japan.

    Science.gov (United States)

    Kusumi, Junko; Azuma, Hiroshi; Tzeng, Hsy-Yu; Chou, Lien-Siang; Peng, Yan-Qiong; Nakamura, Keiko; Su, Zhi-Hui

    2012-04-01

    The Ogasawara Islands are oceanic islands and harbor a unique endemic flora. There are three fig species (Ficus boninsimae, F. nishimurae and F. iidaiana) endemic to the Ogasawara Islands, and these species have been considered to be closely related to Ficus erecta, and to have diverged within the islands. However, this hypothesis remains uncertain. To investigate this issue, we assessed the phylogenetic relationships of the Ogasawara figs and their close relatives occurring in Japan, Taiwan and South China based on six plastid genome regions, nuclear ITS region and two nuclear genes. The plastid genome-based tree indicated a close relationship between the Ogasawara figs and F. erecta, whereas some of the nuclear gene-based trees suggested this relationship was not so close. In addition, the phylogenetic analyses of the pollinating wasps associated with these fig species based on the nuclear 28S rRNA and mitochondrial cytB genes suggested that the fig-pollinating wasps of F. erecta are not sister to those of the Ogasawara figs These results suggest the occurrence of an early hybridization event(s) in the lineage leading to the Ogasawara figs. Copyright © 2012 Elsevier Inc. All rights reserved.

  3. How to be a dioecious fig: Chemical mimicry between sexes matters only when both sexes flower synchronously

    Science.gov (United States)

    Hossaert-McKey, M.; Proffit, M.; Soler, C. C. L.; Chen, C.; Bessière, J.-M.; Schatz, B.; Borges, R. M.

    2016-01-01

    In nursery pollination mutualisms, which are usually obligate interactions, olfactory attraction of pollinators by floral volatile organic compounds (VOCs) is the main step in guaranteeing partner encounter. However, mechanisms ensuring the evolutionary stability of dioecious fig–pollinator mutualisms, in which female fig trees engage in pollination by deceit resulting in zero reproductive success of pollinators that visit them, are poorly understood. In dioecious figs, individuals of each sex should be selected to produce odours that their pollinating wasps cannot distinguish, especially since pollinators have usually only one choice of a nursery during their lifetime. To test the hypothesis of intersexual chemical mimicry, VOCs emitted by pollen-receptive figs of seven dioecious species were compared using headspace collection and gas chromatography-mass spectrometry analysis. First, fig-flower scents varied significantly among species, allowing host-species recognition. Second, in species in which male and female figs are synchronous, intersexual VOC variation was not significant. However, in species where figs of both sexes flower asynchronously, intersexual variation of VOCs was detectable. Finally, with one exception, there was no sexual dimorphism in scent quantity. We show that there are two ways to use scent to be a dioecious fig based on differences in flowering synchrony between the sexes. PMID:26888579

  4. Nucleocapsid Protein from Fig Mosaic Virus Forms Cytoplasmic Agglomerates That Are Hauled by Endoplasmic Reticulum Streaming

    Science.gov (United States)

    Ishikawa, Kazuya; Miura, Chihiro; Maejima, Kensaku; Komatsu, Ken; Hashimoto, Masayoshi; Tomomitsu, Tatsuya; Fukuoka, Misato; Yusa, Akira; Yamaji, Yasuyuki

    2014-01-01

    ABSTRACT Although many studies have demonstrated intracellular movement of viral proteins or viral replication complexes, little is known about the mechanisms of their motility. In this study, we analyzed the localization and motility of the nucleocapsid protein (NP) of Fig mosaic virus (FMV), a negative-strand RNA virus belonging to the recently established genus Emaravirus. Electron microscopy of FMV-infected cells using immunogold labeling showed that NPs formed cytoplasmic agglomerates that were predominantly enveloped by the endoplasmic reticulum (ER) membrane, while nonenveloped NP agglomerates also localized along the ER. Likewise, transiently expressed NPs formed agglomerates, designated NP bodies (NBs), in close proximity to the ER, as was the case in FMV-infected cells. Subcellular fractionation and electron microscopic analyses of NP-expressing cells revealed that NBs localized in the cytoplasm. Furthermore, we found that NBs moved rapidly with the streaming of the ER in an actomyosin-dependent manner. Brefeldin A treatment at a high concentration to disturb the ER network configuration induced aberrant accumulation of NBs in the perinuclear region, indicating that the ER network configuration is related to NB localization. Dominant negative inhibition of the class XI myosins, XI-1, XI-2, and XI-K, affected both ER streaming and NB movement in a similar pattern. Taken together, these results showed that NBs localize in the cytoplasm but in close proximity to the ER membrane to form enveloped particles and that this causes passive movements of cytoplasmic NBs by ER streaming. IMPORTANCE Intracellular trafficking is a primary and essential step for the cell-to-cell movement of viruses. To date, many studies have demonstrated the rapid intracellular movement of viral factors but have failed to provide evidence for the mechanism or biological significance of this motility. Here, we observed that agglomerates of nucleocapsid protein (NP) moved rapidly

  5. Effect of drying of figs (Ficus carica L.) on the contents of sugars, organic acids, and phenolic compounds.

    Science.gov (United States)

    Slatnar, Ana; Klancar, Urska; Stampar, Franci; Veberic, Robert

    2011-11-09

    Fresh figs were subjected to two different drying processes: sun-drying and oven-drying. To assess their effect on the nutritional and health-related properties of figs, sugars, organic acids, single phenolics, total phenolics, and antioxidant activity were determined before and after processing. Samples were analyzed three times in a year, and phenolic compounds were determined using high-performance liquid chromatography coupled with mass spectrometry (HPLC-MS). In figs, monomer sugars predominate, which is important nutritional information, and the content of sugars as well as organic acids in fresh figs was lower than in dried fruits. However, the best sugar/organic acid ratio was measured after the sun-drying process. Analysis of individual phenolic compounds revealed a higher content of all phenolic groups determined after the oven-drying process, with the exception of cyanidin-3-O-rutinoside. Similarly, higher total phenolic content and antioxidant activity were detected after the drying process. With these results it can be concluded that the differences in analyzed compounds in fresh and dried figs are significant. The differences between the sun-dried and oven-dried fruits were determined in organic acids, sugars, chlorogenic acid, catechin, epicatechin, kaempferol-3-O-glucoside, luteolin-8-C-glucoside, and total phenolic contents. The results indicate that properly dried figs can be used as a good source of phenolic compounds.

  6. Traditional agroecosystems as conservatories and incubators of cultivated plant varietal diversity: the case of fig (Ficus carica L. in Morocco

    Directory of Open Access Journals (Sweden)

    Santoni Sylvain

    2010-02-01

    Full Text Available Abstract Background Traditional agroecosystems are known to host both large crop species diversity and high within crop genetic diversity. In a context of global change, this diversity may be needed to feed the world. Are these agroecosystems museums (i.e. large core collections or cradles of diversity? We investigated this question for a clonally propagated plant, fig (Ficus carica, within its native range, in Morocco, but as far away as possible from supposed centers of domestication. Results Fig varieties were locally numerous. They were found to be mainly highly local and corresponded to clones propagated vegetatively. Nevertheless these clones were often sufficiently old to have accumulated somatic mutations for selected traits (fig skin color and at neutral loci (microsatellite markers. Further the pattern of spatial genetic structure was similar to the pattern expected in natural population for a mutation/drift/migration model at equilibrium, with homogeneous levels of local genetic diversity throughout Moroccan traditional agroecosystems. Conclusions We conclude that traditional agroecosystems constitue active incubators of varietal diversity even for clonally propagated crop species, and even when varieties correspond to clones that are often old. As only female fig is cultivated, wild fig and cultivated fig probably constitute a single evolutionary unit within these traditional agroecosystems. Core collections, however useful, are museums and hence cannot serve the same functions as traditional agroecosystems.

  7. Spatial Scales of Genetic Structure in Free-Standing and Strangler Figs (Ficus, Moraceae Inhabiting Neotropical Forests.

    Directory of Open Access Journals (Sweden)

    Katrin Heer

    Full Text Available Wind-borne pollinating wasps (Agaonidae can transport fig (Ficus sp., Moraceae pollen over enormous distances (> 100 km. Because of their extensive breeding areas, Neotropical figs are expected to exhibit weak patterns of genetic structure at local and regional scales. We evaluated genetic structure at the regional to continental scale (Panama, Costa Rica, and Peru for the free-standing fig species Ficus insipida. Genetic differentiation was detected only at distances > 300 km (Jost´s Dest = 0.68 ± 0.07 & FST = 0.30 ± 0.03 between Mesoamerican and Amazonian sites and evidence for phylogeographic structure (RST>>permuted RST was only significant in comparisons between Central and South America. Further, we assessed local scale spatial genetic structure (SGS, d ≤ 8 km in Panama and developed an agent-based model parameterized with data from F. insipida to estimate minimum pollination distances, which determine the contribution of pollen dispersal on SGS. The local scale data for F. insipida was compared to SGS data collected for an additional free-standing fig, F. yoponensis (subgenus Pharmacosycea, and two species of strangler figs, F. citrifolia and F. obtusifolia (subgenus Urostigma sampled in Panama. All four species displayed significant SGS (mean Sp = 0.014 ± 0.012. Model simulations indicated that most pollination events likely occur at distances > > 1 km, largely ruling out spatially limited pollen dispersal as the determinant of SGS in F. insipida and, by extension, the other fig species. Our results are consistent with the view that Ficus develops fine-scale SGS primarily as a result of localized seed dispersal and/or clumped seedling establishment despite extensive long-distance pollen dispersal. We discuss several ecological and life history factors that could have species- or subgenus-specific impacts on the genetic structure of Neotropical figs.

  8. Seasonal abundance of the navel orangeworm, Amyelois transitella, in figs and the effect of peripheral aerosol dispensers on sexual communication.

    Science.gov (United States)

    Burks, Charles S; Brandl, David G

    2004-01-01

    We used flight traps baited with unmated female navel orangeworm Amyelois transitella (Walker) (Lepidoptera: Pyralidae) to examine, over two growing seasons, seasonal changes in the abundance of males in fig orchards and the impact of release of 48 mg per ha per day of the pheromone component (Z,Z)-11,13-hexadecadienal from peripherally-located timed-release dispensers on the ability of males to find unmated females within 16-ha treatment plots. Material was placed out and mating disruption was commenced at the beginning of April in the first year, and at the beginning of July the second year. This technique effectively prevented males from finding females in female-baited traps placed throughout the plot. Navel orangeworm abundance was high in figs during the first and third flight, but lower in June and July during the second flight. Since Calimyrna figs are not susceptible to attack by navel orangeworm until mid-to-late July, these findings suggest that materials cost can be reduced by beginning treatment later. Implications for insect pest management in figs and other California crops are discussed.

  9. 76 FR 18511 - Notice of Decision To Issue Permits for the Importation of Fresh Figs From Chile into the...

    Science.gov (United States)

    2011-04-04

    ... United States of fresh figs from Chile. Based on the findings of a pest risk analysis, which we made... the findings of a pest risk analysis, can be safely imported subject to one or more of the designated... the Federal Register announcing the availability of the pest risk analysis that evaluates the risks...

  10. The stimulating effects of polyphenol and protein fractions from jelly fig (Ficus awkeotsang Makino achenes against proliferation of leukemia cells

    Directory of Open Access Journals (Sweden)

    Yi-Zhen Shih

    2017-10-01

    Full Text Available This study aimed to investigate the direct and immune-stimulated antiproliferative activities of jelly fig achenes fractions including pectinesterase inhibitors, crude polyphenols extract, and purified polyphenols extract (PP. Beside the measurement of cell viability of U937, the quantity of cytokines in conditioned medium and morphologic changes in leukemia were observed. After surveying all fractions in jelly fig, the obtained fractions of polyphenol exhibited the highest stimulating effects and directly cytotoxic effects against leukemia with the lowest effect found in protein fractions. The leukemia treated by our PP fraction showed dose-dependent response between the concentration and G2/M cell numbers of the U937 cells. The PP fraction had more pronounced effect on immune-stimulated than direct antiproliferative activities. The finding was also supported by morphological analysis by showing the formation of apoptotic bodies and differentiation from immature U937 cells into mature monocytes/macrophages on cells cultured with PP-conditioned medium. In conclusion, polyphenol fraction of pectinesterase inhibitors from jelly fig showed the immune-stimulated antiproliferative activities against U937 cell.

  11. DNA profiling of figs (Ficus carica L.) from Slovenia and Californian USDA collection revealed the uniqueness of some North Adriatic varieties

    Science.gov (United States)

    A set of 23 local varieties from Slovenia and 218 fig accessions from Californian fig germplasm collection were compared to determine the identity of genotypes and their possible genetic relationships. Figs were genotyped using twelve microsatellite loci. One hundred alleles were identified over all...

  12. The Effect of Compost and the Ripe Fruit Waste of Fig on some Physical Properties of Surface Soil

    Directory of Open Access Journals (Sweden)

    zahra dianat maharluei

    2017-02-01

    Full Text Available Introduction: In arid and semi-arid soils, low organic matter is one of the barriers to achieving optimal performance. The soils with more organic matter have a better structure and are more resistant to erosive factors such as water and wind. Soil organic matter has a particular importance and has significant impact on the stability of soil aggregates, the extension of plant root system, carbon and water cycles and soil resistance to erosion. This substance acts as a cementing agent and plays an important role in soil flocculation and formation of resistant aggregates.Also, the addition of organic matter to the soil increases soil porosity and decreases soil bulk density. Materials and Methods: In this research, the effect of the two types of organic matter (compost and the ripe fruit waste of fig on some soil physical properties was studied. A factorial experiment based on completely randomized design, including the four levels of compost and the ripe fruit waste of fig (0, 1, 2 and 4 by weight % and three soil types (loamy sand, loam and silty clay loam with three replications was carried out. The soil samples were collected from the three territories of Fars Province: loamy sand soil from Shiraz, loamy soil from Maharlu and Silty clay loam soil from Zarghan area. The soil samples were air dried and passed through a 2 mm sieve. The physical properties including the bulk density, particle density, porosity, moisture content and soil crust strength was measured. In this research, the soil texture by hydrometer method, Electrical conductivity of the soil saturated paste extract by electrical conductivity meter, saturated paste pH by pH meter, seedling emergence test, soil crust strength by a pocket penetrometer (HUMBOLDT MFG.CO. bulk density by cylindrical sample and particle density by pycnometer method were measured. The fig fruit treatments were prepared by thoroughly mixing the dried powder of ripe fig fruit passed through a 2 mm sieve (with

  13. Evaluation of agronomic and fruit quality traits of fig tree varieties (Ficus carica L.) grown in Mediterranean conditions

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, C.; Serradilla, M.J.; Pérez-Gragera, F.; Martín, A.; Villalobos, M. C.; López-Corrales, M.

    2017-07-01

    In this work, the agronomic behaviour and fruit quality of ten varieties of common fig were evaluated for the establishment of new commercial orchards destined for fresh consumption. The following traits were measured: annual yield, cumulative yield, trunk cross sectional area (TCSA) and yield efficiency of each variety, as well as weight, width, total soluble solids (TSS), pH, titratable acidity (TA) and maturation index (MI) of brebas and figs. The results show that ‘Banane’ and ‘Brown Turkey’ were the earliest to enter into production, and ‘Banane’ showed the highest annual yield in the 7th green (2014), with 76 kg/tree, followed by ‘Brown Turkey’ (57.6 kg/tree), ‘Cuello Dama Blanco’ (52 kg/tree) and ‘Colar Elche’ (39 kg/tree). On the other hand, 'Cuello Dama Blanco' and 'De Rey' exhibited the better organoleptic traits, with TSS and MI values ranged from 18.7 ºBrix and 203.3 MI (‘Cuello Dama Blanco’) to 20.4 ºBrix and 187.1 MI (‘De Rey’) for brebas and from 21.4 ºBrix and 278.7 (‘Cuello Dama Blanco’) to 23.3 ºBrix and 255.6 (‘De Rey’) for figs. This study will allow the fruit grower to select the most interesting and appropriate range of varieties based on market needs taking into account the ripening season (early, middle or late) and fruit colour (green, purple or black).

  14. Evaluation of agronomic and fruit quality traits of fig tree varieties (Ficus carica L.) grown in Mediterranean conditions

    International Nuclear Information System (INIS)

    Pereira, C.; Serradilla, M.J.; Pérez-Gragera, F.; Martín, A.; Villalobos, M. C.; López-Corrales, M.

    2017-01-01

    In this work, the agronomic behaviour and fruit quality of ten varieties of common fig were evaluated for the establishment of new commercial orchards destined for fresh consumption. The following traits were measured: annual yield, cumulative yield, trunk cross sectional area (TCSA) and yield efficiency of each variety, as well as weight, width, total soluble solids (TSS), pH, titratable acidity (TA) and maturation index (MI) of brebas and figs. The results show that ‘Banane’ and ‘Brown Turkey’ were the earliest to enter into production, and ‘Banane’ showed the highest annual yield in the 7th green (2014), with 76 kg/tree, followed by ‘Brown Turkey’ (57.6 kg/tree), ‘Cuello Dama Blanco’ (52 kg/tree) and ‘Colar Elche’ (39 kg/tree). On the other hand, 'Cuello Dama Blanco' and 'De Rey' exhibited the better organoleptic traits, with TSS and MI values ranged from 18.7 ºBrix and 203.3 MI (‘Cuello Dama Blanco’) to 20.4 ºBrix and 187.1 MI (‘De Rey’) for brebas and from 21.4 ºBrix and 278.7 (‘Cuello Dama Blanco’) to 23.3 ºBrix and 255.6 (‘De Rey’) for figs. This study will allow the fruit grower to select the most interesting and appropriate range of varieties based on market needs taking into account the ripening season (early, middle or late) and fruit colour (green, purple or black).

  15. Long-term dietary supplementation of pomegranates, figs and dates alleviate neuroinflammation in a transgenic mouse model of Alzheimer's disease.

    Directory of Open Access Journals (Sweden)

    Musthafa Mohamed Essa

    Full Text Available Alzheimer's disease (AD is a devastating age-related neurodegenerative disease with no specific treatment at present. The APPsw/Tg2576 mice exhibit age-related deterioration in memory and learning as well as amyloid-beta (Aβ accumulation, and this mouse strain is considered an effective model for studying the mechanism of accelerated brain aging and senescence. The present study was aimed to investigate the beneficial effects of dietary supplements pomegranate, figs, or the dates on suppressing inflammatory cytokines in APPsw/Tg2576 mice. Changes in the plasma cytokines and Aβ, ATP, and inflammatory cytokines were investigated in the brain of transgenic mice. Significantly enhanced levels of inflammatory cytokines IL-1β, IL-2, IL-3, IL-4, IL-5, IL-6, IL-9, IL-10, TNF-α and Eotaxin activity were decreased by administration of the diet supplements containing pomegranates, figs, or dates. In addition, putative delays in the formation of senile plaques, as indicated by a decreasing tendency of brain Aβ1-40 and Aβ1-42 contents, were observed. Thus, novel results mediated by reducing inflammatory cytokines during aging may represent one mechanism by which these supplements exert their beneficial effects against neurodegenerative diseases such as AD.

  16. Phylogeny and evolution of life-history strategies in the Sycophaginae non-pollinating fig wasps (Hymenoptera, Chalcidoidea

    Directory of Open Access Journals (Sweden)

    Farache Fernando HA

    2011-06-01

    Full Text Available Abstract Background Non-pollinating Sycophaginae (Hymenoptera, Chalcidoidea form small communities within Urostigma and Sycomorus fig trees. The species show differences in galling habits and exhibit apterous, winged or dimorphic males. The large gall inducers oviposit early in syconium development and lay few eggs; the small gall inducers lay more eggs soon after pollination; the ostiolar gall-inducers enter the syconium to oviposit and the cleptoparasites oviposit in galls induced by other fig wasps. The systematics of the group remains unclear and only one phylogeny based on limited sampling has been published to date. Here we present an expanded phylogeny for sycophagine fig wasps including about 1.5 times the number of described species. We sequenced mitochondrial and nuclear markers (4.2 kb on 73 species and 145 individuals and conducted maximum likelihood and Bayesian phylogenetic analyses. We then used this phylogeny to reconstruct the evolution of Sycophaginae life-history strategies and test if the presence of winged males and small brood size may be correlated. Results The resulting trees are well resolved and strongly supported. With the exception of Apocrytophagus, which is paraphyletic with respect to Sycophaga, all genera are monophyletic. The Sycophaginae are divided into three clades: (i Eukoebelea; (ii Pseudidarnes, Anidarnes and Conidarnes and (iii Apocryptophagus, Sycophaga and Idarnes. The ancestral states for galling habits and male morphology remain ambiguous and our reconstructions show that the two traits are evolutionary labile. Conclusions The three main clades could be considered as tribes and we list some morphological characters that define them. The same biologies re-evolved several times independently, which make Sycophaginae an interesting model to test predictions on what factors will canalize the evolution of a particular biology. The ostiolar gall-inducers are the only monophyletic group. In 15 Myr, they

  17. Flavonoid content in leaf extracts of the fig (Ficus carica L.), carob (Ceratonia siliqua L.) and pistachio (Pistacia lentiscus L.).

    Science.gov (United States)

    Vaya, Jacob; Mahmood, Saeed

    2006-01-01

    The total flavonoid content of leaf extracts (70% ethanol) from fig (Ficus carica L.), carob (Ceratonia siliqua L.) and pistachio (Pistacia lentiscus L.) plants were determined by using reverse phase high-performance liquid chromatography (HPLC)-and analyzed by UV/VIS array and electrospray ionization (ESI)-mass spectrometry (MS) detectors. As a base for comparison, flavonoid type and level were also determined in extracts from soybeans and grape seeds. It was found that the major flavonoids in Ficus are quercetin and luteolin, with a total of 631 and 681 mg/kg extract, respectively. In Ceratonia leaves, nine different flavonoids were detected. The major one was myricetin (1486 mg/kg extract), with a similar level in Pistacia (1331 mg/kg extract, myricetin). The present study is the first to report the presence of the isoflavone genistein in the Pistacia leaf, which was discovered to consist of about a third of the genistein level detected in soybean.

  18. Some pollinators are more equal than others: Factors influencing pollen loads and seed set capacity of two actively and passively pollinating fig wasps

    Science.gov (United States)

    Kjellberg, Finn; Suleman, Nazia; Raja, Shazia; Tayou, Abelouahad; Hossaert-McKey, Martine; Compton, Stephen G.

    2014-05-01

    The nursery pollination system of fig trees (Ficus) results in the plants providing resources for pollinator fig wasp larvae as part of their male reproductive investment, with selection determining relative investment into pollinating wasps and the pollen they carry. The small size of Ficus pollen suggests that the quantities of pollen transported by individual wasps often limits male reproductive success. We assessed variation in fig wasp pollen loads and its influence on seed production in actively pollinated (Ficus montana) and passively pollinated (Ficus carica) dioecious fig trees.

  19. Testing the emergence of New Caledonia: fig wasp mutualism as a case study and a review of evidence.

    Directory of Open Access Journals (Sweden)

    Astrid Cruaud

    Full Text Available While geologists suggest that New Caledonian main island (Grande Terre was submerged until ca 37 Ma, biologists are struck by the presence of supposedly Gondwanan groups on the island. Among these groups are the Oreosycea fig trees (Ficus, Moraceae and their Dolichoris pollinators (Hymenoptera, Agaonidae. These partners are distributed in the Paleotropics and Australasia, suggesting that their presence on New Caledonia could result from Gondwanan vicariance. To test this hypothesis, we obtained mitochondrial and nuclear markers (5.3 kb from 28 species of Dolichoris, used all available sequences for Oreosycea, and conducted phylogenetic and dating analyses with several calibration strategies. All our analyses ruled out a vicariance scenario suggesting instead that New Caledonian colonization by Dolichoris and Oreosycea involved dispersal across islands from Sundaland ca 45.9-32.0 Ma. Our results show that successful long-distance dispersal of obligate mutualists may happen further suggesting that presence of intimate mutualisms on isolated islands should not be used as a priori evidence for vicariance. Comparing our results to a review of all the published age estimates for New Caledonian plant and animal taxa, we showed that support for a vicariant origin of the island biota is still lacking. Finally, as demonstrating a causal relationship between geology and biology requires independent evidence, we argue that a priori assumptions about vicariance or dispersal should not be used to constrain chronograms. This circular reasoning could lead to under or overestimation of age estimates.

  20. An ethnobotanical study of the less known wild edible figs (genus Ficus) native to Xishuangbanna, Southwest China.

    Science.gov (United States)

    Shi, Yinxian; Hu, Huabin; Xu, Youkai; Liu, Aizhong

    2014-09-24

    The genus Ficus, collectively known as figs, is a key component of tropical forests and is well known for its ethnobotanical importance. In recent decades an increasing number of studies have shown the indigenous knowledge about wild edible Ficus species and their culinary or medicinal value. However, rather little is known about the role of these species in rural livelihoods, because of both species and cultural diversity. In this study we 1) collected the species and ethnic names of wild edible Ficus exploited by four cultural groups in Xishuangbanna, Southwest China, and 2) recorded the collection activities and modes of consumption through semi-structured interviews, 3) investigated the resource management by a statistical survey of their field distribution and cultivation, and 4) compared and estimated the usage intensities by the grading method. The young leaves, leaf buds and young or ripe syconia of 13 Ficus species or varieties are traditionally consumed. All the species had fixed and usually food-related ethnic names. All four cultural groups are experienced in the collection and use of edible Ficus species as vegetables, fruits or beverages, with the surplus sold for cash income. Different cultural groups use the Ficus species at different intensities because of differences in availability, forest dependency and cultural factors. Both the mountain and basin villagers make an effort to realize sustainable collection and meet their own and market needs by resource management in situ or cultivation. In comparison with reports from other parts of the world, ethnic groups in Xishuangbanna exploited more edible Ficus species for young leaves or leaf buds. Most of the edible species undergo a gradient of management intensities following a gradient of manipulation from simple field gathering to ex situ cultivation. This study contributes to our understanding of the origins and diffusion of the knowledge of perception, application and managing a group of

  1. Bambini stranieri con bisogni speciali: rappresentazione della disabilità dei figli da parte delle famiglie migranti e degli insegnanti

    Directory of Open Access Journals (Sweden)

    Alain Goussot

    2010-02-01

    Full Text Available Interviste qualitative a genitori immigrati di bambine e bambini con disabilità: 5 interviste a Cesena e 4 interviste a Pescara. Somministrazione questionari ad insegnanti. La maggioranza dei bambini frequenta la scuola primaria e qualcuno la secondaria. Dalle interviste fatte ai genitori, in particolare le madri si hanno una serie di indicazioni sulla storia nella prima infanzia, su come i genitori vivono la disabilità dei propri figli in una condizione particolare che è quella dell'esperienza migratoria. Nella ricostruzione della storia migratoria abbiamo anche la ricostruzione delle storie cliniche dei bambini; alcuni con disabilità congenite (la maggior parte di tipo sensoriale (sordità, cecità , qualcuno con disabilità intellettiva, vi sono anche due casi con disabilità acquisite. la ricerca mette in evidenza quanto lo sguardo e il vissuto dei genitori sia fortemente condizionato da alcuni variabili: cultura di origine, condizioni e motivi dell'esperienza migratoria, evento traumatico che provoca la disabilità, condizioni dell'accoglienza in Italia, storia familiare, aspettative di guarigione dei genitori. Vi è anche una analisi del vissuto delle madri e del loro modo di concepire la relazione con il figlio disabile: vissuto e concezione fortemente condizionati dalla cultura della cura del proprio contesto di origine e dalle condizioni psico-affettive e sociali dell'inserimento della donna. Vi sono madri che arrivano in Italia pensando di curare e 'riparare' il figlio, vi è anche chi si trova in difficoltà nel combinare lo sguardo medico della neuropsichiatria infantile 'occidentale' con lo sguardo della cultura tradizionale del paese di provenienza. Quello che emerge dal lavoro è anche l'importanza del nesso madre-figlia/o disabile nonché la valorizzazione delle forme di maternage veicolate dalle madri migranti; forme che non coincidono sempre con quelle italiane. I casi di accompagnamento positivo sono dovuti all

  2. Optimization of flavored drinking yoghurt formula containing fig syrup and Bacillus coagulans and evaluation of some physicochemical characteristics and its overall acceptability

    Directory of Open Access Journals (Sweden)

    D Jafarpour

    2018-03-01

    Conclusion: Drinking yoghurt containing 10% pectin fig syrup and 1% has higher score of physicochemical properties and overall acceptability than other received samples; so this product can be introduced as a probiotic dairy and nutritious drink.

  3. The ambiguous ripening nature of the fig (Ficus carica L.) fruit: a gene-expression study of potential ripening regulators and ethylene-related genes

    Science.gov (United States)

    Freiman, Zohar E.; Rosianskey, Yogev; Dasmohapatra, Rajeswari; Kamara, Itzhak; Flaishman, Moshe A.

    2015-01-01

    The traditional definition of climacteric and non-climacteric fruits has been put into question. A significant example of this paradox is the climacteric fig fruit. Surprisingly, ripening-related ethylene production increases following pre- or postharvest 1-methylcyclopropene (1-MCP) application in an unexpected auto-inhibitory manner. In this study, ethylene production and the expression of potential ripening-regulator, ethylene-synthesis, and signal-transduction genes are characterized in figs ripening on the tree and following preharvest 1-MCP application. Fig ripening-related gene expression was similar to that in tomato and apple during ripening on the tree, but only in the fig inflorescence–drupelet section. Because the pattern in the receptacle is different for most of the genes, the fig drupelets developed inside the syconium are proposed to function as parthenocarpic true fruit, regulating ripening processes for the whole accessory fruit. Transcription of a potential ripening regulator, FcMADS8, increased during ripening on the tree and was inhibited following 1-MCP treatment. Expression patterns of the ethylene-synthesis genes FcACS2, FcACS4, and FcACO3 could be related to the auto-inhibition reaction of ethylene production in 1-MCP-treated fruit. Along with FcMADS8 suppression, gene expression analysis revealed upregulation of FcEBF1, and downregulation of FcEIL3 and several FcERFs by 1-MCP treatment. This corresponded with the high storability of the treated fruit. One FcERF was overexpressed in the 1-MCP-treated fruit, and did not share the increasing pattern of most FcERFs in the tree-ripened fig. This demonstrates the potential of this downstream ethylene-signal-transduction component as an ethylene-synthesis regulator, responsible for the non-climacteric auto-inhibition of ethylene production in fig. PMID:25956879

  4. Consumption of fig fruits grown in Oman can improve memory, anxiety, and learning skills in a transgenic mice model of Alzheimer's disease.

    Science.gov (United States)

    Subash, Selvaraju; Essa, Musthafa Mohamed; Braidy, Nady; Al-Jabri, Ahood; Vaishnav, Ragini; Al-Adawi, Samir; Al-Asmi, Abdullah; Guillemin, Gilles J

    2016-12-01

    Alzheimer disease (AD) is one of the most common forms of dementia in the elderly. Several reports have suggested neurotoxic effects of amyloid beta protein (Aβ) and role of oxidative stress in AD. Figs are rich in fiber, copper, iron, manganese, magnesium, potassium, calcium, vitamin K, and are a good source of proanthocyanidins and quercetin which demonstrate potent antioxidant properties. We studied the effect of dietary supplementation with 4% figs grown in Oman on the memory, anxiety, and learning skills in APPsw/Tg2576 (Tg mice) mice model for AD. We assessed spatial memory and learning ability, psychomotor coordination, and anxiety-related behavior in Tg and wild-type mice at the age of 4 months and after 15 months using the Morris water maze test, rota-rod test, elevated plus maze test, and open-field test. Tg mice that were fed a control diet without figs showed significant memory deficits, increased anxiety-related behavior, and severe impairment in spatial, position discrimination learning ability, and motor coordination compared to the wild-type control mice on the same diet, and Tg mice fed on 4% fig diet supplementation for 15 months. Our results suggest that dietary supplementation of figs may be useful for the improvement of cognitive and behavioral deficits in AD.

  5. Comparisons of host mitochondrial, nuclear and endosymbiont bacterial genes reveal cryptic fig wasp species and the effects of Wolbachia on host mtDNA evolution and diversity

    Directory of Open Access Journals (Sweden)

    Feng Gui

    2011-04-01

    Full Text Available Abstract Background Figs and fig-pollinating wasp species usually display a highly specific one-to-one association. However, more and more studies have revealed that the "one-to-one" rule has been broken. Co-pollinators have been reported, but we do not yet know how they evolve. They may evolve from insect speciation induced or facilitated by Wolbachia which can manipulate host reproduction and induce reproductive isolation. In addition, Wolbachia can affect host mitochondrial DNA evolution, because of the linkage between Wolbachia and associated mitochondrial haplotypes, and thus confound host phylogeny based on mtDNA. Previous research has shown that fig wasps have the highest incidence of Wolbachia infection in all insect taxa, and Wolbachia may have great influence on fig wasp biology. Therefore, we look forward to understanding the influence of Wolbachia on mitochondrial DNA evolution and speciation in fig wasps. Results We surveyed 76 pollinator wasp specimens from nine Ficus microcarpa trees each growing at a different location in Hainan and Fujian Provinces, China. We found that all wasps were morphologically identified as Eupristina verticillata, but diverged into three clades with 4.22-5.28% mtDNA divergence and 2.29-20.72% nuclear gene divergence. We also found very strong concordance between E. verticillata clades and Wolbachia infection status, and the predicted effects of Wolbachia on both mtDNA diversity and evolution by decreasing mitochondrial haplotypes. Conclusions Our study reveals that the pollinating wasp E. verticillata on F. microcarpa has diverged into three cryptic species, and Wolbachia may have a role in this divergence. The results also indicate that Wolbachia strains infecting E. verticillata have likely resulted in selective sweeps on host mitochondrial DNA.

  6. Template - FIG Working Week 2007

    African Journals Online (AJOL)

    Markku Villikka

    Talking Titler: Evolutionary and Self-Adaptive Land Tenure .... The thinking has parallels with grounded theory research methodology in the social sciences, .... This concerns the assessment, verification and validation of the changes taking.

  7. Frequency distribution, isotopic composition and physical characterization of plutonium-bearing particles from the Fig-Quince zone on Runit Island, Enewetak Atoll

    International Nuclear Information System (INIS)

    Hamilton, T.F.; Martinelli, R.E.; Kehl, S.R.; Rivers, A.N.; Brown, T.A.; Tumey, S.J.; Jernstroeem, J.; Williams, R.W.

    2009-01-01

    Runit Island on Enewetak Atoll was very heavily impacted by the U.S. nuclear testing campaign in the northern Marshall Islands (1946-58). The primary source of contamination on Runit Island was the 1958 Quince safety test where a large quantity of device plutonium (Pu) was scattered over the area near the GZ. A second low-yield device was detonated on the same site 10 days later, further disturbing the soil and leaving behind a very heterogeneous pattern of contamination including milligram-size particles of plutonium. A limited cleanup of the Fig-Quince zone was carried out in 1979. During this period, the effectiveness of the cleanup operations was primarily evaluated on the basis of bulk soil concentration data with little consideration given to the heterogeneity and long-term material-, biological-, and environmental-specific impacts of residual high activity (hot) particle contamination. The aim of the present study was twofold; (i) to characterize the levels and distribution of residual contamination in the Fig-Quince zone, and (ii) to develop pertinent data on the frequency distribution, elemental and isotopic composition, and physico-chemical properties of hot particles isolated from surface soils from Fig-Quince with a view towards providing recommendations on the future management and possible cleanup of the site. Today, Runit Island remains under an administrative quarantine. (author)

  8. Phosphoinositide 5-phosphatase Fig 4p is required for both acute rise and subsequent fall in stress-induced phosphatidylinositol 3,5-bisphosphate levels.

    Science.gov (United States)

    Duex, Jason E; Nau, Johnathan J; Kauffman, Emily J; Weisman, Lois S

    2006-04-01

    Phosphoinositide lipids regulate complex events via the recruitment of proteins to a specialized region of the membrane at a specific time. Precise control of both the synthesis and turnover of phosphoinositide lipids is integral to membrane trafficking, signal transduction, and cytoskeletal rearrangements. Little is known about the acute regulation of the levels of these signaling lipids. When Saccharomyces cerevisiae cells are treated with hyperosmotic medium the levels of phosphatidylinositol 3,5-bisphosphate (PI3,5P(2)) increase 20-fold. Here we show that this 20-fold increase is rapid and occurs within 5 min. Surprisingly, these elevated levels are transient. Fifteen minutes following hyperosmotic shock they decrease at a rapid rate, even though the cells remain in hyperosmotic medium. In parallel with the rapid increase in the levels of PI3,5P(2), vacuole volume decreases rapidly. Furthermore, concomitant with a return to basal levels of PI3,5P(2) vacuole volume is restored. We show that Fig 4p, consistent with its proposed role as a PI3,5P(2) 5-phosphatase, is required in vivo for this rapid return to basal levels of PI3,5P(2). Surprisingly, we find that Fig 4p is also required for the hyperosmotic shock-induced increase in PI3,5P(2) levels. These findings demonstrate that following hyperosmotic shock, large, transient changes occur in the levels of PI3,5P(2) and further suggest that Fig 4p is important in regulating both the acute rise and subsequent fall in PI3,5P(2) levels.

  9. IMPACT OF THE FERMENTATION PROCESS WITH IMMOBILIZED YEAST CELLS ON THE AROMA PROFILE AND SENSORY QUALITY OF DISTILLATES PRODUCED FROM TWO FIG (Ficus carica L. CULTIVARS

    Directory of Open Access Journals (Sweden)

    Borislav Miličević

    2017-01-01

    Full Text Available The aim of this research was to investigate the influence of immobilized cell fermentation on aroma and sensory characteristics of distillates produced from two fig varieties commonly grown in Croatia (Petrovača bijela and Petrovača crna. Distillate samples were produced both by classical and immobilized yeast fermentation technology. Aroma profile was determined using GC/FID and sensory analysis was conducted according to German DLG model. Results showed that immobilized cell technique gives distillates with higher ethanol and lower ester contents, but of higher sensory quality. It is a promising technique for production of high quality fruit distillates.

  10. Synergistic Hepatoprotective and Antioxidant Effect of Artichoke, Fig, Blackberry Herbal Mixture on HepG2 Cells and Their Metabolic Profiling Using NMR Coupled with Chemometrics.

    Science.gov (United States)

    Youssef, Fadia S; Labib, Rola M; Eldahshan, Omayma A; Singab, Abdel Nasser B

    2017-12-01

    The edible plants have long been reported to possess a lot of biological activities. Herein, the hepatoprotective and the antioxidant activities of the aqueous infusion of the edible parts of Cynara cardunculus, Ficus carica, and Morus nigra and their herbal mixture (CFM) was investigated in vitro using CCl 4 induced damage in HepG2 cells. The highest amelioration was observed via the consumption of CFM at 1 mg/ml showing 47.00% and 37.09% decline in aspartate transaminase and alanine transaminase and 77.32% and 101.02% increase in reduced glutathione and superoxide dismutase comparable to CCl 4 treated cells. Metabolic profiling of their aqueous infusions was done using nuclear magnetic resonance spectroscopic experiments coupled with chemometrics particularly hierarchical cluster analysis (HCA) and principal component analysis (PCA). The structural closeness of the various metabolites existing in black berry and the mixture as reflected in the PCA score plot and HCA processed from the 1 H-NMR spectral data could eventually explained the close values in their biological behavior. For fig and artichoke, the existence of different phenolic metabolites that act synergistically could greatly interpret their potent biological behavior. Thus, it can be concluded that a herbal mixture composed of black berry, artichoke, and fig could afford an excellent natural candidate to combat oxidative stress and counteract hepatic toxins owing to its phenolic compounds. © 2017 Wiley-VHCA AG, Zurich, Switzerland.

  11. Sex ratio in two species of Pegoscapus wasps (Hymenoptera: Agaonidae) that develop in figs: can wasps do mathematics, or play sex ratio games?

    Science.gov (United States)

    Ramírez-Benavides, William; Monge-Nájera, Julián; Chavarría, Juan B

    2009-09-01

    The fig pollinating wasps (Hymenoptera: Agaonidae) have obligate arrhenotoky and a breeding structure that fits local mate competition (LMC). It has been traditionally assumed that LMC organisms adjust the sex ratio by laying a greater proportion of male eggs when there is superparasitism (several foundresses in a host). We tested the assumption with two wasp species, Pegoscapus silvestrii, pollinator of Ficus pertusa and Pegoscapus tonduzi, pollinator of Ficus eximia (= F citrifolia), in the Central Valley of Costa Rica. Total number of wasps and seeds were recorded in individual isolated naturally colonized syconia. There was a constant additive effect between the number of foundresses and the number of males produced in the brood of a syconium, while the number of females decreased. Both wasp species seem to have precise sex ratios and probably lay the male eggs first in the sequence, independently of superparasitism and clutch size: consequently, they have a non-random sex allocation. Each syconium of Ficus pertusa and of F. eximia colonized by one foundress had similar mean numbers of females, males, and seeds. The two species of wasps studied do not seem to adjust the sex ratio when there is superparasitism. Pollinating fig wasp behavior is better explained by those models not assuming that females do mathematical calculations according to other females' sex ratios, size, number of foundresses, genetic constitution, clutch size or environmental conditions inside the syconium. Our results are in agreement with the constant male number hypothesis, not with sex ratio games.

  12. Condutividade e difusividade térmica do figo (Ficus carica L. "Roxo de Valinhos" Conductivity and thermal diffusivity of fig fruit (Ficus carica L. "Roxo de Valinhos"

    Directory of Open Access Journals (Sweden)

    Saul D. Sarria

    2004-04-01

    Full Text Available O resfriamento e/ou congelamento de produtos hortícolas, depois da colheita, é realizado com o objetivo de retirar o calor desses produtos, permitindo-lhes, em função disso, um tempo maior de conservação. Portanto, o conhecimento das propriedades físicas que envolvem transferência de calor do figo "Roxo de Valinhos" é útil para o cálculo de projetos e a análise de sistemas de engenharia de alimentos em geral, assim como para o emprego em equações de modelos matemáticos termodinâmicos. Neste trabalho, foram determinadas, experimentalmente, a condutividade e a difusividade térmica do figo inteiro no estádio rami e, a partir desses valores, foi determinado o calor específico. Foi utilizado o método transiente da Fonte Linear de Calor. Foi introduzida nas frutas uma sonda que contém resistência elétrica e termopares. Para manter constante a temperatura da fruta, montou-se um sistema de resfriamento a água. Encontrou-se que o figo rami apresentou um valor de condutividade térmica de 0,52 W m-1 °C, difusividade térmica de 1,56 x 10-7 m² s-1, massa específica do figo de 815,6 kg m-3 e calor específico de 4,07 kJ kg-1 °C.The post harvest cooling and/or freezing processes for horticultural products have been carried out with the objective of removing the heat from these products, allowing them a bigger period of conservation. Therefore, the knowledge of the physical properties that involve heat transference in the fig fruit "Roxo de Valinhos" is useful for calculating projects and systems of food engineering in general, as well as, for using in equations of thermodynamic mathematical models. The values of conductivity and thermal diffusivity of the whole fig fruit-rami index were determined, and from these values it was determined the value of the specific heat. For these determination it was used the transient method of the Line Heat Source. The results shown that the fig fruit has a thermal conductivity of 0.52 W m-1

  13. Sex ratio in two species of Pegoscapus wasps (Hymenoptera: Agaonidae that develop in figs: can wasps do mathematics, or play sex ratio games?

    Directory of Open Access Journals (Sweden)

    William Ramírez-Benavides

    2009-09-01

    Full Text Available The fig pollinating wasps (Hymenoptera: Agaonidae have obligate arrhenotoky and a breeding structure that fits local mate competition (LMC. It has been traditionally assumed that LMC organisms adjust the sex ratio by laying a greater proportion of male eggs when there is superparasitism (several foundresses in a host. We tested the assumption with two wasp species, Pegoscapus silvestrii, pollinator of Ficus pertusa and Pegoscapus tonduzi, pollinator of Ficus eximia (= F. citrifolia, in the Central Valley of Costa Rica. Total number of wasps and seeds were recorded in individual isolated naturally colonized syconia. There was a constant additive effect between the number of foundresses and the number of males produced in the brood of a syconium, while the number of females decreased. Both wasp species seem to have precise sex ratios and probably lay the male eggs first in the sequence, independently of superparasitism and clutch size: consequently, they have a non-random sex allocation. Each syconium of Ficus pertusa and of F. eximia colonized by one foundress had similar mean numbers of females, males, and seeds. The two species of wasps studied do not seem to adjust the sex ratio when there is superparasitism. Pollinating fig wasp behavior is better explained by those models not assuming that females do mathematical calculations according to other females’ sex ratios, size, number of foundresses, genetic constitution, clutch size or environmental conditions inside the syconium. Our results are in agreement with the constant male number hypothesis, not with sex ratio games. Rev. Biol. Trop. 57 (3: 605-621. Epub 2009 September 30.

  14. Les séries figées dans Le traité de stylistique de Charles Bally (1865-1947

    Directory of Open Access Journals (Sweden)

    Brigitte Lépinette

    2013-12-01

    Full Text Available Cet article contextualise dans Le traité de stylistique ([Heidelberg, 1909 et 1921] 1951 de Charles Bally le traitement des séries figées, question qui, en particulier, après les recherches sur la combinatoire sémantico-lexicale d’Igor Mel’čuk et les travaux syntaxico-sémantiques, de base distributionaliste, de Maurice Gross spécialement, a donné lieu, de nos jours, à une littérature linguistique aussi bien quantitativement que qualitativement importante. Avant ces derniers auteurs, Bally a fait de ces séries phraséologiques un élément sur lequel portera son double objectif d’identification et de délimitation dans la langue des faits d’expression liés à l’affectivité (considérés par opposition aux faits d’expression qui le sont à la pensée. Dans le cadre des présupposés linguistiques particuliers de la stylistique de Bally, l’analyse des séries figées permettra à ce linguiste d’en reconnaître les principales caractéristiques (lexicales, sémantiques mais non syntaxiques. Cependant, –contrairement aux études récentes dans ce domaine, d’abord théoriques– elle sera mise au service d’un apprentissage du français s’appuyant sur ce que nous pouvons appeler un corpus (avant la lettre destiné à l’apprentissage d’une langue.

  15. Substratos no enraizamento de estacas herbáceas de figueira oriundas da desbrota Substrates in the rooting of fig tree herbaceous cuttings originated from the sprouting

    Directory of Open Access Journals (Sweden)

    Rafael Pio

    2005-06-01

    Full Text Available Com o presente trabalho teve-se como objetivo verificar o enraizamento de estacas de figueira oriundas da desbrota, por meio da utilização de diferentes substratos. Foram coletadas estacas herbáceas de figueira 'Roxo de valinhos', aproximadamente com 10 cm de comprimento, no momento da desbrota da figueira. As estacas com apenas duas folhas e sem gema apical foram acondicionadas em bandejas de polipropileno, contendo diferentes substratos: casca de pinus®, vermiculita®, fibra de coco®, plantmax®, solo + esterco bovino (1:1 v/v e tropstrato® . Posteriormente, as estacas foram colocadas em casa-de-vegetação, com umidade e temperatura controlada. Após 50 dias, avaliaram-se a porcentagem de estacas enraizadas, brotadas e mortas, número de folhas e raízes emitidas da estaca. Os substratos fibra de coco® e plantmax® promoveram melhores resultados.The present work had the objective to verify the rooting of fig tree cuttings originating from sprouting, through the use of different substrates. Herbaceous cuttings were collected of 'Roxo de valinhos' fig tree with 10 cm of length when the sprouting was happening. The cuttings with two leaves and not of the apical bud to conditioned in polypropylene trays containing different substrates: casca de pinus®, vermiculita®, coconut fiber®, plantmax®, soil + cow mature(1:1 v/v and tropstrato® . The cuttings were placed at greenhouse, under humidity and temperature control. After 50 days, the rooting, sprouting and death cutting percentage, the number of leaves and roots of each cutting were evaluated. The substrates coconut fiber® and plantmax® promoted better results.

  16. Cattle manure fertilization increases fig yield Adubação com esterco de curral na produção da figueira

    Directory of Open Access Journals (Sweden)

    Sarita Leonel

    2009-12-01

    Full Text Available Fertilization using organic compounds is complementary to chemical fertilization, being essential to integrated fruit production. Reports on fig tree (Ficus carica L. organic fertilization and mineral nutrition are worldwide scarce, especially in Brazil. This experiment aimed to evaluate the effects of cattle manure fertilization on the yield and productivity of the fig tree 'Roxo de Valinhos' in Botucatu, São Paulo State, Brazil, during the 2002/03, 2003/04, 2004/05 and 2005/06 crop cycles. Plants aged one, two, three and four year olds received the following cattle manure treatments: control (no fertilizer, 25%, 50%, 75%, 100%, 125% and 150% of the recommended N level for this crop. The evaluated variables were: fruit number, weight and mean diameter, plant yield and productivity. The application of cattle manure increased productivity, yield and fruit number, slightly affecting fruit dimensions. After four years of cattle manure application, the best results were obtained with 76 to 124% of the N level recommended for the fig crop.A adubação com compostos orgânicos é complementar à adubação química e especialmente necessária para a produção integrada de frutas. Trabalhos de pesquisa com adubação orgânica e nutrição mineral da figueira (Ficus carica L. são escassos em todo o mundo e particularmente, no Brasil. O experimento teve como objetivo avaliar os efeitos da adubação orgânica com esterco de curral na produção e produtividade da figueira 'Roxo de Valinhos' em Botucatu-SP, nos ciclos de produção de 2002/03, 2003/04, 2004/05 e 2005/06. As plantas com idade de um, dois, três e quatro anos receberam os tratamentos com doses de esterco de curral correspondentes a: testemunha (sem adubação, 25%, 50%, 75%, 100%, 125% e 150% da dose recomendada de N para a cultura. As variáveis avaliadas foram número, peso e diâmetro médio dos frutos, produção por planta e produtividade. A aplicação de esterco de curral

  17. Il corpo della madre schiava, i corpi dei figli. Forme di resistenza alla schiavitù nell’America del XIX secolo

    Directory of Open Access Journals (Sweden)

    Irene Fattacciu

    2009-12-01

    Full Text Available Slavery represents the most evident form of appropriation and exploitation of the body, notably of the female body. This article focuses on motherhood as a place of oppression and resistance to slavery. The devastating consequences of slavery on the mother-child relation is exemplified, in many slave narratives, by the account of when a child, realizing that he does not belong to his/her parents, perceives him/herself as a slave for the first time. Female slaves suffered a double form of exploitation, both economic (as work force and sexual: besides being exposed to the sexual abuses by masters and overseers, after 1807 they became the only precious resource to “produce” new slaves. The impotence and disillusion felt by enslaved mothers shaped contradictory and contrasting definitions of motherhood. This ambiguity was the centre of women’s daily resistance to slavery: if slavery denied parental role, the refusal of motherhood became the most explicit form of denial of women’s role in the maintenance of the slave system. The author also looks at the reinterpretation of these stories in 20th century literature, shifting the focus from motherhood as an aspect of slavery to investigating slavery in order to understand the evolving definition and practices of motherhood in history.Keywords: schiave, corpo, famiglia, maternità, madri, figli, racconti di schiavitù, resistenza, sessualità, infanticidio; female slaves, body, family, motherhood, mothers, children, slave narratives, resistance, sexuality, infanticide.

  18. Poda e sistemas de condução na produção de figos verdes Pruning and conduction system in the yield of green fig

    Directory of Open Access Journals (Sweden)

    Carlos Antonio Alvarenga Gonçalves

    2006-06-01

    Full Text Available O objetivo deste trabalho foi verificar o efeito da época de poda e de sistemas de condução sobre crescimento, produção e qualidade de frutos da figueira cultivada na região norte mineira, sob irrigação. O delineamento utilizado foi em blocos ao acaso, com quatro repetições, e os tratamentos arranjados em esquema fatorial 4x2, tomando por fatores épocas de poda (junho, setembro, dezembro e março e sistemas de condução (com desponte e sem desponte. Em cada parcela, constituída de três plantas úteis, foram coletados dados nos ciclos de produção 2000/2001 e 2001/2002. Não houve interação entre os fatores época de poda e sistema de condução. Houve diferenças de produção entre épocas de poda; plantas podadas em março e junho apresentaram maiores produções. Não houve diferença de produção entre os dois sistemas de condução. Diferentes épocas de poda e sistemas de condução não influíram na qualidade dos frutos em relação a teores de sólidos solúveis totais, pH, acidez total titulável, açúcares totais, glucose, sacarose e amido. A poda da figueira em diferentes épocas do ano pode propiciar produção na entressafra da cultura no norte de Minas Gerais, sem alterar a qualidade dos frutos verdes com padrão para a indústria.The objective of the work was to verify the effect of pruning time and conduction system on growth, yield, and quality of the fig tree fruit grown in the northern Minas Gerais region, under irrigation. The design utilized was randomized blocks with four replicates, and the treatments arranged in a 4x2 factorial scheme, taking as factors pruning times (June, September, December and March and conduction system (with lopping and without lopping. In each plot, made up of three useful plants, data concerning the cropping cycles of 2000/2001 and 2001/2002 were collected. No interaction between the factors pruning time and conduction system was verified. There were yield differences between

  19. Época de poda da figueira cultivada no estado de São Paulo Pruning time for fig trees in the state of São Paulo

    Directory of Open Access Journals (Sweden)

    Orlando Rigitano

    1963-01-01

    Full Text Available No Estado de São Paulo as figueiras (Ficus carica L. são anualmente submetidas a um tipo de poda hibernal que consiste na eliminação quase total da copa formada na estação anterior. Com a finalidade de estudar o comportamento de figueiras podadas em diferentes épocas durante o inverno, foi iniciado em 1960, em Campinas, um experimento com cinco épocas de poda no período de 1.° de maio a 1.° de setembro. São apresentados os dados de produção, por tratamento obtidos em 1962 e 1963, relativos ao número e ao pêso de figos, assim como os pesos médios de uma fruta. Os dados de 1963, revelaram diferenças significativas e permitiram várias conclusões. A poda feita em 1.° de agôsto ofereceu os melhores resultados, embora sem diferir significativamente daquela executada em 1.° de julho. Como era esperado, as podas levadas a efeito nas épocas extremas, isto é, em princípios de maio e de setembro, resultaram nas produções mais baixas. Observou-se tendência da obtenção de colheitas mais precoces e figos mais pesados nos tratamentos mais produtivos.With a view to compare the effects on fruit bearing, pruning of fig trees was carried out in Campinas, State of São Paulo, during the dormant season of the plant, at 5 different dates, namely on the 1st day of each of the months of May, June, July, August and September. Pruning was started as soon as the plants became more or less dormant in the fall and was continued until vegetation again appeared at the end of winter. The pruning operation took place for two following years and at the dates mentioned all the new branches were cut back to short stubs. The experimental plot consisted of 30 trees of the variety "Roxo de Valinhos" (San Piero spread apart 7 by 13 feet and was laid out in randomized blocks with 3 replications. The results of this trial can be summarized as follows: a Trees pruned on August 1st gave the highest yield followed by those pruned on July 1st. While the

  20. Acclimatization and leaf anatomy of micropropagated fig plantlets Aclimatização e anatomia foliar de plântulas de figo micropropagadas

    Directory of Open Access Journals (Sweden)

    Chrystiane Fráguas Chirinéa

    2012-12-01

    Full Text Available The survival of micropropagated plants during and after acclimatization is a limiting process to plant establishment. There is little information on how the anatomy of vegetative organs of Ficus carica can be affected by culture conditions and acclimatization. The present research aimed to study the effects of time on culture medium and substrates during the acclimatization of fig tree plantlets produced in vitro, characterizing some leaf anatomy aspects of plantlets cultured in vitro and of fig trees produced in field. Plantlets previously multiplied in vitro were separated and transferred into Wood Plant Medium (WPM where they were kept for 0, 15, 30, 45 and 60 days. Different substrates were tested and studies on leaf anatomy were performed in order to compare among plantlets grown in vitro, plantlets under 20, 40 and 60 days of acclimatization, and field grown plants. Keeping plantlets for 30 days in WPM allowed better development in Plantmax during acclimatization. Field grown plants presented higher number of stomata, greater epicuticular wax thickness and greater leaf tissue production compared to in vitro ones. The leaf tissues of in vitro plantlets show little differentiation and have great stomata number compared with acclimatized plants, which reduce the number of stomata during the acclimatization process.A sobrevivência de plantas micropropagadas durante e após a aclimatização é um processo limitante para o estabelecimento de plantas. Poucas informações são encontradas de como a anatomia de órgãos vegetativos de Ficus carica pode ser afetada pelas condições de cultivo e aclimatização. O presente trabalho teve por objetivo estudar os efeitos do tempo em meio de cultura e substratos durante a aclimatização de plântulas de figueira produzidas in vitro e cultivadas no campo. Plântulas multiplicadas in vitro foram separadas e transferidas para meio WPM, onde foram mantidas por 0; 15; 30; 45 e 60 dias. Diferentes

  1. Assessment of Geographic and Host-Associated Population Variations of the Carob Moth, Ectomyelois ceratoniae, on Pomegranate, Fig, Pistachio and Walnut, Using AFLP Markers

    Science.gov (United States)

    Mozaffarian, Fariba; Mardi, Mohsen; Sarafrazi, Alimorad; Nouri Ganbalani, Gadir

    2008-01-01

    The carob moth, Ectomyelois ceratoniae (Zeller 1839) (Lepidoptera: Pyralidae) is the most important pest of pomegranate, Punica granatum L. (Myrtales: Ponicaceae), in Iran. In this study, 6 amplified fragment length polymorphism primer combinations were used to survey the genetic structure of the geographic and putative host-associated populations of this pest in Iran. An AMOVA was performed on test populations. Pairwise differences, Mantel test, multidimensional analysis, cluster analysis and migration rate were calculated for 5 geographic populations of E. ceratoniae sharing the same host, pomegranate. In another part of the study, 3 comparisons were performed on pairwise populations that were collected on different hosts (pomegranate, fig, pistachio and walnut) in same geographic regions. The results showed high within population variation (85.51% of total variation), however geographic populations differed significantly. The Mantel test did not show correlations between genetic and geographic distances. The probable factors that affect genetic distances are discussed. Multidimensional scaling analysis, migration rate and cluster analysis on geographic populations showed that the Arsanjan population was the most different from the others while the Saveh population was more similar to the Sabzevar population. The comparisons didn't show any host fidelity in test populations. It seems that the ability of E. ceratoniae to broaden its host range with no fidelity to hosts can decrease the efficiency of common control methods that are used on pomegranate. The results of this study suggest that in spite of the effects of geographic barriers, high within-population genetic variation, migration rate and gene flow can provide the opportunity for emerging new phenotypes or behaviors in pest populations, such as broadening host range, changing egg lying places, or changing over-wintering sites to adapt to difficult conditions such as those caused by intensive control

  2. Il corpo della madre schiava, i corpi dei figli. Forme di resistenza alla schiavitù nell’America del XIX secolo

    Directory of Open Access Journals (Sweden)

    Irene Fattacciu

    2010-05-01

    Full Text Available

    Slavery represents the most evident form of appropriation and exploitation of the body, notably of the female body. This article focuses on motherhood as a place of oppression and resistance to slavery. The devastating consequences of slavery on the mother-child relation is exemplified, in many slave narratives, by the account of when a child, realizing that he does not belong to his/her parents, perceives him/herself as a slave for the first time. Female slaves suffered a double form of exploitation, both economic (as work force and sexual: besides being exposed to the sexual abuses by masters and overseers, after 1807 they became the only precious resource to “produce” new slaves. The impotence and disillusion felt by enslaved mothers shaped contradictory and contrasting definitions of motherhood. This ambiguity was the centre of women’s daily resistance to slavery: if slavery denied parental role, the refusal of motherhood became the most explicit form of denial of women’s role in the maintenance of the slave system. The author also looks at the reinterpretation of these stories in 20th century literature, shifting the focus from motherhood as an aspect of slavery to investigating slavery in order to understand the evolving definition and practices of motherhood in history.

    Keywords: schiave, corpo, famiglia, maternità, madri, figli, racconti di schiavitù, resistenza, sessualità, infanticidio; female slaves, body, family, motherhood, mothers, children, slave narratives, resistance, sexuality, infanticide.

  3. Radioactivity distribution of the fruit trees ascribable to radioactive fall out (6). Effect of heterogeneity of caesium-137 concentration in soil on transferability to grape trees and fig trees

    International Nuclear Information System (INIS)

    Takata, Daisuke; Yasunaga, Eriko; Tanoi, Keitaro

    2013-01-01

    We examined the effects of the heterogeneity of 137 Cs concentration in soil on transferability to shallow rooted fig and non-shallow rooted grapes. Three-year-old trees were planted into the pots filled with soil changed to the concentration of radioactivity Cs in surface (0 - 5cm) and deep soil (5 - 15cm). Transfer rate of radioactive 137 Cs to plants from the soil was higher in fig than in grapes when grown under the same conditions. In fig trees, transfer rate of radioactive 137 Cs to plants from the soil was higher the plants cultivated under high concentration of 137 Cs in surface soil than in deep soil. (author)

  4. Propagação da figueira 'Roxo de Valinhos' por alporquia Propagation of the fig tree 'Roxo de Valinhos' by air layering

    Directory of Open Access Journals (Sweden)

    Simone Daneluz

    2009-03-01

    of the branch associated to different wounds, substrates and concentrations of indolbutyric acid (IBA in the rooting of air layering in 'Roxo de Valinhos' fig tree. In the first experiment, air layering was accomplished in the basal, medium portion and apical of the branches in the beginning of the month of March. In the prepare the air layering, different wounds were accomplished: whole ring (rings of three cm of length, two cuts (parallel cuts of three cm of length and a cm of width, a cut (measuring three cm of length and one cm of width and the witness cut absence. Soon after, it was placed in the place of the treatment, substrate of humidified pinus, wrapped up with transparent plastic and being tied in the extremities, to avoid the humidity loss. After 50 days, the air layering was removed for the evaluation of the percentage of case-hardened and rooted layers and the medium number of roots. Soon after, they were transplanted for bed of sand humidified under nursery constituted of sombrite with 50% of brightness. After 30 days, it was evaluated the percentage of alive, air layering sprouted and the medium number of sprouts. In the second experiment, the air layering was accomplished in the month of April, in the medium portion of the branches, without wound, being applied in the place, different concentrations of IBA (0, 1000, 2000 and 3000 mg L-1 and soon after, they were involved by the following substrate: humidified pinus, humidified sphagnum and the mixture in the proportion 1:1 v/ v. After 60 days, the air layering was removed for the evaluated of the percentage of case-hardened and rooted layers and the medium number of roots. It was concluded that the air layering should be accomplished in the medium portion of the branches, absent of wound, agreements with 1000 mg L-1 of IBA and involved with pinus substrate.

  5. Genitori dei figli innamorati (tattiche educative

    Directory of Open Access Journals (Sweden)

    Janusz Mastalski

    2012-09-01

    Full Text Available In the contemporary global context where people devalue tradition, the challenge which faces many parents is how they can be meaningfully present in their children’s lives. This can be problematic as in the contemporary world children are often searching for their own identity and space which they do not necessarily locate within their own family home. This text explores the question: how can family ties be nurtured to include children’s interests and affections? The author provides specific guidelines for raising children so that parents can accompany their children’s emotional development.

  6. Figs1,2,3a

    Data.gov (United States)

    U.S. Environmental Protection Agency — all data is in the netCDF format and zipped. after downloading this data, you need to unzip it first to create original netCDF formatted data. This dataset is...

  7. Tissue-Specific Transcriptome and Hormonal Regulation of Pollinated and Parthenocarpic Fig (Ficus carica L. Fruit Suggest that Fruit Ripening is Coordinated by the Reproductive Part of the Syconium

    Directory of Open Access Journals (Sweden)

    Yogev Rosianski

    2016-11-01

    Full Text Available In the unconventional climacteric fig (Ficus carica fruit, pollinated and parthenocarpic fruit of the same genotype exhibit different ripening characteristics. Integrative comparative analyses of tissue-specific transcript and of hormone levels during fruit repining from pollinated vs. parthenocarpic fig fruit were employed to unravel the similarities and differences in their regulatory processes during fruit repining. Assembling tissue-specific transcripts into 147,000 transcripts with 53,000 annotated genes provided new insights into the spatial distribution of many classes of regulatory and structural genes, including those related to color, taste and aroma, storage, protein degradation, seeds and embryos, chlorophyll, and hormones. Comparison of the pollinated and parthenocarpic tissues during fruit ripening showed differential gene expression, especially in the fruit inflorescence. The distinct physiological green phase II and ripening phase III differed significantly in their gene-transcript patterns in both pulp and inflorescence tissues. Gas chromatographic analysis of whole fruits enabled the first determination of ripening-related hormone levels from pollinated and non-pollinated figs. Ethylene and auxin both increased during fruit ripening, irrespective of pollination, whereas no production of active gibberellins or cytokinins was found in parthenocarpic or pollinated ripening fruit. Tissue-specific transcriptome revealed apparent different metabolic gene patterns for ethylene, auxin and ABA in pollinated vs. parthenocarpic fruit, mostly in the fruit inflorescence. Our results demonstrate that the production of abscisic acid (ABA, non-active ABA–GE conjugate and non-active indoleacetic acid (IAA–Asp conjugate in pollinated fruits is much higher than in parthenocarpic fruits. We suggest that fruit ripening is coordinated by the reproductive part of the syconium and the differences in ABA production between pollinated and

  8. Produção da figueira em ambiente protegido submetida a diferentes épocas de poda e número de ramos Fig-growing under protecting environment, submited to different pruning times and number of branches

    Directory of Open Access Journals (Sweden)

    Alexandre Augusto Nienow

    2006-12-01

    Full Text Available A produção de figos para consumo in natura, no sul do Brasil, é limitada pelas chuvas, que causam elevadas perdas por podridão. O uso da poda drástica, por sua vez, retarda o início da colheita e as baixas temperaturas impedem o crescimento e a maturação dos frutos a partir do início do outono. O cultivo da figueira está sendo estudado em ambiente protegido como tecnologia para ampliar o período de colheita, elevar a produtividade e minimizar perdas de frutos. Figueiras cv. Roxo de Valinhos foram cultivadas em ambiente protegido dotado de sistema de irrigação por gotejamento e submetidas a três épocas de podas, no segundo e terceiro ciclos vegetativos (15 de maio, 10 de agosto e 5 de outubro. As plantas foram conduzidas, no segundo ciclo, com 4 e 8 ramos por planta, espaçadas de 0,75 m x 1,90 m e de 1,50 m x 1,90 m, respectivamente, e, no terceiro ciclo, com 6 e 12 ramos por planta, nos respectivos espaçamentos. O delineamento experimental foi com quatro blocos casualizados, os tratamentos dispostos em faixa e duas plantas úteis por parcela. O cultivo do figo em ambiente protegido e com fertirrigação é tecnicamente viável na região de Passo Fundo - RS. A produção obtida é equivalente a 41 t.ha-1 e 43 t.ha-1 no segundo e terceiro ciclos de cultivo, respectivamente. A poda realizada no início de agosto e as plantas conduzidas com 8 a 12 ramos, no espaçamento de 1,50 m x 1,90 m, favoreceram a taxa de frutificação, a produção por planta e por área, além de maior período de colheita. O sistema de cultivo de figo em ambiente protegido foi eficiente em prevenir perdas por rachaduras e podridões de frutos.Production of fresh fig (Carica ficus L. fruits, in the south of Brazil, is limited by drastic rains that cause high losses of mature figs. Drastic pruning delays the beginning of the harvest and low temperatures hinder growth and maturation of fruits in the beginning of autumn. Fig-growing is being studied under

  9. Effects of auxin and misting on the rooting of herbaceous and hardwood cuttings from the fig tree Efeitos de auxina e nebulização no enraizamento de estacas herbáceas e lenhosas de figueira

    Directory of Open Access Journals (Sweden)

    Cleiton Mateus Sousa

    2013-06-01

    Full Text Available Propagation of the fig tree predominately uses hardwood cuttings obtained from pruning stock plants. With a view to optimising fig tree propagation, the effects of auxin and misting on the rooting of herbaceous and hardwood cuttings from the fig tree were evaluated. An experiment was set up in a 2x2x2 factorial design, with two types of cuttings (softwood and hardwood, two levels of auxin (0 and 1000 mg L-1 indolbutyric acid and two environments (with and without misting. Thirty days after starting the experiment, rooting, root length, sprouting and losses were all evaluated. The interaction of the type of cutting and the auxin was significant for rooting, sprouting, root length and cutting loss. Misting did not affect the variables analysed. In the absence of auxin, there was no difference between the type of cutting for rooting, length of root and sprouting, while the application of auxin (1,000 mg L-1 produced a reduction in these variables. The production of fig tree seedlings can be made from either softwood or hardwood cuttings and does not require the use of auxin or misting.A propagação da figueira predomina com o uso de estacas lenhosas obtidas após a poda de plantas matrizes. Visando otimizar a propagação da figueira, avaliou-se os efeitos da auxina e da nebulização no enraizamento de estacas herbáceas e lenhosas de figueira. Foi implantado um experimento em fatorial 2x2x2, sendo dois tipos de estacas (herbáceas e lenhosas, dois níveis de auxina (0 e 1.000 mg L-1 de ácido indolbultírico e dois ambientes (com ou sem nebulização. Aos 30 dias após a implantação do experimento, avaliou-se o enraizamento, comprimento da radícula, brotação e perdas. A interação do tipo de estaca e auxina foi significativa para enraizamento, brotação, comprimento da radícula e perdas de estacas. A nebulização não interferiu nas variáveis analisadas. Na ausência de auxina não houve diferença entre os tipos de estacas para o

  10. Disinfestation of Dried Figs by Gamma Radiation; Desinsectation des figues seches par les rayons gamma; Dezinfestatsiya sushenogo inzhira s pomoshch'yu gamma-izlucheniya'; Desinfestacion de higos secos mediante rayos gamma

    Energy Technology Data Exchange (ETDEWEB)

    Papadopoulou, C. P. [Department of Biology, Democritus Nuclear Research Centre, Aghia Paraskevi, Attica (Greece)

    1963-09-15

    Research has been carried on for many years on the disinfestation of stored agricultural products. Recently gamma radiation has been successfully applied in such investigations. Dried figs are among the main export products of Greece. Serious damage is caused by insect attack each year. The research work aimed at: (1) Determining the doses of radiation required to destroy certain species of insects attacking dried figs at their various stages of development, or to destroy their eggs and thus prevent reproduction; and (2) Determining the physical and chemical changes of the texture of dried figs caused by radiation. Studies have been made on the following species: Plodia interpunctella, Ephestia cautella, Carpophilus hemipterous, Oryzaephilus surinamensis and Lasioderma serricorne. The optimum doses required are discussed. At these doses, irradiation damage does not become apparent in the texture of the figs. (author) [French] Des recherches sur la desinsectation des produits agricoles en magasin sont en cours depuis de nombreuses annees. On a recemment utilise avec succes les rayons gamma dans ces etudes. Les insectes font chaque annee de grands ravages dans les figues seches, qui sont l'un des principaux produits d'exportation de la Grece. L'objet des recherches etait le suivant: 1. Determiner les doses de rayonnements necessaires pour detruire certaines especes d'insectes qui, a differents stades de leur developpement, attaquent les figues, ou detruire leurs oeufs et les empecher ainsi de se reproduire; 2. Determiner les modifications physiques et chimiques que les rayonnements produisent dans la texture de la figue seche. Les travaux ont porte sur les especes suivantes: Plodia interpunctella, Ephestia cautella, Carpophilus hemipterous, Oryzaephilus surinamensis et Lasioderma serricorne. Le memoire etudie les dises optimum d'irradiation, qui ne provoquent aucun dommage visible dans la texture de la figue. (author) [Spanish] Des hace muchos anos se estan

  11. Ação de fungos entomopatogênicos em larvas e adultos da mosca do figo Zaprionus indianus (Diptera: Drosophilidae Action of entomopathogenic fungi on the larvae and adults of the fig fly Zaprionus indianus (Diptera: Drosophilidae

    Directory of Open Access Journals (Sweden)

    Virgínia Michelle Svedese

    2012-11-01

    Full Text Available A mosca do figo, Zaprionus indianus, vem se disseminando no Brasil e causou nos últimos anos perdas de até 50% na produção de figos. Uma alternativa viável de controle desta mosca pode ser a utilização de fungos entomopatogênicos. Este trabalho foi conduzido em laboratório (27±1°C, UR 70±10% e fotoperíodo de 12h para avaliar a suscetibilidade dos estágios de larva e adulto de Z. indianus a cinco concentrações (10(8 a 10(4 conídios mL-1 de B. bassiana (URM2915; ESALQ447 e M. anisopliae (URM3349; URM4403. Não houve mortalidade larval e o período de pré-pupa não sofreu alteração em relação ao grupo controle, já o estágio de pupa foi aumentado em até três dias quando se utilizou B. bassiana. A emergência de adultos diminuiu em relação ao grupo controle: 10,6% quando as larvas foram tratadas com a maior concentração de B. bassiana URM2916 e 2,0% com M. anisopliae URM4403. No bioensaio com adultos, a mortalidade máxima atingiu 98,7% com B. bassiana e 100,0% com M. anisopliae. Os menores valores da CL50 foram de 1,09x10(5 conídios mL-1 para B. bassiana URM2916 e de 1,94x10(4 conídios mL-1 para M. anisopliae URM4403. O tempo letal médio (TL50 variou de 4,5 a 6,12 dias. Os resultados demonstraram que ambos os fungos são eficientes e mostram ser promissores agentes biocontroladores da mosca do figo, com destaque para M. anisopliae URM4403.The "fig fly", Zaprionus indianus, has spread by in Brazil and in recent years and has caused losses of up to 50% in the production of figs. A viable alternative to control this fly may be the use of entomopathogenic fungi such. The present study was developed in laboratory (27±1°C, RH 70±10% and 12h photoperiod, to assess the susceptibility of larval and adult stages of Z. indianus to five concentrations (10(8 to 10(4 conidia mL-1 of B. bassiana (URM2915; ESALQ447 and M. anisopliae (URM3349; URM4403. There was no larval mortality and the pre-pupal period did not change compared

  12. Produção da figueira submetida a diferentes épocas de poda e irrigação The yield of fig trees as a function of pruning time and irrigation

    Directory of Open Access Journals (Sweden)

    Sarita Leonel

    2008-12-01

    Full Text Available O trabalho teve como objetivo avaliar diferentes épocas de poda, correspondentes aos meses de julho, agosto, setembro e outubro dos anos de 2004/05 e 2005/06, com e sem o uso de irrigação, em figueira 'Roxo de Valinhos', no município de Botucatu-SP. Para atingir tal objetivo, adotou-se o delineamento experimental em parcelas subdivididas, com 5 repetições em blocos, onde as parcelas corresponderam aos tratamentos com e sem irrigação, e as subparcelas foram constituídas pelas podas realizadas nos quatro meses do ano. Foram avaliadas características de produção e alguns atributos de qualidade, que serviram para indicar a necessidade do uso de irrigação. Os resultados obtidos permitiram concluir que, na avaliação do desdobramento da interação entre épocas de poda e irrigação complementar, o mês de agosto, com o uso de irrigação complementar, foi o mais favorável para a realização da poda da figueira, proporcionando as maiores produções médias verificadas no ensaio, tanto no ciclo agrícola de 2004/05 (3.513,8 g planta-1, quanto em 2005/06 (4.110,7 g planta-1. Em condições não-irrigadas, não houve diferença estatística entre os meses de julho, agosto e setembro de 2004/05 e entre julho e agosto de 2005/06.The research had the purpose to determine the effects of pruning time in July, August, September and October of 2004/05 and 2005/06, with and without irrigation, in the fig trees 'Roxo de Valinhos', located in Botucatu/SP/Brazil. The experimental design was in split plots with 5 replications at random in lines, where the plots consisted in the treatments with and without irrigation and the subplots were composed of the pruning accomplished in the four months of the year. It was evaluated the yield and fruits quality. These characteristics could be used to evaluate the irrigation necessity. The August month with irrigation was the best time to the fig trees pruning, enhancing the yield (3.513,8 g plant-1 in 2004

  13. Preservation of fruits and vegetables using solar dryers. A comparative study for solar and natural drying of grapes, figs, tomatoes and onions. IV. temperature measurements, calculating the generated energy and dryer efficiency during drying

    International Nuclear Information System (INIS)

    Sehery, A.A.; Gallali, Y.M.; Shoshan, H.

    2000-01-01

    This study has taken four axis, first, design and construction of the dryer, secondly, microbial load determination, thirdly, chemical and sensory evaluation data. The results of these three parts were published earlier at the International Congress on Application of Solar and Renewable Energy, Food Science and Technology and World Renewable Energy Congress V, Cairo, Egypt, 1992, 1996 and Florence, Italy, 1998, respectively. The whole study was oriented towards comparing the solar (three modes, direct, indirect, and mixed) and natural drying. The fourth part of the study is dealing with some parameters affecting drying as temperature measurement, calculating the generated energy and the dryer efficiency during drying periods. Drying temperature is considered the most important factor in the drying operation, since the accuracy of temperature measurement gives the correct results and right indication for the approval of these scientific methods in the drying operation and the design of solar dryers. In this project, we depended on temperature measurements at different points by means of thermocouples fixed in the heat collector and the drying chamber. The average temperature outside the dryer ranged from 21-41 degree C. That of the heat collector were 40-75 degree C and those of the drying chamber were in the range of 40-73 degree C. The radiation measurements calculated depending on the results recorded by the solar center instruments from 5/8/95 - 16/10/95. The thermal energy existing from the heat collector to the drying chamber during the drying period was measured using the equation of Holland. From the investigation results, we can conclude that in all trials, solar drying was a more efficient method for drying all samples of fruits and vegetables, especially for grapes, figs and onion. Grapes dried using mixed mode from 83 % to 30 % moisture in 4 days at an average temperature of 55 degree C while natural drying reduced the moisture to 57% for the same period

  14. Pelviureteric Junction Obstruction: A Surgical Experience Fig. 1: PUJ ...

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... Objective: To describe the experience in the management of patients with intrinsic pelviureteric junction obstruction in the town of Mombasa, Kenya. Methods: This was an evaluation of the patients operated upon by the authors between 1995 and 2003. The thirteen patients subjected to surgery are ...

  15. 21 CFR 145.134 - Canned preserved figs.

    Science.gov (United States)

    2010-04-01

    ... this section, to which citric acid or lemon juice or concentrated lemon juice is added, if necessary...) The packing medium referred to in paragraph (a) of this section is prepared from water and one of the...

  16. Le sfide che i figli degli immigrati devono affrontare

    Directory of Open Access Journals (Sweden)

    Sandra Sicurella

    2015-05-01

    Full Text Available Economic changes, poverty, wars, violence and socio-political conditions generated waves of migrants that irreversibly affect the daily lives in our country too. Children of migrants are requested to face many difficulties which are transformed into challenges on a daily basis in order to assert a position in the host society. The number of admissions of foreign children is constantly growing and often the culture clash may lead to exclusion. This is an extremely difficult situation, especially for children who sometimes do not have the adequate tools to deal with this.

  17. 6. International FIG-symposium on deformation measurements. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Pelzer, H; Heer, R [eds.

    1997-12-31

    Due to the diversified fields of specialization of the authors, the papers span a very wide spectrum of theories, applications and case studies, concerning various problems of deformation studies in structural, geotechnical and mining engineering, in rock mechanics and earth crustal movements, covering such topics as: Design and analysis of deformations surveys; Integration of terrestrial, and space measurement techniques; New instrumental developements for automatic, continuous and telemetric data-acquisition with respect to geotechnical and geodetic applications; Monitoring and prediction of ground subsidence in mining areas, land slides and tectonic movements; Modeling and computation of deformations by Kalman-filtering techniques, finite element analysis and a special view to continuum mechanics; Application of expert systems and artificial intelligence; Description and analysis of dynamical deformation problems; special views in rock- and groundmechanics; Demonstration of mechanical engineering problems with respect to the supervision of industrial production and quality control. (orig.)

  18. Level measurements part 2[5 figs]; Nivaamaalinger del 2

    Energy Technology Data Exchange (ETDEWEB)

    Gundersen, Thor Ole

    2006-07-01

    The article discusses various level measurement methods other than using ultrasound that was discussed in part 1 of the article series. Methods using laser, capacity, weight and displacement are presented. Various life span aspects of the machinery are discussed.

  19. I figli della strada. Infanzia indifesa e abbandonata in Romania

    Directory of Open Access Journals (Sweden)

    Rita De Caris

    2010-02-01

    Full Text Available Intervento al Workshop Internazionale “Infanzie e Famiglie in Europa”, del 16 ottobre 2009, presso la Facoltà di Scienze della Formazione, Via Filippo Re, 6 Bologna (Aula Magna.

  20. Pollinating fig wasps: genetic consequences of island recolonization

    NARCIS (Netherlands)

    Zavodna, M.; Arens, P.; Partomihardjo, T.; Vosman, B.; van Dijk, P.J.; Van Damme, J.M.M.

    2005-01-01

    The levels of genetic diversity and gene flow may influence the long-term persistence of populations. Using microsatellite markers, we investigated genetic diversity and genetic differentiation in island (Krakatau archipelago, Indonesia) and mainland (Java and Sumatra, Indonesia) populations of

  1. 7 CFR 457.110 - Fig crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... of quarantine, boycott, or refusal of any entity to accept production. 11. Settlement of Claim (a) We... to abandon and no longer care for if you and we agree on the appraised amount of production. Upon... the appraised amount of production is not reached: (A) We may require you to continue to care for the...

  2. Pelviureteric Junction Obstruction: A Surgical Experience Fig. 1: PUJ ...

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... The left side was more commonly affected in a ratio of 8:5. ... have a right renal carcinoma, and a variant of polycystic kidney on the left. Both had .... review of 219 personal cases. ... A new plastic operation for stricture of the ...

  3. 6. International FIG-symposium on deformation measurements. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Pelzer, H.; Heer, R. [eds.

    1996-12-31

    Due to the diversified fields of specialization of the authors, the papers span a very wide spectrum of theories, applications and case studies, concerning various problems of deformation studies in structural, geotechnical and mining engineering, in rock mechanics and earth crustal movements, covering such topics as: Design and analysis of deformations surveys; Integration of terrestrial, and space measurement techniques; New instrumental developements for automatic, continuous and telemetric data-acquisition with respect to geotechnical and geodetic applications; Monitoring and prediction of ground subsidence in mining areas, land slides and tectonic movements; Modeling and computation of deformations by Kalman-filtering techniques, finite element analysis and a special view to continuum mechanics; Application of expert systems and artificial intelligence; Description and analysis of dynamical deformation problems; special views in rock- and groundmechanics; Demonstration of mechanical engineering problems with respect to the supervision of industrial production and quality control. (orig.)

  4. Network investments, reinvestments, maintenance[3 figs.]; Nettinvesteringer, reinvesteringer, vedlikehold

    Energy Technology Data Exchange (ETDEWEB)

    Sand, Kjell; Solvang, Eivind; Lundgaard, Lars

    2003-07-01

    Following the deregulation of the electricity sector in 1991, the general trend has been a growing cost and cost-benefit awareness in all parts of the sector. In the network activities, the companies are currently focusing sharply on cutting costs in the monopoly franchise and at the same time trying to establish new activity outside the revenue limit. Several polls and analyses conducted by SINTEF Energy show that the network companies are strongly influenced by the regulation enforced by NVE (The Norwegian Water Resources and Energy Directorate). This is true of investments, reinvestments and maintenance.

  5. Efeito da adubação com boro e esterco bovino sobre a produtividade da figueira e as propriedades químicas do solo Effect of boron and cattle manure fertilization on yield productivity fig tree and on soil properties

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Santos Caetano

    2006-08-01

    Full Text Available O objetivo deste trabalho foi verificar o efeito da adubação da cultura da figueira com boro e esterco bovino sobre a produtividade de figos verdes e as propriedades químicas do solo. Os tratamentos foram cinco doses de ácido bórico (0, 20, 40, 60 e 100g planta-1 combinadas com dois níveis de adubação de esterco (sem esterco e 10kg de esterco/planta. O delineamento experimental foi o de blocos casualizados em esquema de parcelas subdivididas e quatro repetições. A adubação com ácido bórico não afetou a produtividade de figos, enquanto que o esterco bovino aumentou-a. Os teores de fósforo e potássio no solo aumentaram significativamente e o teor de alumínio diminuiu significativamente em função da adubação com esterco bovino. O teor de B no solo, extraído pelo método da água quente, aumentou linearmente em função das doses de ácido bórico.The objective of the present work was evaluate the effect of fig tree orchard fertilization with boron and cattle manure on the green fig yield and soil chemical properties. The treatments were five boric acid levels (0, 20, 40, 60 and 100g plant-1 combined with two cattle manure fertilization levels (without cattle manure and 10kg of cattle manure/plant. The experimental design was that of randomized blocks in a split-plot scheme and four repetitions. The boric acid fertilization did not affect the fig productivity whereas the cattle manure one increased it. The P and K content increased significantly and the Al content decreased significantly in function of the cattle manure fertilization. The B soil content, extracted by hot water methodology increased linearly in function of the boric acid levels.

  6. Caracterização física, físico-química, enzimática e de parede celular em diferentes estádios de desenvolvimento da fruta de figueira Physical, chemico-physical, enzymatic and cell wall charazterization during the different development stages of the fig tree fruits

    Directory of Open Access Journals (Sweden)

    Carlos Antonio A. Gonçalves

    2006-03-01

    diferentes estádios de desenvolvimento dos frutos. Com a maturação dos frutos, houve redução dos principais componentes dos polissacarídeos pécticos (galactose, arabinose e ramnose, enquanto os componentes da fração hemicelulósica (xilose, glucose e manose tenderam a aumentar. A solubilização da celulose e queda nos teores de hemicelulose se deu a partir dos 60 dias, quando o fruto, já na maturidade fisiológica, inicia o processo de amaciamento, em função da solubilização de pectinas, pela maior atividade das enzimas pectinametilesterase e poligalacturonase.With the objective of evaluating the physical, physical-chemical, enzymic and cell wall characterization during the different developmental stages of the fig tree fruits under irrigation in Northern Minas Gerais, the present work was developed during the 2001/2002 cropping cycle in the Unidade de Produção Frutícola da Escola Agrotécnica Federal de Salinas (Fruit Growing Unit of the Federal Agrotechnical School of Salinas (Eafsal, town of Salinas. Plants of two years and a half after transplanting and with twelve well developed primary branches (pernadas = the first strong branches of a tree and 2.5x1.5 m spacing were utilized in this experiment. The design applied was completely randomized with two replicates and a total of 40 marked plants. The data collected were concerning 2001/2002 cropping cycle for the June-pruned plants. Evaluated during the different developmental stages of fig tree fruits activity of the enzimes, chemical composition, physical evaluate, neutral sugars and cell wall components. As polyphenoloxidase and peroxidase activity was decreasing, polygalacturonase activity increased throughout the development of the fruits. The fruits reached harvest point for industry and in natura consumption at 30 and 75 days from the differentiation of the buds in syconium, respectively. A significant increase took place in the contents of total soluble solids, total soluble and reducing sugars

  7. Conservação pós-colheita de figos verdes (Ficus carica L. cv. roxo de Valinhos tratados com hipoclorito de sódio e armazenados sob refrigeração em atmosfera modificada passiva Post-harvest conservation of unripe figs (Ficus carica L. cv. "roxo de Valinhos" treated with sodium hypochlorite and stored under refrigeration in passive modified atmosphere

    Directory of Open Access Journals (Sweden)

    Luciana Costa Lima

    2005-08-01

    Full Text Available Os principais causadores de perdas da qualidade de figos são: colheita e embalagens inadequadas, falta de padronização do produto na classificação e péssimas condições de transporte e armazenamento. Com este trabalho objetivou-se avaliar o efeito da imersão em hipoclorito, tipo de embalagem e refrigeração na conservação pós-colheita de figos verdes, cv. Roxo de Valinhos, mediante as características físicas, físico-químicas e químicas, durante o armazenamento. Após seleção, os figos foram imersos ou não em solução de hipoclorito de sódio a 40 ppm conforme os tratamentos, secos ao ar e embalados em filme de PVC de 50 m ou sacos plásticos. Após os tratamentos, os frutos foram submetidos a armazenamento refrigerado (1ºC e 70% de UR em BOD, por um período de 35 dias, sendo avaliados a cada 7 dias. O uso da embalagem reduziu drasticamente a perda de massa dos figos. Frutos não embalados apresentaram-se mais ácidos e com menores teores de açúcares. Com o uso da embalagem, os figos podem ser comercializados até os 35 dias de armazenamento desde que armazenados a 1ºC e 70% de UR em BOD. Já os figos não embalados, estes podem ser comercializados somente até os 2 dias de armazenamento sob refrigeração.The chief causesof quality loss in figs are inadequate harvest and packaging, lack of standardization of the product in the classification and very bad transportation and storage conditions. This work aimed to evaluate the effects of soaking in hypochlorite, and the type of packaging and refrigeration on the post-harvest conservation of unripe figs cv. "Roxo de Valinhos", through physico-chemical analyses, during storage. After selection, the figs were soaked, or not, in a 40ppm sodium hypochlorite solution, air-dried and wrapped in 50µ PVC film or plastic bags. After the treatments, the fruits were submitted to refrigerated storage (1ºC and 70% of RH for a 35-day period, being evaluated every 7 days. Use of the

  8. La mediazione familiare nei casi di affido dei figli/e e violenza domestica: contesto legale, pratiche dei servizi ed esperienze delle donne in Italia / Family mediation in child custody cases and domestic violence: legal context, logic of services and women's experiences in Italy / La médiation familiale dans les cas de garde d’enfants et la violence conjugale : le contexte juridique, les pratiques au sein des services et les expériences des femmes en Italie

    Directory of Open Access Journals (Sweden)

    Mariachiara Feresin

    2017-07-01

    Full Text Available L’applicabilità della mediazione familiare in contesto di violenza domestica (VD è oggetto di discussione. Scopo della ricerca è esplorare il ruolo della mediazione familiare nella gestione degli affidi dei figli in situazione di VD, analizzando le esperienze, conoscenze e significati di differenti attori sociali, quali avvocati, assistenti sociali e donne separate con figli, vittime di VD, e la documentazione inerente. I risultati mostrano che la VD viene occultata durante la mediazione. I professionisti spesso ignorano la VD e di conseguenza applicano la mediazione; ex-coniugi e genitori vengono presentati come distinti; i pattern di potere e controllo agiti dal partner violento durante la relazione continuano in queste occasioni. La mediazione, che dovrebbe essere centrata sul miglior interesse del bambino, si focalizza sul miglior interesse dei padri. I professionisti non conoscono la Convenzione di Istanbul. La sicurezza di donne e bambini/e viene messa a rischio. Le recours à la médiation familiale dans le domaine de la violence conjugale (VC fait l’objet de débats. Cette recherche a pour but d’examiner le rôle de la médiation familiale dans les cas de garde d’enfants en situation de VC, analysant les expériences, les connaissances, les valeurs de différents acteurs sociaux (par exemple, avocats, travailleurs sociaux, femmes séparées avec enfants, victimes de VC ainsi que des documents ad hoc. Les résultats montrent que la VC est dissimulée pendant la médiation. Les professionnels souvent ignorent la VC et par conséquent utilisent la médiation ; ex-conjoints et parents sont par ailleurs présentés sous la forme de deux entités distinctes ; les modèles de pouvoir et de contrôle appliqués par le conjoint violent dans la vie familiale continuent d’être utilisés durant ces occasions. La médiation, qui devrait protéger avant tout l'intérêt de l'enfant, s’adresse au contraire à l’intérêt des p

  9. Radioactive waste storage. Annual report 1974. [*14 figs. ; 4 tabs. ; 5 refs. *

    Energy Technology Data Exchange (ETDEWEB)

    Bechthold, W; Diefenbacher, W; Engelmann, H J; Hild, W; Korthaus, E; Krause, H; Schuchardt, M C; Smailos, E; Albrecht, E; Kolditz, H

    1975-12-01

    This report is a joint effort of Gesellschaft fuer Strahlen- und Umweltforschung mbH Muenchen and Gesellschaft fuer Kernforschung mbH Karlsruhe, presenting a survey of the work performed in 1974 in the field of disposal of radioactive waste. The mining and construction work is discussed, which was carried out both underground and above at the ASSE Salt Mine near Remlingen and which was done for repair, maintenance and expansion of operation in accordance with its future purpose. Moreover, the report gives information on the present status of research and of its results. Also new storage techniques are reported which are currently in the planning stage.

  10. Ethical codes. Fig leaf argument, ballast or cultural element for radiation protection?

    International Nuclear Information System (INIS)

    Gellermann, Rainer

    2014-01-01

    The international association for radiation protection (IRPA) adopted in May 2004 a Code of Ethics in order to allow their members to hold an adequate professional level of ethical line of action. Based on this code of ethics the professional body of radiation protection (Fachverband fuer Strahlenschutz) has developed its own ethical code and adopted in 2005.

  11. Codici alla mano. I due figli di Iorio in contenzioso estetico-giudiziario

    Directory of Open Access Journals (Sweden)

    Francesco de Cristofaro

    2012-10-01

    Full Text Available Il sottobosco ottocentesco delle transparodie – inversioni sessuali in chiave comica, con personaggi en travesti che riprendono per contrappunto figure mitiche dell’immaginario romanzesco e melodrammatico – risulta incomprensibile se si dimentica che già ad alcune figure carismatiche dell’individualismo moderno erano toccate in sorte evirazioni in piena regola (da The Female Quichotte in poi. A tale famiglia di testi si rifà anche un’opera pionieristica nella storia del diritto d’autore: Il figlio di Iorio (1904 di Eduardo Scarpetta, parodia de La figlia di Iorio di Gabriele D’Annunzio, dello stesso anno. La “commedia presepiana” – un po’ opera buffa stile belle epoque, un po’ parodia assai casareccia – provocò un piccolo terremoto giudiziario: una richiesta di consenso, una diffida, una querela per plagio, infine un processo fatto di portentose pezze d’appoggio, e con un’intera società cultural-mondana divisa in due – letterati vs commedianti, pianto vs riso, arte alta vs arte plebea, ecc. – , e alcuni intellettuali di prestigio coinvolti in qualità di periti. Caso interessantissimo di sociologia dell’arte, il processo D’Annunzio-Scarpetta è anche un cruciale episodio di storia della cultura: perché ciò che il tribunale ospitò fu anche un dilettantesco e appassionato brainstorming di “comparatistica forense”.

  12. DETERMINATION OF THE TOXIC EFFECTS OF MERCURY IN THE Brachiaria dictyoneura (Fig. & De Not. Stapf SPECIES

    Directory of Open Access Journals (Sweden)

    Gladis E. Morales

    2013-03-01

    Full Text Available In this research has been evaluated, on a laboratory scale, the toxic effect of mercury on the root development and biomass growth of the Brachiaria dictyoneura species, with the goal of finding an adequate concentration interval for the study on the accumulation of Hg (II. Brachiaria dictyoneura seeds were exposed to different amounts of mercury, the germination kinetics were determined, and after a 20 day growth period the length of the roots and the biomass were measured. There were found harmful effects on the root development starting at 25 mg*kg-1 Hg (II; for the dry biomass the differences were found starting at 5 mg*kg-1 Hg (II and starting at 75 mg*kg-1 Hg (II for the seed emergency time, therefore, working with concentrations not exceeding 25 mg Hg(II*kg-1 of substrate is suggested.

  13. Learning and memory enhancing activity of Ficus carica (Fig: An experimental study in rats

    Directory of Open Access Journals (Sweden)

    Meera Sumanth

    2014-01-01

    Full Text Available Objective: The study aimed to assess the learning and memory enhancing activity of the ethanolic fruit extract of Ficus carica in rats using elevated plus maze (EPM, Hebb-William maze (HWM and Morris water maze (MWM. Materials and Methods: Wistar rats (100-150 g of either sex, were divided into 5 groups (n = 6. Group I (control animals received vehicle, Group II (scopolamine control animals received scopolamine (0.4 mg/kg i.p, Groups III and IV animals received ethanolic fruit extract of F. carica (200 mg/kg and 400 mg/kg p.o and Group V animals received piracetam (400 mg/kg i.p for 27 days. The rats of Groups III-V were injected with a single dose of scopolamine (0.4 mg/kg i.p on 19 th and 27 th day. Assessment of transfer latency (TL, time taken to reach reward chamber (TRC and swim latency (SL was done on 19 th and 27 th day using EPM, HWM and MWM, respectively. The data was analyzed by one-way Analysis of Variance followed by Dunnett′s test. P ≤ 0.05 was considered to be significant. Results: Ethanolic fruit extract of F. carica decreased TL, TRC and SL in comparison to scopolamine treated rats. Conclusion: The fruit of F. carica enhanced learning and memory activity.

  14. 76 FR 14320 - Importation of Figs and Pomegranates From Chile Under a Systems Approach

    Science.gov (United States)

    2011-03-16

    ... comment to Docket No. APHIS-2010-0024, Regulatory Analysis and Development, PPD, APHIS, Station 3A-03.8... using a flushing method, placed in a 20-mesh sieve on top of a 200-mesh sieve, sprinkled with a liquid... process would then be repeated. The contents of the 200- mesh sieve would then be placed on a petri dish...

  15. Effects of Common Fig (Ficus carica Leaf Extracts on Sperm Parameters and Testis of Mice Intoxicated with Formaldehyde

    Directory of Open Access Journals (Sweden)

    Majid Naghdi

    2016-01-01

    Full Text Available Formaldehyde (FA is the leading cause of cellular injury and oxidative damage in testis that is one of the main infertility causes. There has been an increasing evidence of herbal remedies use in male infertility treatment. This assay examines the role of Ficus carica (Fc leaf extracts in sperm parameters and testis of mice intoxicated with FA. Twenty-five adult male mice were randomly divided into control; sham; FA-treated (10 mg/kg twice per day; Fc-treated (200 mg/kg; and FA + Fc-treated groups. Cauda epididymal spermatozoa were analyzed for viability, count, and motility. Testes were weighed and gonadosomatic index (GSI was calculated. Also, histoarchitecture of seminiferous tubules was assessed in the Haematoxylin and Eosin stained paraffin sections. The findings showed that FA significantly decreased GSI and increased percentage of immotile sperm compared with control group. Disorganized and vacuolated seminiferous epithelium, spermatogenic arrest, and lumen filled with immature germ cells were also observed in the testes. However, Fc leaf extracts improved sperm count, nonprogressive motility of spermatozoa, and GSI in FA-treated testes. Moreover, seminiferous tubule with spermatogenic arrest was rarely seen, indicating that Fc has the positive effects on testis and epididymal sperm parameters exposed with FA.

  16. Fig .1. X-ray diffraction (XRD) patterns of Ag2Se-G-TiO2 composites.

    Indian Academy of Sciences (India)

    32

    SEM images of Ag2Se-G nanocomposites, (c)TiO2 nanoparticles and (d) SEM images of Ag2Se-. G-TiO2 .... Although photo-catalytic conversion of CO2 using solar energy is the most convenient route for the ..... based structure of graphene, the unpaired π electron merges with the metal nanoparticles, causing a shift in the ...

  17. Radiological imaging in patients with low back pain and sciatica[6 figs., 14 refs]; Billeddiagnostikk ved lumbago og isjas

    Energy Technology Data Exchange (ETDEWEB)

    Dullerud, R. [Aker Sykehus, Oslo (Norway)

    1999-05-01

    Low back pain and sciatica are among the most common medical problems in Western countries, affecting up to 80% of the population at some time during their lives. Plain radiography is still a sensitive method in degenerative spinal disease and for the identification of spondylolysis and destructions as well as transitional vertebra and other anomalies in the lumbosacral region. In lumbar disk herniation CT and MR have higher sensitivity than lumbar myelography and should be used as the primary imaging methods. Myelography is still the method of choice in lumbar spinal stenosis. Myelography should also be considered in patients with poor consistency between CT and MR findings and the clinical presentation. Postoperatively MR is superior to CT and myelography for distinguishing between scar tissue and recurrent disk herniation.

  18. Initial analysis of the second FIG 3D cadastres questionnaire : Status in 2014 and expectations for 2018

    NARCIS (Netherlands)

    Van Oosterom, P.J.M.; Stoter, J.E.; Ploeger, H.D.; Lemmen, C.; Thompson, R.; Karki, S.

    2014-01-01

    Valuation of real estate/ properties is in many countries/ cities the basis for fair taxation. The value depends on many aspects, including the physical real world aspects (geometries, material of object as build) and legal/virtual aspects (rights, restrictions, responsibilities, zoning/development

  19. A General Chemistry and Precalculus First-Year Interest Group (FIG): Effect on Retention, Skills, and Attitudes

    Science.gov (United States)

    Pence, Laura E.; Workman, Harry J.; Haruta, Mako E.

    2005-01-01

    The backdrop of the calculus reform movement created a fertile movement for the creation of overlap between general chemistry and precalculus as many of the goals emphasized key concepts from the chemistry lab. By using the graphing calculator in both precalculus and chemistry laboratory enhanced the students' comfort and competence with the…

  20. Marble in Israel : A. Shadmon. Ministry of Development, State of Israel, Jerusalem, 1965, 56 pp., 36 fig., 2 tables

    NARCIS (Netherlands)

    Manten, A.A.

    The booklet Marble in Israel is announced to be the first in a series of reports on the mineral building commodities of Israel, which series will summarize the information available on the subject at the Quarries Section of the Israel Geological Survey and the Office of the Controller of Mines.

  1. CRESCIMENTO DE FIGUEIRA SOB DIFERENTES CONDIÇÕES DE CULTIVO FIG TREE GROWTH UNDER DIFFERENT CROP CONDITIONS

    Directory of Open Access Journals (Sweden)

    Manoel Euzébio de Souza

    2011-10-01

    Full Text Available

    A análise de crescimento de plantas pode ser considerada um bom indicativo para a avaliação das bases fisiológicas de produção e da influência exercida por variáveis ambientais, genéticas e agronômicas. Avaliou-se o crescimento da figueira ‘Roxo de Valinhos’, submetida a irrigação e cobertura morta (bagacilho de cana-de-açúcar triturado, em Botucatu (SP. O experimento utilizou blocos casualizados, em esquema fatorial 2x2 (cobertura morta x irrigação, com 4 repetições, sendo cada repetição constituída por 3 plantas, com caracterização dos seguintes tratamentos: T1 - sem irrigação e sem cobertura morta; T2 - sem irrigação e com cobertura morta; T3 - com irrigação e sem cobertura morta; T4 - com irrigação e cobertura morta. Foram realizadas análises destrutivas e não destrutivas, aos 7, 55, 76, 97, 114, 135, 156, 176, 198, 219, 240, 254 e 275 dias após o transplantio, com base nos seguintes parâmetros: diâmetro do ramo e do caule, comprimento do ramo, número de folhas, número de entrenós e número de frutos. Foram particionados os diferentes órgãos da planta, para obtenção da massa seca e fresca das partições isoladas. As medições da área foliar (cm2 foram realizadas com aparelho integrador fotoelétrico. O manejo da irrigação foi realizado com o auxílio da técnica de tensiometria, mantendo o potencial matricial do solo próximo a -30 kPa. O uso de cobertura morta e irrigação favoreceu o desenvolvimento das plantas (diâmetro do caule de 36,60 mm e comprimento do ramo de 1,28 m, e as taxas de crescimento, crescimento relativo e assimilatória líquida da cultura foram de 7 g m-2 dia-1, 0,015 g g-1 dia-1 e 17 g m-2 dia-1, respectivamente. As taxas indicaram que a cobertura morta ofereceu condições hídricas satisfatórias ao rápido estabelecimento das mudas.

    The plant growth analysis can be a good tool to evaluate the yield physiological basis and the influence of environmental, genetic, and agronomic traits. The Ficus carica L. growth, under irrigation and mulch (crushed sugar-cane, was evaluated in Botucatu, São Paulo State, Brazil. The experimental design was randomized blocks, in a 2x2 factorial scheme (mulch x irrigation, with 4 replications and each replication consisting of 3 plants, under the following treatments: T1 - without irrigation or mulch; T2 - without irrigation and with mulch; T3 - with irrigation and without mulch; T4 - with irrigation and mulch. Destructive and non-destructive analysis were carried out at 7, 55, 76, 97, 114, 135, 156, 176, 198, 219, 240, 254, and 275 days after transplanting, based on the following parameters: branch and stem diameter, branch length, and number of leaves, internodes, and fruits. Different plant organs were partitioned to obtain the fresh and dry mass of isolated partitions. The leaf area (cm2 was measured with a photoelectric device and the irrigation management was carried out with the aid of a tensiometer, keeping the soil matric potential close to -30 kPa. The use of mulch and irrigation favored the development of plants (stem diameter of 36.60 mm and branch length of 1.28 m, and the crop growth rate, relative growth rate, and net assimilation rate were respectively 7 g m-2 day-1, 0.015 g g-1 day-1, and 17 g m-2 day-1. These rates showed that the mulch provided satisfactory hydric conditions to a fast establishment of seedlings.

  2. Structure and Principal Components Analyses Reveal an Intervarietal Fusion in Malaysian Mistletoe Fig (Ficus deltoidea Jack Populations

    Directory of Open Access Journals (Sweden)

    Birifdzi Zimisuhara

    2015-06-01

    Full Text Available Genetic structure and biodiversity of the medicinal plant Ficus deltoidea have rarely been scrutinized. To fill these lacunae, five varieties, consisting of 30 F. deltoidea accessions were collected across the country and studied on the basis of molecular and morphological data. Molecular analysis of the accessions was performed using nine Inter Simple Sequence Repeat (ISSR markers, seven of which were detected as polymorphic markers. ISSR-based clustering generated four clusters supporting the geographical distribution of the accessions to some extent. The Jaccard’s similarity coefficient implied the existence of low diversity (0.50–0.75 in the studied population. STRUCTURE analysis showed a low differentiation among the sampling sites, while a moderate varietal differentiation was unveiled with two main populations of F. deltoidea. Our observations confirmed the occurrence of gene flow among the accessions; however, the highest degree of this genetic interference was related to the three accessions of FDDJ10, FDTT16 and FDKT25. These three accessions may be the genetic intervarietal fusion points of the plant’s population. Principal Components Analysis (PCA relying on quantitative morphological characteristics resulted in two principal components with Eigenvalue >1 which made up 89.96% of the total variation. The cluster analysis performed by the eight quantitative characteristics led to grouping the accessions into four clusters with a Euclidean distance ranged between 0.06 and 1.10. Similarly, a four-cluster dendrogram was generated using qualitative traits. The qualitative characteristics were found to be more discriminating in the cluster and PCA analyses, while ISSRs were more informative on the evolution and genetic structure of the population.

  3. Biostratigraphic correlation of the western and eastern margins of the Labrador–Baffin Seaway and implications for the regional geology. Fig. 5

    Directory of Open Access Journals (Sweden)

    Henrik Nøhr-Hansen

    2016-12-01

    Full Text Available New analyses of the palynological assemblages in 13 offshore wells on the Canadian margin and six on the West Greenland Margin, in conjunction with onshore data, have led to a new biostratigraphic framework for the Cretaceous–Cenozoic strata of the Labrador Sea – Davis Strait – Baffin Bay (Labrador–Baffin Seaway region and the first broad biostratigraphic correlation of the Canadian and Greenland margins. This framework is based on 167 last occurrences and 18 local/regional peak/common-occurrence events for dinocysts, miospores, fungal spores and Azolla. Detailed biostratigraphic evidence has confirmed the following hiatuses: pre-Aptian in the Hopedale Basin; pre-Albian in the Saglek Basin; Albian–Turonian in some wells of the Hopedale Basin; Turonian–Santonian/Campanian in some areas; pre-Campanian and late Campanian – Thanetian on the Greenland Margin; late Maastrichtian and Danian in some wells of the Hopedale Basin and in the Saglek Basin; Selandian in part of the Hopedale Basin, in all the Saglek Basin wells and in two wells on the West Greenland Margin; late Ypresian and/or Lutetian on both sides; Oligocene to middle Miocene of considerable variability on both margins, with all of the Oligocene and the lower Miocene missing in all the West Greenland Margin wells; and middle to late Miocene on the western side. On the Canadian margin, the hiatuses can be partially matched with the five previously recognised regional unconformities; on the Greenland margin, however, the relationship to the five unconformities is more tenuous. Palynomorph assemblages show that most Aptian to Albian sediments were deposited in generally non-marine to marginal marine settings, interrupted by a short-lived shallow marine episode in the Aptian. A marine transgression started in the Cenomanian–Turonian and led to the most open-marine, oceanic conditions in the Campanian–Lutetian; shallowing probably started in the late Lutetian and continued into the Rupelian, when inner neritic and marginal marine palaeoenvironments predominated. Throughout the rest of the Cenozoic, inner neritic palaeoenvironments alternated with marginal marine conditions on the margins of the Labrador–Baffin Seaway. These observations broadly reflect the tectonic evolution of the seaway, with rift conditions prevailing from Aptian to Danian times, followed by drift through much of the Paleocene and Eocene, and post-drift from Oligocene to the present. Dinocysts indicate that climatic conditions in the Labrador–Baffin Seaway region were relatively temperate in the Cretaceous, but varied dramatically through the Cenozoic. The Danian was a time of increasingly warmer climate, a thermal maximum being reached around the Paleocene–Eocene boundary reflecting the global thermal event at this time. Warm to hot conditions prevailed throughout the Ypresian, but the climate began to cool in the Lutetian, a trend that accelerated through the Priabonian and Rupelian. Throughout the Neogene, temperatures generally declined, culminating in the Quaternary.

  4. Ethical codes. Fig leaf argument, ballast or cultural element for radiation protection?; Ethik-Codes. Feigenblatt, Ballast oder Kulturelement fuer den Strahlenschutz?

    Energy Technology Data Exchange (ETDEWEB)

    Gellermann, Rainer [Nuclear Control and Consulting GmbH, Braunschweig (Germany)

    2014-07-01

    The international association for radiation protection (IRPA) adopted in May 2004 a Code of Ethics in order to allow their members to hold an adequate professional level of ethical line of action. Based on this code of ethics the professional body of radiation protection (Fachverband fuer Strahlenschutz) has developed its own ethical code and adopted in 2005.

  5. IAEA launches a pictorial history book of 'Atoms for Peace' [196 pp.; 850 figs; 2007; ISBN 978-103807-4; 50 Euro

    International Nuclear Information System (INIS)

    2007-01-01

    Full text: To commemorate its first 50 years, the International Atomic Energy Agency is today launching a photographic history of the organization and its work. A large volume, elegantly produced, it offers an overview of the Agency that is both attractive and educational. The book explores in pictures the balance between the IAEA's work as a nuclear watchdog and rigorous advocate for safety and security and its mission in helping developing countries use advanced science for humanitarian benefit. Issued at a time of unprecedented international interest in the Agency, it addresses the fundamental concepts that underlie the work of the IAEA and its 'Atoms for Peace' mission. It also describes the historical evolution of the IAEA, illustrating the successes and challenges that have shaped the organization over the past half century. Notable milestones covered include US President Eisenhower's Atoms for Peace speech, the establishment of safeguards regimes, the international response to the Chernobyl accident and the awarding of the Nobel Peace Prize in 2005. Ongoing efforts, in fields ranging from sustainable energy production to human health and agricultural productivity, further detail the diversity and complexity of the IAEA's contribution - as IAEA Director General Mohamed ElBaradei explains in the foreword - to 'the betterment of the human family.' (IAEA)

  6. Frequency distribution, isotopic composition and physical characterization of plutonium-bearing particles from the Fig-Quince zone on Runit Island, Enewetak Atoll

    DEFF Research Database (Denmark)

    Hamilton, Terry F.; Jernström, Jussi; Martinelli, Roger E.

    2009-01-01

    Runit Island on Enewetak Atoll was very heavily impacted by the U.S. nuclear testing campaign in the northern Marshall Islands (1946–58). The primary source of contamination on Runit Island was the 1958 Quince safety test where a large quantity of device plutonium (Pu) was scattered over the area...

  7. International dictionary of geophysics : S. K. Runcorn (editor-in-chief). Pergamon, Oxford, 1967, 2 volumes, 1,728 pp., 730 fig., £ 45.0.0

    NARCIS (Netherlands)

    Manten, A.A.

    1968-01-01

    The reader is informed about a large number of subjects in a generally brief, elucidating manner. No single source contains such a large number of short review articles. That the general framework in which the contributions are contained is weak, is no reflection on the authors, but the

  8. Soil macrofauna in cover crops of figs grown under organic management Macrofauna edáfica sob coberturas do solo no cultivo de figo sob manejo orgânico

    Directory of Open Access Journals (Sweden)

    Analy de Oliveira Merlim

    2005-01-01

    Full Text Available Soil fauna plays an important role in organic management through their effects on soil organic decomposition, nutrient mineralization, and amelioration of the soil's physical properties. This work evaluates the density and diversity of the soil macrofauna under types of cover plants in areas cultivated with Ficus carica L. under organic management. The soil macrofauna was collected in 0.25 × 0.25 m areas, down to a soil depth of 0.3 m, and at the surface layer. The treatments consisted of bahiagrass living mulch (Paspalum notatum, siratro living mulch (Macroptilium atropurpureum, and bahiagrass mulch. The highest macrofauna density and the lowest diversity were observed in bahiagrass, of which 80% were represented by ants, thus characterizing the soil under this cover crop as showing the lowest functional diversity and quality.A fauna do solo tem papel importante em sistemas orgânicos, através dos seus efeitos na decomposição da matéria orgânica, mineralização de nutrientes e condicionamento físico do solo. Este trabalho avaliou a densidade e a diversidade da macrofauna edáfica sob tipos de cobertura do solo em áreas cultivadas com Ficus carica L. sob manejo orgânico do solo. A macrofauna foi coletada em áreas de 0,25 × 0,25 m e amostraram-se as camadas de material vegetal e solo até a profundidade de 0,3 m, nos meses de março e setembro de 2001. Os tratamentos constaram de cobertura viva com grama batatais (Paspalum notatum, cobertura viva de siratro (Macroptilium atropurpureum e cobertura morta formada por palha de grama batatais. A mais alta densidade da macrofauna e a mais baixa diversidade foi observada em grama batatais, sendo mais de 80% dessa fauna de formigas, o que caracteriza o solo sob influência desta cobertura como o de mais baixa diversidade funcional e qualidade, comparado às outras coberturas.

  9. The nutritional levels in leaves and fruits of fig trees as a function of pruning time and irrigation / Teores nutricionais em folhas e frutos de figueira, submetida a épocas de poda e irrigação

    Directory of Open Access Journals (Sweden)

    Marco Antonio Tecchio

    2009-07-01

    Full Text Available The present study aimed to evaluating the nutritional content in leaves and fruits of the fg tree ‘Roxo de Valinhos’, pruned at different periods corresponding to the months of July, August, September and October in the years of 2004 and 2005, with and without the use of irrigation, in the county of Botucatu, São Paulo State, Brazil. To achieve this objective, the adopted experimental design was in blocks with subdivided plots and 5 replications, in which plots corresponded to treatments with and without irrigation and subplots included prunings done in the above-mentioned four months. The levels of N, P, K, Ca, Mg, S, B, Cu, Mn and Zn in leaves and fruits were evaluated in the two crop cycles. The results indicated no signifcant differences among macro and micronutrient levels in the leaves subjected to treatments with and without irrigation in the cycle 2004/05, except for cupper which showed higher level with the treatment including irrigation (6 mg kg-1. In the fruits, there was no difference, except for Zn, which also showed the highest levels (28 mg kg-1 with irrigation. In the crop cycle 2005/06, there were differences for N (40 g kg-1 and K (20 g kg-1 in the leaves, where the highest levels were observed with the treatment including irrigation. In the fruits, N had signifcant difference and its highest level was observed without irrigation (21 g kg-1. In relation to the pruning periods, signifcant differences were observed for Ca, Fe and Zn content in the leaves and Ca, K, Mg, S and Zn content in the fruits in the crop cycle 2004/05. In the cycle 2005/06, there were not differences among the levels of the evaluated nutrients in the leaves, and in the fruits there was difference for N, Ca and Cu.O trabalho teve como objetivo avaliar os teores nutricionais foliares e nos frutos de fgueira ‘Roxo de Valinhos’, podada em diferentes épocas, correspondentes aos meses de julho, agosto, setembro e outubro dos anos de 2004 e 2005, com e sem o uso de irrigação, no município de Botucatu/SP. Para atingir tal objetivo adotou-se um delineamento experimental em parcelas subdivididas, com 5 repetições em blocos, onde as parcelas corresponderam aos tratamentos com e sem irrigação e as subparcelas foram constituídas pelas podas realizadas nos quatro meses do ano. Foram avaliados os teores de N, P, K, Ca, Mg, S, B, Cu, Fe, Mn e Zn em folhas e frutos nos dois ciclos agrícolas. Os resultados evidenciaram que não houve diferenças signifcativas entre os teores de macro e micronutrientes nas folhas nos tratamentos com e sem irrigação no ciclo 2004/05, com exceção do cobre, onde o tratamento com irrigação apresentou o maior teor do nutriente (6 mg kg-1. Nos frutos, não houve diferenças, com exceção do Zn, que também apresentou os maiores teores (28 mg kg-1, no tratamento com irrigação. No ciclo agrícola 2005/06 houve diferenças para o N (40 g kg-1 e o K (20 g kg-1 nas folhas, cujos maiores teores foram verifcados no tratamento com irrigação. Nos frutos, o N apresentou diferença signifcativa e o maior teor foi observado sem irrigação (21 g kg-1. Em relação aos meses de poda, foram verifcadas diferenças signifcativas para os teores de Ca, Fe e Zn nas folhas e Ca, K, Mg, S e Zn nos frutos no ciclo agrícola 2004/05. No ciclo 2005/06 não houve diferenças entre os teores foliares dos nutrientes avaliados e nos frutos houve diferença para o N, Ca e Cu.

  10. RAMS - Regional Atmospheric Modelling System for decision support system SWD-WJ/RODOS[34 refs, 26 figs, 4 tabs]; RAMS - numeryczne prognozowanie pogody dla systemu wspomagania decyzji SWD-WJ/RODOS

    Energy Technology Data Exchange (ETDEWEB)

    Borysiewicz, M; Potemski, S [Inst. of Atomic Energy, Otwock-Swierk (Poland); Galkowski, A [Inst. Fizyki Plazmy i Laserowej Mikrosyntezy, Warsaw (Poland); Zelazinska, B [Inst. of Geophysics, Warsaw University, Warsaw (Poland)

    1999-07-01

    Presented is report aimed at implementation of RAMS (Regional Atmospheric Modelling System) to the decision support system SWD-WJ/RODOS. A comprehensive analysis has been made of different meteorological codes, both local and regional. RAMS code, developed at Colorado State University and Aster Division of Mission Research Corporation, has been selected for reasons presented in this report. RAMS has been adjusted to Polish conditions. Necessary data as topography and surface characteristics (roughness, land percentage, see surface temperature, land cover, soil type, etc.) have been obtained from US Geological Survey and NOAA ARL, Washington DC. Numerical tests have been performed on two nested grids, one covering large part of Europe, the other one covering Polish territory. RAMS requires meteorological input from global model and/or from local meteorological stations. Use has been made of data from the Institute of Meteorology and Water Management, Warsaw, and from European Center for Medium Range Forecast (ECMWF, Reading). For the later RAMS acted operationally what means that global data were delivered every 12 h from Reading via Internet to Swierk and subsequently 12 h weather forecast was calculated by RAMS. In a separate experiment RAMS forecast has been benchmarked with a forecast by UMPL code operated routinely at Warsaw University. Results of all of those test are presented in the report. Finally, some suggestions concerning further work has been put forward. (author)

  11. Rachel Crellin, Chris Fowler and Richard Tipping, eds. Prehistory without Borders: The Prehistoric Archaeology of the Tyne-Forth Region ( : Oxford: Oxbow Books, 2016, 244 pp., 124 b/w figs, 19 tables, hbk, ISBN 978-1-78-570199-3)

    NARCIS (Netherlands)

    Arnoldussen, Stijn

    2017-01-01

    Borders, in the sense of modern geopolitical boundaries, have no bearing on prehistoric realities, yet they do affect archaeology as a discipline―particularly when one is committed to thinking, working, and writing on regions that transcend administrative limits, whether regional or national. While

  12. Aspectos florísticos e ecológicos de epífitos vasculares sobre figueiras isoladas no norte da planície costeira do Rio Grande do Sul Floristic and ecological aspects of vascular epiphytes on isolated fig trees on the northern coastal plain of Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Cezar Neubert Gonçalves

    2003-03-01

    Full Text Available Estudos com epífitos vasculares no Brasil normalmente não consideram árvores isoladas em áreas antropizadas, as quais permitem o estabelecimento e preservação de uma porção representativa da flora epifítica original. Neste trabalho, enfoca-se a composição florística dos epífitos vasculares em espécimes isolados de Ficus organensis (Miq. Miq. no norte da planície costeira do Rio Grande do Sul. A área de estudo fica situada no entorno da cidade de Terra de Areia (29°35' S e 50°04' W, com clima subtropical úmido (Cfa. Sessenta árvores foram inventariadas. Foram encontradas 77 espécies, 33 gêneros e 10 famílias. A família Orchidaceae e o gênero Tillandsia L. apresentaram os maiores números de espécies. A categoria ecológica mais diversificada foi a dos holoepífitos, com 69 espécies, a maioria delas apresentando a suculência como adaptação para o estresse hídrico. A proporção de espécies anemocóricas (51 foi praticamente o dobro das zoocóricas (26. A percentagem das espécies epifíticas, em relação à flora epifítica regional, foi de 30,8%. A proporção de Orchidaceae foi relativamente menor, provavelmente devido a maiores exigências em relação aos hábitats florestais originais. A família com maior importância fisionômica foi Bromeliaceae. O predomínio das espécies anemocóricas sobre as zoocóricas, nas árvores amostradas, é menor do que em áreas com florestas preservadas.Studies on vascular epiphytes in Brazil usually do not consider isolated trees close to anthropic areas. These trees allow the establishment and preservation of a representative proportion of the original epiphytic flora. In this study, the floristic composition of vascular epiphytes was surveyed on isolated specimens of Ficus organensis (Miq. Miq., on the northern coastal plain of Rio Grande do Sul. The study area lies around the city of Terra de Areia (29°35' S; 50°04' W, a region with a humid subtropical climate (Cfa. Sixty trees were surveyed. The floristic survey resulted in 77 species, 33 genera and 10 families. Orchidaceae and the genus Tillandsia L. presented the highest number of species. The most diversified ecological category was true epiphytes, with 69 species, most of these are succulent as an adaptation to water deficit. The proportion of anemochoric species (51 was almost twice the number of zoochoric species (26. The percentage of epiphytic species in relation to the regional epiphytic flora was 30.8%. The proportion of Orchidaceae was relatively small, probably due to greater ecological demands in relation to the original forested habitats. The family with greatest physiognomic importance was Bromeliaceae. Although anemochoric species clearly predominate over zoochoric species, the importance of this seed dispersal form is still higher in areas with well-preserved forests.

  13. Proxy-based accelerated discovery of Fischer–Tropsch catalysts† †Electronic supplementary information (ESI) available: Details of synthesis, analysis and testing, validation experiments for high-throughput XRD and gas treatment, details of statistical analysis and calculations, tabulation of synthesis parameters and XRD results, alternatives to Fig. 3 highlighting different data points, FTS testing results displayed graphically. See DOI: 10.1039/c4sc02116a Click here for additional data file.

    Science.gov (United States)

    Boldrin, Paul; Gallagher, James R.; Combes, Gary B.; Enache, Dan I.; James, David; Ellis, Peter R.; Kelly, Gordon; Claridge, John B.

    2015-01-01

    Development of heterogeneous catalysts for complex reactions such as Fischer–Tropsch synthesis of fuels is hampered by difficult reaction conditions, slow characterisation techniques such as chemisorption and temperature-programmed reduction and the need for long term stability. High-throughput (HT) methods may help, but their use has until now focused on bespoke micro-reactors for direct measurements of activity and selectivity. These are specific to individual reactions and do not provide more fundamental information on the materials. Here we report using simpler HT characterisation techniques (XRD and TGA) along with ageing under Fischer–Tropsch reaction conditions to provide information analogous to metal surface area, degree of reduction and thousands of hours of stability testing time for hundreds of samples per month. The use of this method allowed the identification of a series of highly stable, high surface area catalysts promoted by Mg and Ru. In an advance over traditional multichannel HT reactors, the chemical and structural information we obtain on the materials allows us to identify the structural effects of the promoters and their effects on the modes of deactivation observed. PMID:29560180

  14. The kinetics of chirality assignment in catalytic single-walled carbon nanotube growth and the routes towards selective growth† †Electronic supplementary information (ESI) available: Details of density functional theory (DFT) calculations, definition of interfacial formation energy (IFE), cap formation energy and fitting equation, Fig. S1–S4 and Table S1. See DOI: 10.1039/c7sc04714b

    Science.gov (United States)

    Xu, Ziwei; Qiu, Lu

    2018-01-01

    Depending on its specific structure, or so-called chirality, a single-walled carbon nanotube (SWCNT) can be either a conductor or a semiconductor. This feature ensures great potential for building ∼1 nm sized electronics if chirality-selected SWCNTs could be achieved. However, due to the limited understanding of the growth mechanism of SWCNTs, reliable methods for chirality-selected SWCNTs are still pending. Here we present a theoretical model on the chirality assignment and control of SWCNTs during the catalytic growth. This study reveals that the chirality of a SWCNT is determined by the kinetic incorporation of pentagons, especially the last (6th) one, during the nucleation stage. Our analysis showed that the chirality of a SWCNT is randomly assigned on a liquid or liquid-like catalyst surface, and two routes of synthesizing chirality-selected SWCNTs, which are verified by recent experimental achievements, are demonstrated. They are (i) by using high melting point crystalline catalysts, such as Ta, W, Re, Os, or their alloys, and (ii) by frequently changing the chirality of SWCNTs during their growth. This study paves the way for achieving chirality-selective SWCNT growth for high performance SWCNT based electronics. PMID:29732090

  15. Clothing for Sports: Part 2: Stridalongapos Loses Shorts, Wins in Style

    Science.gov (United States)

    Schamberger, Wolf

    1985-01-01

    The choice of clothing for sports must take into account the climate, movement, ability to enhance athletic performance, safety and comfort. Part 2 of this two-part article describes the clothing needed for running, cycling, skiing, windsurfing, triathlon, aerobic dancing and hot air ballooning. ImagesFig. 1Fig. 2Fig. 3Fig. 4Fig. 5Fig. 6Fig. 7Fig. 8Fig. 9Fig. 10 PMID:21274232

  16. Whole-muscle reimplantation with microneurovascular anastomoses. A functional and histological study.

    Science.gov (United States)

    Prendergast, F. J.; McGeachie, J. K.; Edis, R. H.; Allbrook, D.

    1977-01-01

    Whole tibialis anterior muscles were removed from a number of dogs and were then reimplanted in the original sites. Microsurgical anastomoses of the major nerve, artery, and vein were performed. Biopsy revealed some minor regenerative changes in the muscle a few weeks after the operation. Electromyographic recordings 6-9 months after implantation showed near-complete functional recovery of the muscles. This was confirmed histologically. The study demonstrates not only that whole-muscle reimplantation is technically feasible but that a functionally satisfactory result may be expected. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 Fig. 10 Fig. 11 PMID:900796

  17. Postnatal development of the spleen in Didelphis virginiana.

    Science.gov (United States)

    Cutts, J H; Krause, W J

    1982-01-01

    The postnatal development of the spleen has been examined in 85 opossums ranging in age from newborn to adult. At birth the spleen consists of a well vascularized mass of mesenchymal tissue and lacks lymphatic tissue or any evidence of haemopoietic activity. Haemopoiesis is evident at seven days, increases to a maximum at about two to three weeks and thereafter gradually declines. Although production of granulocytes has disappeared by 60 days postnatum, a small degree of erythropoiesis and megakaryocyte formation continues throughout life. Lymphatic tissue appears by the third week, but germinal centres do not appear until after weaning. A feature of the spleen during the first three to four days is the presence of a population of primitive 'blast' cells. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 Fig. 10 Fig. 11 Fig. 12 Fig. 13 Fig. 14 Fig. 15 Fig. 16 Fig. 17 Fig. 18 Fig. 19 Fig. 20 Fig. 21 Fig. 22 Fig. 23 Fig. 24 PMID:7153176

  18. Untitled

    Indian Academy of Sciences (India)

    Figs, 12-27. Fig. 12, Cross-section of anther, X200. Figs. 13-15. A part of anther icte, x1,620. Figs. 16-18. Pollen grains, x2,125. Fig. 19. Archesporial cell, X2,125. Fig. 20. Megaspore mother cell, X2,125. Figs. 21-22. Tetrads, X2,125. Fig. 23. Functional nega- spore, X2,125. Fig. 24. Four-nucleate embryo-sac, X2,125. Fig. 25.

  19. Fine structure of the epidermal Leydig cells in the axolotl Ambystoma mexicanum in relation to their function.

    Science.gov (United States)

    Jarial, M S

    1989-01-01

    The fine structure of the Leydig cells in the epidermis of the strictly aquatic adult axolotl Ambystoma mexicanum resembles that of similar cells in larval salamanders. The major finding of this study is that the mucous secretion of the Leydig cells is released into the intercellular spaces from which it is discharged through pores onto the surface of the epidermis where it forms a mucous layer to protect the skin. Images Figs. 1-2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 Fig. 10 Figs. 11-13 PMID:2630544

  20. The role of lung imaging in pulmonary embolism

    Science.gov (United States)

    Mishkin, Fred S.; Johnson, Philip M.

    1973-01-01

    The advantages of lung scanning in suspected pulmonary embolism are its diagnostic sensitivity, simplicity and safety. The ability to delineate regional pulmonary ischaemia, to quantitate its extent and to follow its response to therapy provides valuable clinical data available by no other simple means. The negative scan effectively excludes pulmonary embolism but, although certain of its features favour the diagnosis of embolism, the positive scan inherently lacks specificity and requires angiographic confirmation when embolectomy, caval plication or infusion of a thrombolytic agent are contemplated. The addition of simple ventilation imaging techniques with radioxenon overcomes this limitation by providing accurate analog estimation or digital quantitation of regional ventilation: perfusion (V/Q) ratios fundamental to understanding the pathophysiologic consequences of embolism and other diseases of the lung. ImagesFig. 1Fig. 2Fig. 3Fig. 4Fig. 5Fig. 6Fig. 7p495-bFig. 8Fig. 9Fig. 10Fig. 11Fig. 12Fig. 13 PMID:4602128

  1. Electrochemical maps and movies of the hydrogen evolution reaction on natural crystals of molybdenite (MoS2): basal vs. edge plane activity† †Electronic supplementary information (ESI) available: Movies S1 to S4: spatially resolved LSV-SECCM movies obtained from the electrocatalytic HER on the surface of bulk MoS2. Fig. S1 to S14: XRD, XPS, Raman, SEM and OM characterization of MoS2; SEM images of the nanopipets; WCA measurements; LSVs and Tafel plots obtained from the HER on MoS2. See DOI: 10.1039/c7sc02545a Click here for additional data file. Click here for additional data file. Click here for additional data file. Click here for additional data file. Click here for additional data file.

    Science.gov (United States)

    Kang, Minkyung; Maddar, Faduma M.; Li, Fengwang; Walker, Marc; Zhang, Jie

    2017-01-01

    Two dimensional (2D) semiconductor materials, such as molybdenum disulfide (MoS2) have attracted considerable interest in a range of chemical and electrochemical applications, for example, as an abundant and low-cost alternative electrocatalyst to platinum for the hydrogen evolution reaction (HER). While it has been proposed that the edge plane of MoS2 possesses high catalytic activity for the HER relative to the “catalytically inert” basal plane, this conclusion has been drawn mainly from macroscale electrochemical (voltammetric) measurements, which reflect the “average” electrocatalytic behavior of complex electrode ensembles. In this work, we report the first spatially-resolved measurements of HER activity on natural crystals of molybdenite, achieved using voltammetric scanning electrochemical cell microscopy (SECCM), whereby pixel-resolved linear-sweep voltammogram (LSV) measurements have allowed the HER to be visualized at multiple different potentials to construct electrochemical flux movies with nanoscale resolution. Key features of the SECCM technique are that characteristic surface sites can be targeted and analyzed in detail and, further, that the electrocatalyst area is known with good precision (in contrast to many macroscale measurements on supported catalysts). Through correlation of the local voltammetric response with information from scanning electron microscopy (SEM) and atomic force microscopy (AFM) in a multi-microscopy approach, it is demonstrated unequivocally that while the basal plane of bulk MoS2 (2H crystal phase) possesses significant activity, the HER is greatly facilitated at the edge plane (e.g., surface defects such as steps, edges or crevices). Semi-quantitative treatment of the voltammetric data reveals that the HER at the basal plane of MoS2 has a Tafel slope and exchange current density (J 0) of ∼120 mV per decade and 2.5 × 10–6 A cm–2 (comparable to polycrystalline Co, Ni, Cu and Au), respectively, while the edge plane has a comparable Tafel slope and a J 0 that is estimated to be more than an order-of-magnitude larger (∼1 × 10–4 A cm–2). Finally, by tracking the temporal evolution of water contact angle (WCA) after cleavage, it is shown that cathodic polarization has a ‘self-cleaning’ effect on the surface of MoS2, consistent with the time-independent (i.e., time after cleavage) HER voltammetric response. PMID:28989686

  2. Electron microscopy of rapid identification of animal viruses in hematoxylin-eosin sections.

    Science.gov (United States)

    Bhatnagar, R; Johnson, G R; Christian, R G

    1977-01-01

    Routine hematoxylin-eosin stained, paraffin sections were processed for electron microscopy, using a rapid method for localization of animal viruses. Formalin fixation was effective in preserving DNA as well as RNA viruses, however cellular fine structural details and organelles were not well preserved. The procedure is useful for morphological recognition of viral groups and as a rapid diagnostic aid for identifying viral disease. Images Fig. 1. Fig. 2. Fig. 3. Fig. 4. Fig. 5. Fig. 6. PMID:72592

  3. Production chain of CMS pixel modules

    CERN Multimedia

    2006-01-01

    The pictures show the production chain of pixel modules for the CMS detector. Fig.1: overview of the assembly procedure. Fig.2: bump bonding with ReadOut Chip (ROC) connected to the sensor. Fig.3: glueing a raw module onto the baseplate strips. Fig.4: glueing of the High Density Interconnect (HDI) onto a raw module. Fig.5: pull test after heat reflow. Fig.6: wafer sensor processing, Indium evaporation.

  4. Some risk factors in trampolining illustrated by six serious injuries.

    Science.gov (United States)

    Hammer, A.; Schwartzbach, A. L.; Paulev, P. E.

    1982-01-01

    Four case histories out of 75 significant trampoline injuries (from a total of 198 injuries re-examined) plus two recent accidents (1979) are presented, illustrating that the trampoline is posing an undue risk of serious injury. It is argued that the only single factor capable of preventing trampoline injuries is a trampoline ban. This is imperative in schools. Trampoline clubs are advised to reconsider the risk factors involved. Images p27-a p27-b p27-c Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 PMID:7066612

  5. Bearing Assembly With Carbonate Resistant Anti-Seizing Properties

    Science.gov (United States)

    2014-01-28

    surface. Dkt . No. 101805 Application No. ?? REPLACEMENT SHEET? /21 LINEAR MOVEMENT ROTATIONAL MOVEMENT BEARING SURFACE ROTOR OR SLIDER BEARING ROTOR...OR SLIDER BEARING SHAFT FIG. 1 (PRIOR ART) FIG. 2 (PRIOR ART) Dkt . No. 101805 Application No. ?? REPLACEMENT SHEET? /22 100 110 112 114 120 118 116 120 118 114 112 110 LINEAR MOVEMENT ROTATIONAL MOVEMENT 100 FIG. 3 FIG. 4

  6. Emergent Endovascular Management of Acute Arterial Bleeding ...

    African Journals Online (AJOL)

    multiruka1

    little attention has been paid to the novel endovascular options available .... Fig 1b. Fig 1c. Figure 1a: Mass at gastric fundus enhanced in post contrast CT abdomen. ... 1c: Left gastric artery super selectively coiled to occlusion. Fig 2a. Fig 2b.

  7. Grooves on the occipital lobe of Indian brains.

    Science.gov (United States)

    Bisaria, K K

    1984-01-01

    The existence of a groove on the occipital lobe formed by the dural venous sinus or ridge has only rarely been described in the past. As observed in this study such grooves are either unilateral or bilateral and their incidence is very high in Indian brains. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:6490537

  8. Annotations to the figured scallops (Mollusca, Bivalvia, Pectinidae) in Gualtieri’s “Index Testarum Conchyliorum”, deposited in the Museo di Storia Naturale e del Territorio at Calci (Pisa, Italy)

    NARCIS (Netherlands)

    Dijkstra, H.H.

    2016-01-01

    An overview is given of the Pectinidae types present in the Gualtieri collection. In Gualtieri (1742) 46 figures (pl. 73 - 15 figs, pl. 74 - 25 figs, pl. 98 – 2 figs, and pl. 99 – 4 figs) show specimens of Pectinidae. Linnaeus (1758) referred to 10 Pectinidae species figured by Gualtieri. Of these,

  9. Processing of Niobium-Lined M240 Machine Gun Barrels

    Science.gov (United States)

    2014-11-01

    Fig. 5 Finished niobium-lined M240 machine gun barrel with flash suppressor attached ..........11 Fig. 6 End of barrel 1 showing small amount of...the finished barrel is shown in Fig. 5. 11 Fig. 5 Finished niobium-lined M240 machine gun barrel with flash suppressor attached Firing tests

  10. Magnetic resonance imaging of semicircular canals.

    Science.gov (United States)

    Sbarbati, A; Leclercq, F; Zancanaro, C; Antonakis, K

    1992-01-01

    The present paper reports the results of the first investigation of the semicircular canals in a living, small animal by means of high spatial resolution magnetic resonance imaging. This procedure is noninvasive and allows identification of the endolymphatic and perilymphatic spaces yielding a morphology quite consistent with direct anatomical examination. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:1506290

  11. The Frequency and Duration of Uterine Contractions during Labour

    African Journals Online (AJOL)

    1974-04-17

    Apr 17, 1974 ... n-e;.l. Fig. 12. Indian primigravidas: duration of contractions. Fig. 11. Indian multiparas: duration of contractions. Fig. 10. Black primigravidas (all ages): duration of con- tractiom. Indian multiparas: Fig. 11 shows the duration of con- tractions in labour of Indian multiparas studied. Again, the pattern is similar to ...

  12. Histological and immunohistological investigation of alimentary tract lymphoid tissue in the koala (Phascolarctos cinereus), brushtail possum (Trichosurus vulpecula) and ringtail possum (Pseudocheirus peregrinus).

    Science.gov (United States)

    Hemsley, S W; Canfield, P J; Husband, A J

    1996-01-01

    The histological appearance and distribution of T cells, B cells and plasma cells were investigated for oropharyngeal tonsils, small intestinal lymphoid aggregations (Peyer's patches), caecocolic lymphoid patches and mesenteric lymph nodes of koalas (Phascolarctos cinereus), common brushtail possums (Trichosurus vulpecula) and common ringtail possums (Pseudocheirus peregrinus). The histological organisation and distribution of lymphoid cell subpopulations of these tissues were similar to those described in eutherian mammals, although some differences were found in comparison with previous descriptions of American opossum tissues. The main variation among the 3 species was in the structural organisations of the oropharyngeal tonsil and the caecocolic lymphoid patch which were more complex in the koala than in possums. In the koala the extensive crypts of the oropharyngeal tonsils and folding of the mucosa of the caecocolic lymphoid patch increased their surface area and, in addition, both structures had areas of epithelium heavily infiltrated with T and B cells. These features could indicate that these structures are important in immunological surveillance of orally presented antigens in koalas. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 Fig. 10 Fig. 11 Fig. 12 Fig. 13 Fig. 14 Fig. 15 Fig. 16 PMID:8621326

  13. Atypical Manifestations of Hyperthyroidism

    Science.gov (United States)

    Boxall, E. A.; Lauener, R. W.; McIntosh, H. W.

    1964-01-01

    Patients with hyperthyroidism usually present with symptoms of hypermetabolism with or without goitre and/or eye signs. Occasionally, however, the chief complaints are not immediately suggestive of hyperthyroidism. Patients with hyperthyroidism are described who presented with such atypical manifestations as periodic muscular paralysis, myasthenia, myopathy, encephalopathy, psychosis, angina pectoris, atrial fibrillation, heart failure without underlying heart disease, skeletal demineralization, pretibial myxedema, unilateral eye signs, and pitting edema of the ankles. ImagesFig. 2Fig. 3Fig. 5Fig. 7Fig. 8Fig. 9Fig. 10 PMID:14178405

  14. The equilibrium sedimentation of hyaluronic acid and of two synthetic polymers

    Science.gov (United States)

    Nichol, L. W.; Ogston, A. G.; Preston, B. N.

    1967-01-01

    1. The method of equilibrium sedimentation has been investigated as an alternative to osmotic-pressure measurement for determining thermodynamic properties of polymer solutions at relatively high concentrations. 2. The simplifications that must be made in the theoretical treatment are discussed. 3. Measurements have been made on samples of polyethylene glycol, neutralized polymethacrylic acid and hyaluronic acid. With the first and third, values of the `non-ideality coefficients' have been obtained that agree with those obtained from osmotic measurements on the same materials. 4. Evidence has been obtained of the presence in hyaluronic acid preparations of a fraction that has either a lower degree of thermodynamic non-ideality or a higher density increment than the bulk of the sample. This fraction is not protein. ImagesFig. 3.Fig. 4.Fig. 5.Fig. 7.Fig. 8.Fig. 9.Fig. 11.Fig. 12.Fig. 13.Fig. 14. PMID:6029600

  15. Phocomelia: Report of Three Cases

    Science.gov (United States)

    Coodin, Fischel J.; Uchida, Irene A.; Murphy, Claude H.

    1962-01-01

    Three infants were born with phocomelia in Winnipeg during the period from May 1961 to May 1962. In one case thalidomide had been administered to the mother early in the pregnancy. No etiological agent was discovered in the other two, both of whom died. Known teratogenic agents capable of causing phocomelia are reviewed, but no clear association with the two cases described in this report is evident. ImagesFig. 1Fig. 2Fig. 3Fig. 4Fig. 5 PMID:14022756

  16. Virus specific antigens in mammalian cells infected with herpes simplex virus

    Science.gov (United States)

    Watson, D. H.; Shedden, W. I. H.; Elliot, A.; Tetsuka, T.; Wildy, P.; Bourgaux-Ramoisy, D.; Gold, E.

    1966-01-01

    Antisera to specific proteins in herpes simplex infected cells were produced by immunization of rabbits with infected rabbit kidney cells. These antisera were highly virus specific and produced up to twelve lines in immunodiffusion tests against infected cell extracts. Acrylamide electrophoresis and immunoelectrophoresis revealed up to ten virus specific proteins of varying size. ImagesFIG. 1FIG. 2FIG. 3FIG. 4FIG. 5 PMID:4288648

  17. Development of the eye in the North American opossum (Didelphis virginiana).

    Science.gov (United States)

    McMenamin, P G; Krause, W J

    1993-01-01

    utilising this marsupial species. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 Fig. 10-13 Fig. 14 Fig. 15 Fig. 16 Fig. 17 Fig. 18 Fig. 19 Fig. 20 Fig. 21 Fig. 22 Fig. 23 Fig. 24 Fig. 25 Fig. 26 Fig. 27 Fig. 28 Fig. 29 Fig. 30 PMID:8300421

  18. Ultrastructure of mouse intestinal mucosa and changes observed after long term anthraquinone administration.

    Science.gov (United States)

    Dufour, P; Gendre, P

    1984-01-01

    In an attempt to study the relative toxicity of anthraquinonic laxatives on intestinal mucosa, we compared in mice the effects of fruit pulp containing sennosides A and B with those of a free anthraquinone, 1-8 dihydroxyanthraquinone. Observations have been made with transmission electron microscopy (EM) after 16 weeks of treatment with the two drugs. Although the doses used in this study were equipotent in terms of laxative activity, no damage to the intestinal tissue was observed with the sennosides. A number of changes, however, were detected in intestinal nervous tissues of all the animals treated with 1-8 dihydroxyanthraquinone, mainly in the form of vacuolisation of the axons, formation of lysosomal structures and in some cases appearances of fibrillar degeneration. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 PMID:6510768

  19. Ultrastructure of the renal juxtaglomerular complex and peripolar cells in the axolotl (Ambystoma mexicanum) and toad (Bufo marinus).

    Science.gov (United States)

    Hanner, R H; Ryan, G B

    1980-01-01

    Renal juxtaglomerular regions were examined in the axolotl (Ambystoma mexicanum and toad (Bufo marinus). Prominent granulated peripolar epithelial cells were found surrounding the origin of the glomerular tuft in the axolotl. These cells resembled the peripolar cells recently discovered in mammalian species. They contained multiple electron-dense cytoplasmic granules, some of which showed a paracrystalline substructure and signs of exocytoxic activity. Such cells were difficult to find and smaller in the toad. In contrast, granulated juxtaglomerular arteriolar myoephithelial cells were much more readily found and larger in the toad than in the axolotl. No consistent differences were noted in juxtaglomerular cells or their granules in response to changes in environmental chloride concentration. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 PMID:7410189

  20. Pyramid-like basket cells in the granular layer of the dentate gyrus in the rat.

    Science.gov (United States)

    Seress, L

    1978-01-01

    Basket cells of the dentate gyrus were identified using Nissl (cresyl violet) staining. It has been found that the ratio between basket and granule cells is 1:150--210. Only a few glial cells, mainly astroglia, were found in the granular layer of the dentate gyrus. In accordance with earlier data it was found that the granule cells and glial cells originate mainly postnatally, but the basket cells, like the pyramidal cells of the hippocampus, originate prenatally. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 PMID:701192

  1. Assembly of a supercrystal (SC) of the CMS endcap electromagnetic calorimeter

    CERN Multimedia

    J. Williams et al., RAL

    2004-01-01

    The first three pictures show the insertion of the first three rows of crystals into the supercrystal SC03 on Jan. 2004 and the completion of the SC endstops. Fig. 4 shows a complete supercrystal and Fig. 5 its components (alveolar, interface plate, housing, optical fibre, insert, crystal and VPT, endstop). A set of 25 inserts is shown in Fig. 6, while Fig. 7 shows housing, interface plates and inserts. Finally, a SC rear view showing the Vacum Phototriode (VPT) wires through the inserts can be seen in Fig. 8. Fig. 9 and 10 show two supercrystals under test on Dee F and R, respectively.

  2. Trickle Arteriography: Demonstration of Thrombi in the Origin of the Internal Carotid Artery

    Science.gov (United States)

    Hugh, A. E.

    1970-01-01

    Thrombi developing within the origin of the internal carotid artery may be demonstrated by a slow trickle injection of highly concentrated contrast medium, which lingers in pools around the thrombus on the dependent wall of the vessel. With this technique thrombi have been detected which could not be visualized on conventional arteriography because they were obscured by the density of the vascular shadow produced by the forceful injection usually employed in carotid angiography. In addition, trickle arteriography is useful for assessing the position and extent of atheromatous plaques and the contrast stasis associated with them. ImagesFig. 1Fig. 2Fig. 3Fig. 4Fig. 5Fig. 6 PMID:5526613

  3. The regeneration of rectal epithelium in the rat following wounding with suppositories of polyoxyethylene (23) lauryl ether.

    Science.gov (United States)

    Holyhead, E. M.; Thomas, N. W.; Wilson, C. G.

    1983-01-01

    The regeneration of the epithelial compartments of the rectal mucosa in rats has been quantified at time intervals up to one week following wounding with suppositories of the surfactant polyoxyethylene-(23)-lauryl ether. Regeneration of glandular tissue was complete within one week of the wounding, with new glands arising from residual gland bases and from surface invagination of empty crypt skeletons and underlying granulation tissue. This method of wounding appears to be particularly useful for the study of epithelial regeneration since there was a minimal connective tissue response to the insult. Images Fig. 1 Fig. 2 Fig. 3 Figs 4 and 5 Fig. 6 Fig. 7 PMID:6615712

  4. Illustrations

    OpenAIRE

    2016-01-01

    Fig. 1 : Nicolas Poussin, Ravissement de saint Paul (version Scarron), Paris, musée du Louvre. Fig. 4 : Nicolas Poussin, Ravissement de saint Paul (version Scarron), restitution du format d’origine : environ 128 x 96 cm (détail de la fig. 1). Fig. 5 : Giovanni Lanfranco, Ravissement de la Madeleine, Naples, museo nazionale Capodimonte. Fig. 6 : Nicolas Poussin, Ravissement de saint Paul (version Chantelou), Sarasota, Ringling Museum of Art. Fig. 7 : Nicolas Poussin, Assomption, Paris, mus...

  5. Corrigendum to ;Hydroelectric power generation in an Alpine basin: future water-energy scenarios in a run-of-the-river plant; [Advances in Water Resources 94 (2016) 318-331

    Science.gov (United States)

    Bongio, Marco; Avanzi, Francesco; De Michele, Carlo

    2016-12-01

    The authors regret that the unit of measurement of yearly energetic production is mistyped in the paper. It is GWh instead of MWh in Fig.s 3, 8, 9, and 10, and throughout the text. Specifically in the text:

  6. Multiple meningiomas CASE SERIES

    African Journals Online (AJOL)

    masses in the right parietal and parasagittal region (Figs 1a and b). Case 2: A ... scan showed hyperdense parasagittal and left cerebellopontine angle meningiomas (Figs ... Meningiomas are the most common primary non-glial brain tumours.

  7. Involvement of methyltransferases enzymes during the energy

    African Journals Online (AJOL)

    Mgina

    INVOLVEMENT OF METHYLTRANSFERASES ENZYMES DURING THE. ENERGY METABOLISM OF ..... cell extract still exhibited relatively high methanogenesis with methanol (Fig ... product CH3-CoM into methane (see Fig. 1). The HS-CoM ...

  8. Case report

    African Journals Online (AJOL)

    Disease progression is depicted in Fig. 1. ... Fig. 1. Disease progression. Table 1. Pulmonary function tests. Pred. Pre ... sensitivities for bacteria and tuberculosis. ... Pollen grains from an olive tree suggest that olive oil was a key ingredient, just ...

  9. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-11-24

    Nov 24, 2017 ... SYSTEMS OF PNEUMATIC TRANSPORTATION OF CEMENT AND OTHER FINE ... by physical-mechanical properties of the fine material (fig. 2). Fig.2. ..... channels and pipes: Detailed analysis of conveying behavior.

  10. Proceedings of the Integrated Ocean Drilling Program Vol. 341: Expedition reports Southern Alaska margin

    Digital Repository Service at National Institute of Oceanography (India)

    Jaeger, J.M.; Gulick, S.P.S.; LeVay, L.J.; Asahi, H.; Bahlburg, H.; Belanger, C.L.; Berbel, G.B.B.; Childress, L.B.; Cowan, E.A.; Drab, L.; Forwick, M.; Fukumura, A.; Ge, S.; Gupta, S.M.; et. al.

    (Fig. F11, F12). Depositional basins inboard of the Khitrov Ridge along the continental slope west of the Bering Trough contain a sedimentary record of glacial–in- terglacial sedimentation overprinted by active tec- tonic deformation (Fig. F13...

  11. Steady the dizzy child

    African Journals Online (AJOL)

    Chantel

    balance control (Fig. 1). LOUIS M ... Although less frequent in children than in adults, these disorders ... Fig 1. The mechanism of normal balance control. ... checked for hearing loss, vertigo, migraine ... children older than 4 years. Rule out ...

  12. Bioinspired Surface Treatments for Improved Decontamination: Silicate-Based Slippery Liquid-Infused Porous Surfaces (SLIPS)

    Science.gov (United States)

    2017-07-20

    2 Fig. 2 — Nitrogen Adsorption / Desorption for MSS...Coatings ............................................................ 3 Fig. 3 — Nitrogen Adsorption / Desorption for the Fluorinated Coatings... environment including contamination avoidance, individual protection, collective protection, and decontamination. In January 2015, the Center for Bio

  13. A combination of subcuticular suture and sterile Micropore tape compared with conventional interrupted sutures for skin closure. A controlled trial.

    Science.gov (United States)

    Taube, M.; Porter, R. J.; Lord, P. H.

    1983-01-01

    We have conducted a controlled trial to compare skin closure using conventional interrupted sutures with a combination of subcuticular suture and sterile Micropore tape in 169 patients undergoing appendicectomy, inguinal herniorrhaphy, or saphenofemoral ligation. We have found that the combination technique consistently gives a better cosmetic result and that the tape acts well as a dressing, is convenient, and is well tolerated by patients. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:6344732

  14. Gas Metal Arc Welding Process Modeling and Prediction of Weld Microstructure in MIL A46100 Armor-Grade Martensitic Steel

    Science.gov (United States)

    2013-06-01

    earlier in Fig. 4(a) to construct the corresponding CCT diagram , Fig. 5. The diagram displayed in Fig. 5 is obtained under particular continuous-cooling...TTT and CCT diagrams are necessary, but not sufficient, input for a phase volume-fraction determination procedure. That is, in addition to knowing the...fraction of bainite to the instantaneous temperature for the MIL A46100 HAZ section which was described using TTT and CCT diagrams displayed in Fig. 4(a

  15. Environmental studies of the Arabian Sea using remote sensing, GIS and GPS techniques

    Digital Repository Service at National Institute of Oceanography (India)

    Saxena, A.

    Fig 4. Principle of Radar altimetry 17 Fig 5. Block diagram of ArcGIS platform 20 CHAPTER IV RESULT AND DISCUSSION CHAPTER II TOOL FOR STUDY Fig 6. Seasonal Variation of Sea Surface Temperature 24 Fig 7. Seasonal... from any major rivers, the excessive evaporation over precipitation (E-P) as well as proximity to the Red Sea and Persian Gulf makes the surface salinity of Arabian Sea high, in excess of 36psu (practical salinity unit). Motivation Arabian Sea...

  16. Erratum to : Methylome Evolution in plants

    NARCIS (Netherlands)

    Vidalis, Amaryllis; Živković, Daniel; Wardenaar, René; Roquis, David; Tellier, Aurélien; Johannes, Frank

    2017-01-01

    Erratum After publication of this article [1] we noticed that the centromere of Chromosome 3 was missing from Fig. 4a, and that the Fig. 4e y-axis should read ‘CG meth. Div. W-Acc.’. The y-axis of the barplot in Fig. 5a should read ‘Number of cytosines’. The corrected Figs. 4 and 5 are shown below.

  17. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FIG Sbjct: 1 ... LGGSLSCGLTHFAITPLDIVKCRIQVNKEKYGSMVQGFKVTIAEDGVRGLARGWAPTFIG 60 ... Query: 174 MQTSPTAPTTLRACAPM...IYKQEGLTGFFKGLPPLWTRQIPYTMMKFTCFEKTVELLYQYV 233 ... MQTSPTAPTTLRACAPMIYKQE...GLTGFFKGLPPLWTRQIPYTMMKFTCFEKTVELLYQYV Sbjct: 121 MQTSPTAPTTLRACAPMIYKQEGLTGFFKGLPPLWTRQIPYTMMKFTCFEKTVELLYQ

  18. Multifunctional Carbon Nanotube-Based Sensors for Damage Detection and Self Healing in Structural Composites

    Science.gov (United States)

    2010-10-29

    established based on the concept of equipotential surface . The effect of nanotube length on the critical charge level is plotted in Fig. 17. Fig...walled carbon nanotubes was used to develop composites with agglomerated regions of nanotubes at the fiber surface [3]. An image of the nanotube...coating on the surface of two E-glass fibers is shown in Fig. 5. Fig. 5. (a) Carbon nanotube agglomerates on the surface of glass fibers in the

  19. Overview

    Indian Academy of Sciences (India)

    Slide 17 · Superimposition · Fig. 8: Drawings of animals in a Bhimbetka rock shelter (superimposition) (Auditorium Cave) · Fig. 9: Impressions of hand palm in a rock shelter panel (superimposition) · Analysis Spatial · Absolute Dating Techniques · Fig. 10: Paintings of animals on the ceiling of a rock shelter in IGRMS campus.

  20. Hydrothorax, hydromediastinum and pericardial effusion: a complication of intravenous alimentation.

    Science.gov (United States)

    Damtew, B; Lewandowski, B

    1984-01-01

    Complications secondary to intravenous alimentation are rare but potentially lethal. Massive bilateral pleural effusions and a pericardial effusion developed in a patient receiving prolonged intravenous alimentation. Severe respiratory distress and renal failure ensued. He recovered with appropriate treatment. Images Fig. 1 Fig. 2 Fig. 3 PMID:6428731

  1. The visual arts in Northern Ireland hospitals.

    Science.gov (United States)

    Cromie, H.

    1995-01-01

    Since 1989 there has been a burgeoning of the visual arts in Northern Ireland hospitals. This paper compares the three organisational models for hospital arts currently operating within the Province and in an overview discusses ways to coordinate working practice for future development of the visual arts in local hospitals. Images Fig 1 Fig 2 Fig 3 PMID:8533183

  2. C60 and U ion irradiation of Gd2TixZr2-xO7 pyrochlore

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jiaming; Toulemonde, Marcel; Lang, Maik; Costantini, Jean Marc; Della-Negra, Serge; Ewing, Rodney C.

    2015-08-01

    Abstract

    <fig position='anchor'>figAb' mime-subtype='jpeg' mimetype='image' position='float' type='simple'/>fig>

  3. Characterization of ion-induced radiation effects in nuclear materials using synchrotron x-ray techniques

    Energy Technology Data Exchange (ETDEWEB)

    Lang, Maik; Tracy, Cameron L.; Palomares, Raul I.; Zhang, Fuxiang; Severin, Daniel; Bender, Markus; Trautmann, Christina; Park, Changyong; Prakapenka, Vitali B.; Skuratov, Vladimir A.; Ewing, Rodney C.

    2015-05-01

    Abstract

    <fig position='anchor'>figAb' mime-subtype='jpeg' mimetype='image' position='float' type='simple'/>fig>

  4. Uranyl peroxide nanoclusters at high-pressure

    Energy Technology Data Exchange (ETDEWEB)

    Turner, Katlyn M.; Szymanowski, Jennifer E. S.; Zhang, Fuxiang; Lin, Yu; McGrail, Brendan T.; Mao, Wendy L.; Burns, Peter C.; Ewing, Rodney C.

    2017-08-14

    Abstract

    <fig position='anchor'>figAb' mime-subtype='jpeg' mimetype='image' position='float' type='simple'/>fig>

  5. Ion-beam irradiation and 244Cm-doping investigations of the radiation response of actinide-bearing crystalline waste forms

    Energy Technology Data Exchange (ETDEWEB)

    Yudintsev, Sergey V.; Lizin, Andrey A.; Livshits, Tatiana S.; Stefanovsky, Sergey V.; Tomilin, Sergey V.; Ewing, Rodney C.

    2015-02-16

    Abstract

    <fig position='anchor'>figAb' mime-subtype='gif' mimetype='image' position='float' type='simple'/>fig>

  6. Publisher Correction: Tunnelling spectroscopy of gate-induced superconductivity in MoS2

    Science.gov (United States)

    Costanzo, Davide; Zhang, Haijing; Reddy, Bojja Aditya; Berger, Helmuth; Morpurgo, Alberto F.

    2018-06-01

    In the version of this Article originally published, an error during typesetting led to the curve in Fig. 2a being shifted to the right, and the curves in the inset of Fig. 2a being displaced. The figure has now been corrected in all versions of the Article; the original and corrected Fig. 2a are shown below.

  7. Selected caves and lava-tube systems in and near Lava Beds National Monument, California

    Science.gov (United States)

    Waters, Aaron Clement; Donnelly-Nolan, Julie M.; Rogers, Bruce W.

    1990-01-01

    Lava Beds National Monument (fig. 1) lies on the north slope of the huge Medicine Lake shield (fig. 2), a complex volcanic edifice of greater volume than the steep-sided Mount Shasta volcanic cone, which towers as a snowclad land mark 40 mi southwest of the monument (fig. 3).

  8. ALC Rooftop Sensor System

    Science.gov (United States)

    2017-10-31

    Department of the Army position unless so designated by other authorized documents. Citation of manufacturer’s or trade names does not constitute an... Interior view of the new sensor box ...................................................... 3 Fig. 4 Interior of original sensor box...7 Fig. 10 Interior of fiber patch panel .................................................................. 7 Fig. 11

  9. In situ investigation of halide incorporation into perovskite solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Aguiar, Jeffery A.; Alkurd, Nooraldeen R.; Wozny, Sarah; Patel, Maulik K.; Yang, Mengjin; Zhou, Weilie; Al-Jassim, Mowafak; Holesinger, Terry G.; Zhu, Kai; Berry, Joseph J.

    2017-07-10

    Abstract

    <fig position='anchor'>figAb' mime-subtype='jpeg' mimetype='image' position='float' type='simple'/>fig>

  10. Stable Pt clusters anchored to monovacancies on graphene sheets

    Energy Technology Data Exchange (ETDEWEB)

    Medasani, Bharat K.; Liu, Jun; Sushko, Maria L.

    2017-10-09

    Abstract

    <fig position='anchor'>figAb' mime-subtype='jpeg' mimetype='image' position='float' type='simple'/>fig>

  11. Renal involvement in Gaucher's disease.

    Science.gov (United States)

    Siegal, A.; Gutman, A.; Shapiro, M. S.; Griffel, B.

    1981-01-01

    A patient with chronic Gaucher's disease is described who developed glomerulopathy 24 years after splenectomy terminating in renal failure. The pathological changes of this very rare complication of Gaucher's disease are described. The few similar cases reported in the literature are reviewed and the possible pathogenetic pathways discussed. Images Fig. 1 Fig. 2 Fig. 3 PMID:7301691

  12. CpG-STAT3siRNA for Castration-Resistant Prostate Cancer Therapy

    Science.gov (United States)

    2015-12-01

    preliminary studies (Supplementary Fig. S2). Then selected myeloid cell populations were isolated using high- speed cell sorting using FACS-Aria (BD...experimental conditions, we analyzed IFNg and granzyme B production by CD8þ T cells. Both IFNg (Fig. 5G ) and granzyme B (Fig. 5H) expression levels were

  13. Development and Evaluation of a Dynamic, 3-Degree-of-Freedom (DOF) Wind Tunnel Model

    Science.gov (United States)

    2016-11-01

    position and the interference component engages the model by gripping between the fins identical to Fig. 12. Then the locking bar is pushed upward...eliminates any gimbal-induced flow disturbances. All 3 axes can be locked independently and are instrumented with high-resolution feedback. Experiments...6 Fig. 5 Gimbal assembly with axis locking mechanisms ..................................7 Fig. 6 Cross

  14. Composition and Temperature Dependence of Shear Viscosity of Hydrocarbon Mixtures

    Science.gov (United States)

    1980-07-01

    HNN- XTHDCPD Binary System IX. VTF Eq. Parameters for Shear Viscosities Using Constant B Parameter X. Results of Fits to Master Viscosity Eqs. (43...T(K) for 5 C10 Hydrocarbons I Fig. 2a. log n versus 103/T(K) for HNNi I Fig. 2b. log n versus 103/T(K) for XTHDCPD Fig. 3. Isothem of log n versus X...CD for CO-MO Binary System Fig. 4. Isotherm of log n versus XNBC for NBC-DMO Binary System ( ~Fig. 5. Isotherm of log n versus XfINN for HNN- XTHDCPD

  15. An aetiological study on spondylolysis from a biomechanical aspect.

    Science.gov (United States)

    Ichikawa, N.; Ohara, Y.; Morishita, T.; Taniguichi, Y.; Koshikawa, A.; Matsukura, N.

    1982-01-01

    The authors report clinical studies on lumbar disorders (clinical symptoms, X-ray findings) in athletes in various sports. The sport items were divided into three groups according to the main dynamic load applied to the lumbar region. As a result, over 60% of the athletes suffered from "lumbago", and among them spondylolysis reached the high rate of 27%. Arising from these clinical observations, we performed biomechanical laboratory analyses on human cadaver material, axial compression and rotational bending. Our results suggest that the incidence of spondylolysis depends upon the extent and direction of the loads. Images Fig. 4 Fig. 5 Fig. 8 Fig. 9 Fig. 10 PMID:7139222

  16. Complement and Immunoregulation in Tissue Injury

    Science.gov (United States)

    2015-12-01

    in normal mice subjected to 15 (Fig. 2C) or 30 min of ischemia (Fig. 2E) or 30 min of ischemia followed by 120 min of reperfusion (Fig. 2G ). Unlike...CVF-treated (Fig. 3G ) as opposed to grade 4 and 5 lesions in PBS-treated (Fig. 3H) mice. Interestingly however, the degree of lesions in animals...on epithelial cells. Because of its ability to mobilize neutrophils, IL-17A is important in the pathogenesis of autoimmune diseases, and in chronic

  17. Habilitation of Patients with Congenital Malformations Associated with Thalidomide: Surgery of Limb Defects

    Science.gov (United States)

    Hall, John E.

    1963-01-01

    The deformities commonly seen in “thalidomide babies” are described. These vary from relatively uncomplicated radial-ray defects to complete phocomelia of all four extremities. It is suggested that the care of these children is best carried out in a clinic accustomed to dealing with juvenile amputee problems. A plea is made for very early fitting of upper-extremity prostheses (at approximately three months of age) in cases of unilateral upper-limb deficiencies. A “bucket” for sitting should be supplied for children with quadrilateral phocomelia to sit in when they reach seven or eight months of age. Children with severe upper-limb malformations will be candidates for some form of externally powered prostheses. ImagesFig. 1a and 1bFig. 2a and 2bFig. 3a and 3bFig. 4a and 4bFig. 5a, b and cFig. 6a and 6bFig. 7Fig. 8Fig. 9a and 9bFig. 10a,bFig. 10c and d PMID:13952105

  18. Histopathological and electron microscopic studies of lymphangiectasia of the small intestine in Behçet's disease

    Science.gov (United States)

    Asakura, Hitoshi; Morita, Akira; Morishita, Tetsuo; Tsuchiya, Masaharu; Watanabe, Yoonosuke; Enomoto, Yasuhiro

    1973-01-01

    The gastrointestinal involvement and immunological findings in 16 patients with Behçet's disease are described. Four of 15 biopsy specimens of jejunal mucosa showed marked lymphangiectasia in the lamina propria similar to the appearance which was thought to be a characteristic finding in protein-losing enteropathy. None of the patients had hypoproteinaemia. Increases in serum immunoglobulin IgA were proved in six of 15 cases; in IgM, five of 15; and in IgG, one of 15. Electron microscopic studies showed that there were thousands of precipitated lymph protein bodies in the extracellular spaces of the lamina propria. Ulcers and healed ulcers of the large intestine were studied by light microscopy. ImagesFig. 1Fig. 2Fig. 3Fig. 4Fig. 7Fig. 8Fig. 9 PMID:4700433

  19. Planches

    OpenAIRE

    2016-01-01

    Fig. 2 - Karşi kilise, vue générale vers l’ouest Fig. 3 - Le panneau des donatrices (mur ouest) Fig. 4 - Le panneau des donateurs (mur nord) Fig. 5 - Partie nord-est du naos ; de haut en bas : Myrophores au sépulcre et Anastasis ; Paradis ; saint Artémios et le panneau des donateurs Fig. 6 - Mur sud : Constantin et Hélène, avec l’invocation de Michel Plakidas Fig. 7 - Vue vers le sud-est Fig. 8 - Voûte du naos, versant sud : Cène, Trahison de Judas, Baptême ; Dormition de la Vierge, Jeu...

  20. Association of eosinophilic myositis with an unusual species of Sarcocystis in a beef cow.

    Science.gov (United States)

    Gajadhar, A A; Yates, W D; Allen, J R

    1987-01-01

    The carcass of a mature cow had numerous, disseminated lesions typical of eosinophilic myositis. To elucidate the nature and possible cause of the lesions, histological sections were examined by light microscopy and selected areas were removed and processed for electron microscopy. The lesions were granulomatous in nature. Each granuloma contained at its centre an intact or ruptured sarcocyst associated with degenerate muscle fibers. Surrounding this was a layer of epithelioid cells and an intense accumulation of inflammatory cells, most of which were eosinophils. The primary cyst wall of the sarcocysts in these granulomas consisted of hair-like protrusions that featured many unusual electron-dense bodies. Sarcocysts with ultrastructures characteristic of Sarcocystis cruzi and Sarcocystis hirsuta were also present in muscle from the same animal, but these sarcocysts lacked any associated cellular responses. The eosinophilic myositis in this case appeared to be associated with sarcocystosis of an unknown species. Possibly, the inflammatory reaction was due to the host-parasite interaction in an unusual host. Images Fig. 1. Fig. 2. Fig. 3. Fig. 4. Fig. 5. Fig. 6. Fig. 7. Fig. 8. Fig. 9. Fig. 10. PMID:3115553

  1. The development of hyaline-cell cartilage in the head of the black molly, Poecilia sphenops. Evidence for secondary cartilage in a teleost.

    Science.gov (United States)

    Benjamin, M

    1989-01-01

    The development of hyaline-cell cartilage attached to membrane (dentary, maxilla, nasal, lacrimal and cleithrum) and cartilage (basioccipital) bones has been studied in the viviparous black molly, Poecilia sphenops. Intramembranous ossification commences before the first appearance of hyaline cells. As hyaline-cell cartilage is densely cellular and as that attached to the dentary, maxilla and cleithrum develops from the periosteum of these membrane bones, it must be regarded as secondary cartilage according to current concepts. It is also argued that the hyaline-cell cartilage attached to the perichondral bone of the basioccipital (a cartilage bone), could also be viewed as secondary. The status of the cartilage on the nasal and lacrimal bones is less clear, for it develops, at least in part, from mucochondroid (mucous connective) tissue. This is the first definitive report of secondary cartilage in any lower vertebrate. The tissue is therefore not restricted to birds and mammals as hitherto believed, and a multipotential periosteum must have arisen early in vertebrate evolution. Images Fig. 1 Fig. 6 Fig. 7 Fig. 8 Fig. 9 Fig. 10 Fig. 11 Fig. 12 Fig. 13 Fig. 14 PMID:2481666

  2. Medicine Among New Immigrants and Arab Minorities in Israel

    Science.gov (United States)

    Mishkin, Seymour

    1965-01-01

    The reaction to modern medicine and the general health of the new immigrants and Arab populations of Israel are described. The material was gathered during a threemonth visit to Israel where the author participated in the medical care of these persons. While these peoples still share many of the traditional medical superstitions and practices, the new immigrants have progressed much more during the 16 years of Israel's existence. At present over 99% of Jewish women give birth in hospital, whereas only 65% of Israeli Arabs do. The infant mortality rate among the Jews in 1963 was about 21 deaths per 1000 live births, about one-half the rate for Arabs. The importance of understanding the cultural background and social conflicts of these people as a preliminary to the provision of proper medical care is stressed. ImagesFig. 2Fig. 3Fig. 4Fig. 5Fig. 6Fig. 7 PMID:14285305

  3. Lymphocytic gastritis: a newly described entity: a retrospective endoscopic and histological study.

    Science.gov (United States)

    Haot, J; Hamichi, L; Wallez, L; Mainguet, P

    1988-01-01

    Lymphocytic gastritis is a histopathological entity characterised by the accumulation of small lymphocytes in the surface and foveolar epithelium. In order to investigate the correlation between endoscopy and histology in this condition, 192 observations selected on the basis of a presumed diagnosis of erosive or varioliform gastritis were reviewed. Ninety two instances corresponded to lymphocytic gastritis, while 100 did not show any particular microscopic feature and were labelled non-specific gastritis. There was a good correlation (48 of 58) between the diagnosis of the so-called varioliform gastritis and the histological evidence of lymphocytic gastritis. The correlation was even better when nodules, erosions, and enlarged folds were considered. Lymphocytic gastritis has a typical endoscopical appearance consisting of nodules, erosions, and large folds predominating in the gastric body. This contrasts with non-specific gastritis, which affects the antrum and produces erosions on a flat mucosa. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 PMID:3198002

  4. The Pathogenesis of Human Myocardial Infarction

    Science.gov (United States)

    Rona, George

    1966-01-01

    Coronary arteriography, dissection of the coronary arteries and histopathological examination of the heart were carried out in 150 autopsies to study the effect of coronary narrowing and occlusion, of the presence of collaterals, and of coronary artery predominance on the development of myocardial infarction. The thrombosis rate was related to the severity of coronary sclerosis. The development of collaterals was not enhanced by coronary sclerosis and occlusion, and collaterals did not protect the myocardium against reinfarction. Coronary occlusion was regularly demonstrable in recent myocardial infarct cases. The association of atrial and posterior ventricular infarcts was explained by occlusion of their common arterial branch. The interdependence between coronary sclerosis, thrombosis and myocardial infarction in human autopsy material emphasizes the importance of mural coronary artery disease in the genesis of coronary occlusion and myocardial infarction, and it is at variance with statistical data and experimental results. ImagesFig. 1Fig. 2Fig. 3Fig. 4Fig. 5Fig. 6 PMID:5924947

  5. Publisher Correction: Imaging the square of the correlated two-electron wave function of a hydrogen molecule.

    Science.gov (United States)

    Waitz, M; Bello, R Y; Metz, D; Lower, J; Trinter, F; Schober, C; Keiling, M; Lenz, U; Pitzer, M; Mertens, K; Martins, M; Viefhaus, J; Klumpp, S; Weber, T; Schmidt, L Ph H; Williams, J B; Schöffler, M S; Serov, V V; Kheifets, A S; Argenti, L; Palacios, A; Martín, F; Jahnke, T; Dörner, R

    2018-06-05

    The original version of this Article contained an error in the fifth sentence of the first paragraph of the 'Application on H 2 ' section of the Results, which incorrectly read 'The role of electron correlation is quite apparent in this presentation: Fig. 1a is empty for the uncorrelated Hartree-Fock wave function, since projection of the latter wave function onto the 2pσ u orbital is exactly zero, while this is not the case for the fully correlated wave function (Fig. 1d); also, Fig. 1b, c for the uncorrelated description are identical, while Fig. 1e, f for the correlated case are significantly different.' The correct version replaces 'Fig. 1e, f' with 'Fig. 2e and f'.

  6. 13th Annual Conference on the Foundations of Nanoscience (FNANO 2016) Held in Snowbird Cliff Lodge, Snowbird, Utah, April 11-14, 2016

    Science.gov (United States)

    2017-01-30

    DNA origami behaviour under tension . . . . . . . . . . . . . . . . . . . . . . . 194 Megan Engel, Flavio Romano, Thomas Ouldridge, Ard Louis and...Fig. 2d) and a narrow distribution of conductances (Fig. 2e; mean of 1.62 ± 0.09 nS, n = 100). The pore is also ohmic in behaviour (Supplementary Fig...oxidizer couples, Al/CuO is particularly interesting because of its high potential energy, tunable reactivity, its ability to produce gas at high

  7. High-Performance Low-Cost Portable Radiological and Nuclear Detectors Based on Colloidal Nanocrystals (TOPIC 07-B)

    Science.gov (United States)

    2016-07-01

    The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium

  8. Warrior Injury Assessment Manikin (WIAMan) Lumbar Spine Model Validation: Development, Testing, and Analysis of Physical and Computational Models of the WIAMan Lumbar Spine Materials Demonstrator

    Science.gov (United States)

    2016-08-01

    Fig. 13 Lumbar spine assembly in alignment fixture .......................................22 Fig. 14 Double -lap shear coupons before and after...Fig. 7). Strain data were determined from piston displacement, which was verified using a Vision Research Phantom v711 high-speed monochrome... piston would not engage the sample until it had reached the optimal velocity. The slot was around 5 inches in length and the ramp up travel was

  9. Multiphysics Modeling and Simulations of Mil A46100 Armor-Grade Martensitic Steel Gas Metal Arc Welding Process

    Science.gov (United States)

    2013-05-23

    further. Application of the Scheil additive rule to MIL A46100 yielded the CCT diagram displayed in Fig. 8. The diagram displayed in Fig. 8 is obtained...computational procedure used to construct the TTTand CCT diagrams could be used to predict the incubation time for austenite decomposition under an...of austenite into allotriomorphic ferrite is Fig. 8 MIL A46100 CCT diagram corresponding to the TTT dia- gram displayed in Figure 7(a): CCT curves and

  10. Proceedings of the International Conference on Lasers 󈨝 (12th), Held in New Orleans, Louisiana on December 3-8, 1989.

    Science.gov (United States)

    1990-01-01

    divides them corresponds to the vertex of the porro prism . This pattern can be explained by realizing that the resonator is optically equivalent to one...1c). The porro prism folds the resonator back on itself and places the two beams adjacent and parallel to each other (Fig. ld). They are, however...Symposia on Aerospace Sensing Conference, 1989. PORRO OUTPUT PRISM LASER ROD COUPLER Fig. la. Mallet Laser Resonator . Fig. lb. Mallet Laser Near Field

  11. Corrigendum to ;Dynamics of epidemic spreading with vaccination: Impact of social pressure and engagement; [Physica A 467 (2017) 167-179

    Science.gov (United States)

    Pires, Marcelo A.; Crokidakis, Nuno

    2017-09-01

    The authors regret to inform that there are two misprints in the axis of Fig. 3 of the paper. In Fig. 3(c), the correct identification of the x-axis is γ (gamma) instead of λ (lambda), and in Fig. 3(d), the correct identification of the y-axis is γ (gamma) instead of λ (lambda). These modifications do not affect the results of the paper, as well as the discussion made in the text.

  12. VITAL: Vanguard Investigations of Therapeutic Approaches to Lung Cancer

    Science.gov (United States)

    2011-07-01

    nor enhances TRAIL‑induced apoptosis in normal human peripheral blood mononuclear cells.117 Luteolin (Fig. 2), a naturally occurring flavonoid ...in leukemia cells.119 Silibinin (Fig. 2), a flavonoid isolated from Silybum marianum, can sensitize glioma cells to TRAIL‑induced apoptosis...tion of cells to death ligand‑ or death receptor activation‑mediated apoptosis.140,141 Similarly, the flavonoid quercetin (Fig. 2) enhances TRAIL

  13. Evolution of fruit traits in Ficus subgenus Sycomorus (Moraceae)

    DEFF Research Database (Denmark)

    Harrison, Rhett D.; Rønsted, Nina; Xu, Lei

    2012-01-01

    Fig trees are a ubiquitous component of tropical rain forests and exhibit an enormous diversity of ecologies. Focusing on Ficus subgenus Sycomorus, a phenotypically diverse and ecologically important Old World lineage, we examined the evolution of fruit traits using a molecular phylogeny construc......, such as flowering phenology, nutrient economy, and habitat preference. Thus, plant life-history, both directly and through its influence on fig placement, appears to have played a prominent role in determining fruit traits in these figs....

  14. Assembly of the CMS HF (hadron forward) calorimeter, April 2003 to June 2005

    CERN Multimedia

    Tejinder S. Virdee, CERN

    2005-01-01

    The forward calorimeters (HF) of the CMS hadron calorimeter system are located 11.2 m from the interaction point. Each HF module is composed by 18 wedges, made of steel absorbers and radiation-hard quartz fibers. The photogallery shows the wedges (Figs. 1-3, April 2003), the assembly of one HF module (Figs. 4-9, May and June 2004) and the assembly of the other (Figs. 10-11, June 2005)

  15. Problem of Vortex Turbulence behind Wings (II),

    Science.gov (United States)

    1980-09-23

    these winglets would give a resultant aerodynamic force directed towards the front which would decrease the wing drag. Such winglets will affect the...Fig. 30 Whitcomb winglets Pig. 31 Set of winglets for wake dissipation Surfaces on wing tips, winglets (Fig. 30), proposed by Whitcomb to diminish...anyway - to decrease the induced drag of the wing by putting some winglets at a certain angle in different planes, as shown in Fig. 31. The total

  16. Ball-on-DiscTribometers Protocol Development: Loss of Lubrication Evaluation

    Science.gov (United States)

    2016-02-01

    data ...........................................13 Fig. 12 Traction coefficient of the incident caused by a loose bolt .................15 Fig. 13...Damaged parts caused by a loose bolt .................................................16 Fig. 14 LoL traction coefficient’s time to failure...loss of lubrication occurred in March 2009 with a Sikorsky S-92 helicopter off the coast of Canada.2 The Sikorsky’s filter-bowl mounting studs

  17. Single-Use Sensor Strips for Reliable Field Analysis of Gunshot Residue

    Science.gov (United States)

    2013-10-13

    3    List of Figures Fig. 1. Cyclic square-wave voltammogram at the bare GCE for a mixture of trace metals and explosives constituents of GSR: 3...variables obtained after CVA analysis of the GSR samples according to (B) exposure level or (C) 3-class response mode. Samples in (B) correspond to...to (A) exposure level or (B) 3-class response mode. Samples correspond to the same controls outlined in Fig. 6. Fig. 8. Score plot of the

  18. Molecular Analysis of Tube Cement of the Biofouling Tubeworm Hydroides elegans

    Science.gov (United States)

    2016-03-08

    situ hybridizations were performed against competent larvae (Fig. 2A) and juvenile worms that were six hours into the metamorphic process (Fig.2C...upregulated genes are expressed in competent larvae and post- metamorphic juveniles of H. elegans. Of the 12 contigs tested, only one gene ( Orphan -1...was both highly upregulated in the first segment and expressed in the shell glands (Figs. 4F-I). Orphan -1 was and expressed in the shell glands and

  19. IDD Archival Hardware Architecture and Workflow

    Energy Technology Data Exchange (ETDEWEB)

    Mendonsa, D; Nekoogar, F; Martz, H

    2008-10-09

    This document describes the functionality of every component in the DHS/IDD archival and storage hardware system shown in Fig. 1. The document describes steps by step process of image data being received at LLNL then being processed and made available to authorized personnel and collaborators. Throughout this document references will be made to one of two figures, Fig. 1 describing the elements of the architecture and the Fig. 2 describing the workflow and how the project utilizes the available hardware.

  20. Utilization of a Curved Local Surface Array in a 3.5m Wide field of View Telescope

    Science.gov (United States)

    2013-09-01

    about 150-µm. (Fig. 3d ). The second carrier was released, leaving a device about 200-µm thick overall, as shown Fig. 3e, and that could be diced for...station with two of 12 imagers during early alignment. This device provided 3D measurements of the individual CCD surfaces, as well as known fiducial...Fig. 10: The Zernike aberration terms are measured for a set of defocused images using algorithms based on associated yield loss with the

  1. Musculature of facial scent glands in the muntjac.

    Science.gov (United States)

    Barrette, C

    1976-01-01

    The muscles associated with the very large preorbital glands of muntjacs (Muntiacus) are described. Although the two muntjac fawns examined were only 10 days old, their muscles were proportionately larger than those in adult specimens of North American cervids. A muscle, not found in North American cervids, but well developed in muntjacs, is probably responsible for the eversion of muntjacs' preorbital glands. Images Fig. 1 Fig. 2 Fig. 3 PMID:977477

  2. Akt Phosphorylation and PI (3, 4, 5) P3 Binding Coordinately Inhibit the Tumor Suppressive Activity of Merlin

    Science.gov (United States)

    2010-02-01

    GSK3h and merlin S315 phosphorylation tightly correlated with Akt1 expression and activation profiles (Fig. 3B, right). Compared with wild-type NTD...Fig. S4 for a bigger image). (f) Akt phosphorylates merlin in mammalian cells. Akt and merlin protein levels in cell lysates were confirmed (top...II (contains 1-590 residues) had a low level of binding to Akt. Interestingly, neither full-length merlin I nor merlin II interacted with Akt (Fig

  3. Decontamination of a canyon crane at the Savannah River Plant

    International Nuclear Information System (INIS)

    Stevenson, D.A.; Moore, D.B.; Bowers, J.W.; Brown, D.L.

    1985-01-01

    Decontamination of the crane is reviewed in terms of the health physics aspects, controls during decontamination efforts, and the resultant radiation exposure rates for decontamination efforts. 17 figs.,

  4. RTNS-II status

    International Nuclear Information System (INIS)

    Short, D.W.; Heikkinen, D.W.

    1987-01-01

    This report presents operational information about the Rotating Target Neutron Source (RTNS). Data presented include neutrons produced by year, availability, productivity, and staff radiation doses. 4 figs

  5. Urinary concentrating processes in vertebrates.

    Science.gov (United States)

    Schmidt-Nielsen, B.

    1979-01-01

    Avian and mammalian kidneys can produce a urine hyperosmotic to the blood by means of a renal countercurrent system. Birds are uricotelic; mammals are ureotelic. It is proposed that the inner medulla present in mammalian, but not in avian kidneys serves specifically to accumulate urea in the inner and outer medulla. Among mammalian kidneys the degree to which urea accumulates in the inner medulla is inversely related to the complexity of the vascular bundles (in the outer medulla) and the cortical urea recycling index. A model is proposed for urea recycling via the vascular bundles. The renal pelvis varies in size among mammals. Its relative size is unrelated to the type of vascular bundles, cortical recycling index; or urea accumulation in the inner medulla. Since urine refluxes into the renal pelvis during rising urine flow only, the function of the pelvis could be that of bringing the more dilute urine into contact with the outer medulla and underlying capillaries, thereby aiding in reducing the urea concentration in outer and inner medulla during rising urine flow. The size of the renal pelvis may be related to the volume of the inner medulla. Other factors may also be involved. Images FIG. 1 FIG. 3 FIG. 5 FIG. 6 FIG. 9 FIG. 10 FIG. 11 FIG. 12 FIG. 13 PMID:538955

  6. Compact instrument for fluorescence image-guided surgery

    Science.gov (United States)

    Wang, Xinghua; Bhaumik, Srabani; Li, Qing; Staudinger, V. Paul; Yazdanfar, Siavash

    2010-03-01

    Fluorescence image-guided surgery (FIGS) is an emerging technique in oncology, neurology, and cardiology. To adapt intraoperative imaging for various surgical applications, increasingly flexible and compact FIGS instruments are necessary. We present a compact, portable FIGS system and demonstrate its use in cardiovascular mapping in a preclinical model of myocardial ischemia. Our system uses fiber optic delivery of laser diode excitation, custom optics with high collection efficiency, and compact consumer-grade cameras as a low-cost and compact alternative to open surgical FIGS systems. Dramatic size and weight reduction increases flexibility and access, and allows for handheld use or unobtrusive positioning over the surgical field.

  7. Cerebro-costo-mandibular Syndrome

    Science.gov (United States)

    McNicholl, B.; Egan-Mitchell, B.; Murray, J. P.; Doyle, J. F.; Kennedy, J. D.; Crome, L.

    1970-01-01

    Three sibs with a hitherto unreported syndrome are described, the main features being mental handicap, palatal defects, micrognathia, and severe costovertebral defects, involving segmentation of most ribs and fusion of their dorsal ends to the vertebral bodies. In addition one infant had hypoplasia of an elbow together with defects of sacrum and coccyx; she and one other sib had minor dental defects. The syndrome is potentially lethal in the neonatal period; one of the sibs has survived. The inheritance is probably autosomal recessive. ImagesFIG. 1FIG. 2FIG. 3FIG. 4 PMID:5427859

  8. 75 FR 78674 - Emergency Food Assistance Program; Availability of Foods for Fiscal Year 2011

    Science.gov (United States)

    2010-12-16

    ...-apple juice, apple juice, cranberry sauce, dried cranberries, dried cherries, strawberries, applesauce, wild blueberries, mixed fruit, strawberry cups, peaches, pears, plums, dates, fig pieces, chicken leg...

  9. Statistical multistep direct and statistical multistep compound models for calculations of nuclear data for applications

    International Nuclear Information System (INIS)

    Seeliger, D.

    1993-01-01

    This contribution contains a brief presentation and comparison of the different Statistical Multistep Approaches, presently available for practical nuclear data calculations. (author). 46 refs, 5 figs

  10. Nuclear Waste Management. Semiannual progress report, October 1984-March 1985

    Energy Technology Data Exchange (ETDEWEB)

    McElroy, J.L.; Powell, J.A. (comps.)

    1985-06-01

    Progress reports are presented for the following studies on radioactive waste management: defense waste technology; nuclear waste materials characterization center; and supporting studies. 19 figs., 29 tabs.

  11. Nuclear Waste Management. Semiannual progress report, October 1984-March 1985

    International Nuclear Information System (INIS)

    McElroy, J.L.; Powell, J.A.

    1985-06-01

    Progress reports are presented for the following studies on radioactive waste management: defense waste technology; nuclear waste materials characterization center; and supporting studies. 19 figs., 29 tabs

  12. Qualitative analysis of nonlinear incidence rate upon the behaviour of an epidemiological model

    International Nuclear Information System (INIS)

    Li Xiaogui.

    1988-12-01

    Two theorems concerning the solutions of the system of differential equations describing an epidemiological model with nonlinear incidence rate per infective individual are demonstrated. 2 refs, 1 fig

  13. 9 CFR 205.206 - Farm products.

    Science.gov (United States)

    2010-01-01

    ... must specify by name) Apples, apricots, avocados, bananas, cherries, coffee, dates, figs, grapes (& raisins), nectarines, olives, papayas, peaches, pears, persimmons, pineapples, plums (& prunes...

  14. US Army Research Laboratory Power-Line UAV Modeling and Simulation (ARL-PLUMS Ver 2.x) Software Tool: User Manual and Technical Report

    Science.gov (United States)

    2015-09-01

    shown have units of pF/m. This is the capacitance matrix for the 115-kV 3-phase circuit seen in Fig. 24.....................................24 Fig. 29...The window that appears when one clicks “Calculate Lambdas ”. These are the linear charge densities for the 115-kV 3-phase circuit seen in Fig. 24...calculate the capacitance matrix (Fig. 28). The diagonal entries are called the coefficients of capacitance, and the non-diagonal entries are called

  15. Propagation of bottom-trapped waves over variable topography

    Digital Repository Service at National Institute of Oceanography (India)

    Shetye, S.R.

    Fig. 5. Variation in the magnitude of bottom-intensification of the incident and reflected waves (a and if) with meridional wavenumber (B, in dimensionless units). The values of parameters used in the computations are defined in the caption to Fig. 4... 1 I I I 0'0 1.0 (X) =~ Fig. 8. p~°)(x, y, z, 0) on the planes (a) z = 1, and (b) y = 0. The spatial coordinates are in dimensionless units. The values of the parameters used to compute the solution are defined in the caption to Fig. 4. The zonal...

  16. Doprinos istraživanju slobodnih i glikozidno vezanih isparljivih spojeva od 2001. do 2006.

    Directory of Open Access Journals (Sweden)

    Jerković, I.

    2007-04-01

    Full Text Available This review paper presents a contribution to the research of free and glycosidically bound volatiles in the 2001-2006 period obtained by work in the Department of Organic Chemistry, Faculty of Chemistry and Technology, University of Split, Croatia. Many terpene structures, phenylpropane derivatives (Fig. 6, as well as aliphatic hydrocarbons, alcohols, carbonyls, fatty acids and others were identified (Fig. 5. The chemotypes of Origanum vulgare ssp. hirtum, Artemisia absinthium and Myrtus communis were determined and some uninvestigated or insufficiently investigated plants (Micromeria juliana, Sequaoiadendron giganteum, Populus nigra, Prunus mahaleb, Ailanthus altissima and others were analyzed. A newly developed method of co-distillation enabled isolation of unstable volatile compounds without formation of artefacts (Fig. 1.The volatile aglycones liberated by enzymatic hydrolysis of the corresponding glycosides were aliphatic and phenylpropanoic derivatives, as well as monoterpenes, sesquiterpenes and others (Fig. 7. Only partial similarity was observed in the composition of volatile aglycones and corresponding free volatiles of the same plant.Furthermore, glucosides of ubiquitous monoterpene and aliphatic alcohols and phenols were prepared by Koenigs-Knorr glucosylation (Fig. 8, by enzymatic condensation and transglucosidation from cellobiose (Fig. 11 and by direct glucosylation with FeCl3 (Fig. 13. The products were characterized by GC-MS analysis of prepared tetraacetyl glucosides. Fragment ion characteristics of the aglucone moiety were present in all mass spectra, along with the fragments obtained from acetylated glucose (Fig. 12 and Fig. 14. Acetylated glucosides were separable on the HP-101 column, Fig. 9 (even diastereomeric tetraacetyl ß-glucosides of enantiomeric alcohols, Fig. 10.

  17. Modeling and Simulation of a DG-Integrated Intelligent Microgrid

    Science.gov (United States)

    2010-02-01

    17. The I-V curve from the manufacturer for BP-4175 175W PV module...........................32   Fig. 18. Wind turbine model...33   Fig. 19. Electrical outputs of wind turbine... PMSG : Permanent Magnet Synchronous Generator PLL : Phase Lock Loop PV : Photovoltaic PWM : Pulse Width Modulation TOU : Time of Use VTES

  18. Basic principles of radiological protection

    International Nuclear Information System (INIS)

    Pina, Jorge Luiz Soares de; Fajardo, Patricia Wieland.

    1984-07-01

    The fundamentals of radiological protection are presented. The interaction of radiation with matter and with living systems as well as radioprotection procedures and units are described. 6 refs., 7 figs., 9 tabs of radioactive wastes from nuclear medicine in Brazil are presented. 7 refs., 3 figs., 2 tabs

  19. Geologic Site Characterization of the North Korean Nuclear Test Site at Punggye-Ri: A Reconnaissance Mapping Redux

    Science.gov (United States)

    2013-11-30

    a commonly used material either alone or mixed in concrete for reinforcing tunnel walls and/or for emplacement purposes (Pakistan was reported to...so kg. in one cry:-.tJl (Fig. 37). Diopsidc forms light green translucent prismatic crystals. Follow in~:: crystal faces arc obsen•cd (Fig. 39, 7 J

  20. Midwest Structural Sciences Center, 2006-2013

    Science.gov (United States)

    2013-09-01

    be created and compared to experimental data (which also Fig. C2.1: The beam fixed in the testing apparatus and mounted on the electromagnetic ...structural components, a riveted stiffened panel, Fig. C3.3, was considered as the next test case. This stiffened panel was analyzed using displacement

  1. Erratum: Correction to: p-Hydroxy benzoic acid-conjugated dendrimer nanotherapeutics as potential carriers for targeted drug delivery to brain: an in vitro and in vivo evaluation

    Science.gov (United States)

    Swami, Rajan; Singh, Indu; Kulhari, Hitesh; Jeengar, Manish Kumar; Khan, Wahid; Sistla, Ramakrishna

    2017-11-01

    In the published manuscript https://doi.org/10.1007/s11051-015-3063-9, a qualitative cellular uptake image in UT87MG cell line in Fig. 4c is incorrectly provided. The provided fluorescent images in Fig. 4 correspond to our other concurrent project on same cell line.

  2. A systematic catalogue of the Coleopterous family Helotidae in the Leiden Museum

    NARCIS (Netherlands)

    Ritsema, C.

    1915-01-01

    Gen. HELOTA Mc L.1) Mc Leay, Annulosa Javanica, 1825, p. 42; ed. Lequien, 1833, p. 151. INDOMALAYAN SPECIES. (Nos. 1—69). 1. Vigorsi Mc L. Annul. Javan. 1825, p. 43, tab. 1, fig. 9; ed. Lequien, 1833, p. 152, tab. 5, fig. 4. a. ♀. Java or.: Mt. Ardjoeno (W. E. J. Hekmeyer). b. ♀. Java (A. B. v.

  3. Publisher Correction: Predicting unpredictability

    Science.gov (United States)

    Davis, Steven J.

    2018-06-01

    In this News & Views article originally published, the wrong graph was used for panel b of Fig. 1, and the numbers on the y axes of panels a and c were incorrect; the original and corrected Fig. 1 is shown below. This has now been corrected in all versions of the News & Views.

  4. CASE REPORT Echinococcal disease of the bone: An unusual ...

    African Journals Online (AJOL)

    Fig.1. Plain radiographs demonstrate a multilocular lucent lesion in the mid- shaft of the right radius, complicated by pathological fracture. Fig. 2. Histological slide indicating the presence of a hydatid hooklet (arrow). (Figure by courtesy of the Division of Anatomical Pathology/NHLS, University of the Witwatersrand).

  5. Remembering Johann Gregor Mendel: a human, a Catholic priest, an Augustinian monk, and abbot.

    Science.gov (United States)

    Richter, Father Clemens

    2015-11-01

    Johann Mendel (Gregor was the name given to him only later by his Augustinian order, Fig. 1) was born on July 20, 1822 to an ethnic German family, Anton and Rosina Mendel (Fig. 2), in Heinzendorf in the Austrian Empire at the Moravian-Silesian border (now Hynčice, Czech Republic).

  6. cricket: nature and incidence of fast-bowling injuries at an elite ...

    African Journals Online (AJOL)

    . T3. TT. Fig. 1. Seasonal injury incidence per anatomical area. 0. 5. 10. 15. 20. 25. 30. 35. 40. 45. 50 strain other sprain tear fracture bruise break dislocation. T1. T2. T3. TT. Fig. 2. The nature of injuries to fast bowlers. saJsM Vol 20 no. 2 2008.

  7. Terrestrial movements of the red-bellied mudsnake (Farancia abacura) and rainbow snake (F. erytrogramma)

    Science.gov (United States)

    David A. Steen; Dirk J. Stevenson; Jeffrey C. Beane; John D. Willson; Matthew J. Aresco; James C. Godwin; Sean P. Graham; Lora L. Smith; Jennifer M. Howze; D. Craig Rudolph; Josh B. Pierce; James R. Lee; Beau B. Gregory; John Jensen; Sierra H. Stiles; James A. Stiles; Nathan H. Nazdrowicz; Craig Guyer

    2013-01-01

    Red-bellied Mudsnakes (Farancia abacura; Fig. 1A) and Rainbow Snakes (Farancia erytrogramma; Fig. 1B) are relatively large species with geographic distributions restricted to the southeastern United States. Both species are highly associated with aquatic habitats, to the extent that at least one, the Red-bellied Mudsnake, has been described as "fully aquatic...

  8. 77 FR 12182 - Safety Standard for Portable Bed Rails: Final Rule

    Science.gov (United States)

    2012-02-29

    ... comply with the registration card requirements. 76 FR 68668. In the Federal Register of April 11, 2011... normal disassembly (see Fig. 1). [GRAPHIC] [TIFF OMITTED] TR29FE12.004 3.1.6 consumer adjustment, n... arms are rotated 180 degrees above the vertical axis (Fig. 9). [[Page 12189

  9. Preclinical Mouse Models of Neurofibromatosis

    Science.gov (United States)

    2009-10-01

    nuclei with prominent nucleoli (Fig. 2D-F). They also demonstrated brain invasion, an independent predictor of poor prognosis (Fig. 1C). Sheeting, a...figures (arrows E, F) and large cell nuclei with prominent nucleoli (arrowheads E, F). Focal rhabdoid features were also seen in some K;Nf2;Ink4a/Arf

  10. A review of the mobile LIDAR system developed at the CSIR and a proposed improvement of the system

    CSIR Research Space (South Africa)

    Shikwambana, L

    2012-07-01

    Full Text Available or cloud of pollutants) and (3) To study the plume (say smoke, biomass burning and etc), Haze and Aerosol/pollutant dispersion. Fig. 5. A schematic view of the modified LIDAR system with Scanner. Fig. 4. (a) Ground-based zenith-pointing lidars...

  11. Ion Source Development for a Compact Proton Beam Writing System III

    Science.gov (United States)

    2013-06-28

    on ( piezo ) translation stages (Fig. 1). By controlling the piezo translation stage, the opening size of the objective and aperture collimators can be...Acceleration column in Fig. 4). A constant potential drop is maintained across each electrode, through an appropriate resistor arrangement, the accelerated

  12. Three-dimensional colour Doppler of ductus venosus agenesis in ...

    African Journals Online (AJOL)

    was bilateral pleural effusion with generalised subcutaneous oedema suggestive of hydrops fetalis (Fig. 1B). Colour Doppler sonography revealed the umbilical vein draining into the portal sinus with non-visualisation of the DV, which would connect the portal sinus with the inferior vena cava (IVC) (Figs 1C and 1D). Hence ...

  13. Radiation hematology

    International Nuclear Information System (INIS)

    Zherbin, E.A.; Chukhlovin, A.B.

    1989-01-01

    State-of-the-Art ofl radiation hematology and review of the problems now facing this brauch of radiobiology and nuclear medicine are presented. Distortion of division and maturation of hemopoiesis parent cells is considered as main factor of radiopathology for hematopoetic system. Problems of radiation injury and functional variation of hematopoetic microenvironment cell populations are discussed. 176 figs.; 23 figs.; 18 tabs

  14. A case of cyclist's nodule in a female patient

    African Journals Online (AJOL)

    origin (Fig. 1). e nodule measured 12 mm × 7 mm × 15 mm and showed no flow on Doppler. A magnetic resonance image (MRI) of the pelvis was also performed and showed a poorly circumscribed nodule, isointense to muscle on all sequences, in the right perineum (Fig. 2). A diagnosis of a cyclist's nodule was made ...

  15. Untitled

    Indian Academy of Sciences (India)

    , Peru. Pl. 4, fig. 4. . N. tonentosa race Ticempaya. U.C.B.G. 36-59. Ticempaya,. Dpto, La Paz, Bolivia. Pl. 4, fig. 1. N. tomertosifornis Goodsp. U.C.B.G., 25-2. Amazon basin,. Described by Goodspeed (i933). This species has been used under.

  16. Micropalaeontological proxies for understanding palaeoclimate

    Digital Repository Service at National Institute of Oceanography (India)

    Nigam, R.

    of drought years was also deciphered (Fig. 5) and possibilities of correlation between inferred cycle and Gleissberg cycle in variation of radius of the sun were pointed out (Fig. 6). Since reliability of any new technique can be best supported through...

  17. The Spiral Pattern During Development*

    African Journals Online (AJOL)

    1971-08-07

    Aug 7, 1971 ... which are destined to become the limb areas bud out laterally. Fig. 8. The early cells, which are destined to develop into the upper and the lower limbs, after lateral budding has occurred. Fig. 11 demonstrates the human embryo of about 5 mm. CR length and age of about 32 days. The spiral pattern is.

  18. SIMULATION OF NEW SIMPLE FUZZY LOGIC MAXIMUM POWER ...

    African Journals Online (AJOL)

    2010-06-30

    Jun 30, 2010 ... Basic structure photovoltaic system Solar array mathematic ... The equivalent circuit model of a solar cell consists of a current generator and a diode .... control of boost converter (tracker) such that maximum power is achieved at the output of the solar panel. Fig.11. The membership function of input. Fig.12.

  19. Untitled

    Indian Academy of Sciences (India)

    FIG. 4. A section through the liver of mouse fed with normal diet and culture filtrate of. P. purpurogenium for 18 days. (The picture reproduced here is from one among the. 4 mice that exhibited abnormal liver cell pattern.) FIG. 5. A section through the liver of mouse fed with normal diet and culture filtrate of. A. oryzae for 18 ...

  20. Bromus carinatus Hook. et Arn. en Puccinellia distans (L.) Parl. in Midden-Nederland

    NARCIS (Netherlands)

    Floristenclub Gelderse Vallei,

    1979-01-01

    The authors mention the occurrence of two grasses, Bromus carinatus Hook, et Arn. (fig. 1) and Puccinellia distans (L.) Parl. (fig. 2) in the central part of the Netherlands. The first is a naturalised adventitious plant, the other a species of saline habitats and is spreading through this part of

  1. Active Uptake of Amino Acids by Leaves of an Epiphytic Vascular Plant, Tillandsia paucifolia (Bromeliaceae) 1

    Science.gov (United States)

    Nyman, Leslie Paul; Davis, James P.; O'Dell, Stephen J.; Arditti, Joseph; Stephens, Grover C.; Benzing, David H.

    1987-01-01

    Specialized epidermal trichomes on the leaves of the epiphyte, Tillandsia paucifolia (Bromeliaceae) accumulate amino acids from solution. Simultaneous net uptake of 17 amino acids was determined using high performance liquid chromatography. Uptake occurs against concentration gradients at least as high as 104. Images Fig. 2 Fig. 3 PMID:16665307

  2. Evelyn Koop pälvis kõrge tunnustuse / Urve Karuks

    Index Scriptorium Estoniae

    Karuks, Urve, 1936-2015

    2004-01-01

    Maailma Võimlemisliidu (FIG) teenetemärgi Bievet II, autasu anti üle Jaapanis 2004.a. oktoobris toimunud ülemaailmsete parimate võimlemisklubide võistlusel, kus E. Koop osales kohtunikuna. Ta on ainus inimene Kanadas, kes on FIG-i autasu saanud

  3. Iatrogenic injury of an aberrant right posterior sectoral bile duct

    African Journals Online (AJOL)

    (Figs 1 and 2). A week later, an endoscopic retrograde cholangiopancreatography. (ERCP) examination was performed. This showed no filling of the right posterior sectoral ducts but normal opacification of the other ducts. (Figs 3a and b). These findings led to the diagnosis of an aberrant right posterior sectoral bile duct that ...

  4. Shape Factor Modeling and Simulation

    Science.gov (United States)

    2016-06-01

    and there are only 5, as shown in Fig. 9. Fig. 9. The 5 Platonic solids, from left to right, are tetrahedron, cube or hexahedron, octahe- dron ...hidden surfaces, much like the Icosahe- dron Gage. The black curve is the lognormal fit. The maximum likelihood estimate is µ = 0.537 and σ = 0.297, which

  5. Togun et al., Afr J Tradit Complement Altern Med., (2017) 14 (1): 110 ...

    African Journals Online (AJOL)

    EXPERT USER TOOGUN

    Ouchterlony plates (Fig 5), and also formed clear precipitin lines in immunoelecrophoresis experiments (Fig 6). ... treatment group did not show any significant difference before or after treatment (Table 4). ... A dose-dependent reduction in the respiratory portion of the lungs marked by different degrees of alveolar wall.

  6. Dissecting the Molecular Mechanism of RhoC GTPase Expression in the Normal and Malignant Breast

    Science.gov (United States)

    2010-09-01

    validated via qRT-PCR (Fig. S6) and FISH (Fig. 3D ). Interestingly, this fusion has previously been reported in an independent sample found by a...Ohta, H. Inoue, M.G. Cotticelli, K. Kastury, R. Baffa, J. Palazzo, Z. Siprashvili, M. Mori, P. McCue, T. Druck , C.M. Croce, K. Huebner, The FHIT gene

  7. caseous lymphadenitis

    African Journals Online (AJOL)

    Ibrahim Eldaghayes

    2017-12-05

    Dec 5, 2017 ... capsule (Fig. 5). Fig. 5. Capra ibex - Mannheimia haemolytica isolated from the lesion shown in Figure 3 (Gram staining). Both strains were attributed morphologically and by biochemical ... Liver, bone and brain: absence of pathogenic bacteria. ... pneumonia, characterized by the presence of nematode.

  8. The mechanical design and support for the CASTOR calorimeter for ALICE

    CERN Document Server

    Bartke, Jerzy; CERN. Geneva; Mavromanolakis, G; Panagiotou, A D; Zychowski, P

    1998-01-01

    The calorimeter is a structure built out of two sections (left and right), each of them consisting of four modules connected together at each corner through bolted plates, as can be seen in the general view (see Fig.1) and in the front view of the calorimeter (see Fig.2).

  9. Biology and biological control of Dalmatian and yellow toadflax

    Science.gov (United States)

    Linda M. Wilson; Sharlene E. Sing; Gary L. Piper; Richard W. Hansen; Rosemarie De Clerck-Floate; Daniel K. MacKinnon; Carol Bell Randall

    2005-01-01

    Dalmatian toadflax, Linaria dalmatica (L.) P. Mill. ssp. dalmatica (Fig. 1a), and yellow toadflax, Linaria vulgaris (L.) P. Mill. (Fig. 1b), are exotic [see Glossary] weeds of rangeland, forests and cropland. Although several species of weedy toadflax have been intentionally or accidentally introduced to North America, these two species are by far the most common and...

  10. Untitled

    Indian Academy of Sciences (India)

    T. 4. S. Baſa &rishnan Proc. Zaid. 4 cad. Sci., 4, zo/. X/l/, /-/. X (f. Filter. Wood's glass iolet. Filter. Bl te Vicet. Blue. Yellow. Yellow. Red. Red. FIG. 3 FIG. 4. Carbon tetrachloride Ethyl ether. Light Scattering in Liquids observed through a Babinet Compensator.

  11. numerical assessment of conventional regulation effectiveness

    African Journals Online (AJOL)

    Benkoussas B, Djedjig R, and Vauquelin O

    2016-05-01

    May 1, 2016 ... The effectiveness of an underground smoke control system mainly depends on fire safety engineering that is ... In the same context, this work aims firstly, at investigating the effectiveness of conventional regulation applied to .... 5a). Fig.4. Station smoke behavior for conventional ventilation regulation. Fig.5a.

  12. Coastal Trapped Waves, Alongshore Pressure Gradients, and the California Undercurrent

    Science.gov (United States)

    2014-01-01

    pared at different locations along the coast during January-March and 15 . lune -15 September 2UI5 (fig. 8a). ITie latter period is chosen because How...structure of the APF with depth and latitude over the slope (Fig 11). South of 42 N. the mean SSI1 over the slope during 15 . lune -15 September is

  13. A case of disseminated Candida dubliniensis in a preterm infant ...

    African Journals Online (AJOL)

    Fungal elements consistent with Candida spp. were seen within these granulomas. The periodic acid-Schiff special stain highlighted the fungal organisms (Fig. 4). Examination of the autolytic tissue from the brain showed an extensive fungal meningo- encephalitis (Fig. 3). Examination of the thymus revealed parenchymal.

  14. Developing simple tools for transferring the biology to the management in small scale fisheries: the case of a sword razor clam fishery in Galicia

    Directory of Open Access Journals (Sweden)

    Alba Hernández Otero

    2014-06-01

    Fig. 2. Management procedure proposed. Dark grey polygons indicate the stakeholders involved in shellfishing. Light grey polygons and white boxes show the recommended management actions. Fig. 3 von Bertalanffy growth curves fitted for E. magnus using growth marks revealed in the acetate peels.

  15. Effect of different diode laser powers in photodynamic therapy

    CSIR Research Space (South Africa)

    Maduray, K

    2010-09-01

    Full Text Available ?, Radiation and Oncology 37, p 131-135. Fig. 2: The cell viability of fibroblast cells after photosensitization with 50 µg/ml of ZnTSPc and photoactivation using a light dose of 4.5 J/cm2 an emitting output power of 31.8 mW from a CW laser source. Fig...

  16. A System for Receiving and Analyzing Meteorological Satellite Data at Small Meteorological/Oceanographic Centres or Aboard Ship,

    Science.gov (United States)

    1983-10-01

    or stereographic BE - Bond raw data with grid data NA> FIG. A4 THE MENU FOR THE NAVIGATION SUB-SYSTEM. 42 SACLANTCEN SR-74 A.3 ACQUISITION SUBSYSTEM...readily accessible to the user. The calibration routines of Ch. A.5 are callable from this sub-system. The menu is shown in Fig. A.15. A.6.1 The CRAO

  17. Untitled

    Indian Academy of Sciences (India)

    Further, according to Table II, the symmetric vibrations will have a polarisation diſc when the incident light is unpolarised and the syn innetric axis is along OZ. The observed depolarisation of the totally synn innetric vibration 1006 as shown in FigS. 3 (h) and (i) is, therefore, in agreenment with this theoretical expectation.

  18. Untitled

    Indian Academy of Sciences (India)

    muscular contraction is due to folding of myosin molecules as elongation will then be due to opposite action. 36. 2 i. 24. O o so so too to nint. Fig. 1. Frog stomach. Effect of KC on elongation. The addition of the ions to the water checks the clongation (Fig. 1). There is no significant difference between the actions of sodium ...

  19. Meningio- angiomatosis — case report and subject review

    African Journals Online (AJOL)

    Enrique

    showed multiple areas of hyperinten- sity in the left parietal lobe extending in a linear radial fashion along a num- ber of gyni and sulci over the surface of the brain (Fig. 1a). Moderate con- trast enhancement was seen adjacent to some of these hyperintensities (Fig. 1b). The hyperintense areas appeared denser than blood.

  20. Meteorological measurements on Midtdalsbreen

    NARCIS (Netherlands)

    Giesen, R.H.

    2011-01-01

    An automatic weather station (AWS) has been operating in the ablation area on Midtdalsbreen, a north-easterly outlet glacier of Hardangerjøkulen (Fig. 6-2), since October 2000. The station (Fig. 6-6) is owned and maintained by the Institute for Marine and Atmospheric research Utrecht (IMAU), Utrecht

  1. Landing Zone and Drop Zone Criteria

    Science.gov (United States)

    2017-05-01

    Points of Impact (RPI) ............................................................................................. 75 6.5.5 Multiple Points of Impact ...Helicopter IFR runway (UFC 3-260-01, Fig. 4-2) ....................................................................... 48 11 IFR airspace imaginary...surfaces: IFR Helicopter runways and helipad (UFC 3- 260-01, Fig. 4-3

  2. Landing-Zone and Drop-Zone Criteria

    Science.gov (United States)

    2017-05-01

    Points of Impact (RPI) ............................................................................................. 75 6.5.5 Multiple Points of Impact ...Helicopter IFR runway (UFC 3-260-01, Fig. 4-2) ....................................................................... 48 11 IFR airspace imaginary...surfaces: IFR Helicopter runways and helipad (UFC 3- 260-01, Fig. 4-3

  3. Microsurgical Composite Tissue Transplantation

    Science.gov (United States)

    Serafin, Donald; Georgiade, Nicholas G.

    1978-01-01

    total number of operative procedures required in achieving the desired result is also less, thus decreasing the cost of hospital care. ImagesFig. 1a.Fig. 1b.Fig. 1c.Fig. 1d.Fig. 2a.Fig. 2b.Fig. 2c.Fig. 2d.Fig. 3a.Figs. 3b and c.Fig. 3d.Figs. 4a-e.Fig. 5a.Figs. 5b and c. PMID:646501

  4. Felling Ficus

    DEFF Research Database (Denmark)

    Cotee-Jones, H. Eden W.; Whitaker, Robert J.

    2015-01-01

    ethnographic techniques to assess the attudes of villagers towards fig trees in the village of Komargoan and its surroundings in Assam, India. As reported for other parts of South Asia, we found fig trees have significant sacred status, which included taboos against cutng them down. However, we discovered...... mixed and sometmes contradictory understandings of the religious atributes of fig trees, which were sometmes believed to be inhabited by gods or ancestral spirits. The benefits most commonly associated with fig trees by interviewees were their aesthetc beauty, large size, and shade during the daytme...... heat. When the presence of these trees incurred economic costs, their religious, aesthetc, and practcal benefits were not sufficient reasons to prevent people from cutng them down, although often saplings would be planted in another place as compensaton. Unexpectedly, figs were only planted...

  5. Branchial Cleft Anomalies

    Science.gov (United States)

    McPhail, Neil; Mustard, Robert A.

    1966-01-01

    The embryology, anatomy and pathology of branchial cleft anomalies are discussed and 87 cases reviewed. The most frequent anomaly was branchial cleft cyst, of which there were 77 cases. Treatment in all cases consisted of complete excision. There were five cases of external branchial sinus and five cases of complete branchial fistula. Sinograms were helpful in demonstrating these lesions. Excision presented little difficulty. No proved case of branchiogenic carcinoma has been found in the Toronto General Hospital. Five cases are described in which the original diagnosis was branchiogenic carcinoma—in four of these a primary tumour has already been found. The authors believe that the diagnosis of branchiogenic carcinoma should never be accepted until repeated examinations over a period of at least five years have failed to reveal a primary tumour. ImagesFig. 1Fig. 2Fig. 3Fig. 4Fig. 5 PMID:5901161

  6. An XXX male resulting from paternal X-Y interchange and maternal X-X nondisjunction.

    Science.gov (United States)

    Annerén, G; Andersson, M; Page, D C; Brown, L G; Berg, M; Läckgren, G; Gustavson, K H; de la Chapelle, A

    1987-01-01

    A 2-year-old boy was found to have a 47,XXX karyotype. Restriction-fragment-length-polymorphism analysis showed that, of his three X chromosomes, one is of paternal and two are of maternal origin. The results of Y-DNA hybridization were reminiscent of those in XX males in two respects. First, hybridization to Southern transfers revealed the presence in this XXX male of sequences derived from the Y-chromosomal short arm. Second, in situ hybridization showed that this Y DNA was located on the tip of the X-chromosomal short arm. We conclude that this XXX male resulted from the coincidence of X-X nondisjunction during maternal meiosis and aberrant X-Y interchange either during or prior to paternal meiosis. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 PMID:2889356

  7. Cardiovascular Sound and the Stethoscope, 1816 to 2016

    Science.gov (United States)

    Segall, Harold N.

    1963-01-01

    Cardiovascular sound escaped attention until Laennec invented and demonstrated the usefulness of the stethoscope. Accuracy of diagnosis using cardiovascular sounds as clues increased with improvement in knowledge of the physiology of circulation. Nearly all currently acceptable clinicopathological correlations were established by physicians who used the simplest of stethoscopes or listened with the bare ear. Certain refinements followed the use of modern methods which afford greater precision in timing cardiovascular sounds. These methods contribute to educating the human ear, so that those advantages may be applied which accrue from auscultation, plus the method of writing quantitative symbols to describe what is heard, by focusing the sense of hearing on each segment of the cardiac cycle in turn. By the year 2016, electronic systems of collecting and analyzing data about the cardiovascular system may render the stethoscope obsolete. ImagesFig. 1Fig. 2Fig. 3Fig. 5Fig. 8 PMID:13987676

  8. Eficácia de Atrativos Alimentares na Captura de Zaprionus indianus (Gupta em Pomar de Figo em Santa Maria – RS

    Directory of Open Access Journals (Sweden)

    Mauricio Batistella Pasini

    2011-07-01

    Abstract. Aiming to evaluate the efficiency of food baits for monitoring and alternative control of fig fly [Zaprionus indianus (Gupta], held this job. The study was conducted in Sector Fruit of the Polytechnic College, University of Santa Maria, from January 22 to April 22, 2009 in fig orchard (Ficus carica L.. As model of trap we used Pet. bottles of 1 L. Guava juice, jelly palm juice and fig juice with different solvents were use as food baits, with 200 ml solution per bottle. The values were subjected to statistical analysis. The solutions fig juice + rum (50% +50% and fig juice + water (50% +50% showed higher levels of adult capture of Z. indianus, suggesting its use in fly monitoring. The alcohol-based solutions are inefficient.

  9. Fever, petechiae, and pulmonary infiltrates in an immunocompromised Peruvian man.

    Science.gov (United States)

    Berenson, C. S.; Dobuler, K. J.; Bia, F. J.

    1987-01-01

    The diagnostic considerations raised by immunocompromised patients with opportunistic infection continue to expand. When such patients harbor latent or persistent infection acquired in a tropical environment, the diagnostic challenge is even greater. The Infectious Disease Service at Yale-New Haven Hospital was asked to see a middle-aged man from Peru with known T-cell lymphoma who had recently completed a course of chemotherapy. He presented to the hospital with fever, petechial skin rash, pulmonary infiltrates, and neutropenia. Ultimately this case illustrated the necessity for careful evaluation of such patients, looking, in particular, for evidence of opportunistic parasitic infection. Images FIG. 1 FIG. 2 FIG. 3 FIG. 4 FIG. 5 PMID:3424876

  10. Reticulo-endotheliomatose maligna

    Directory of Open Access Journals (Sweden)

    C. Magarinos Torres

    1932-08-01

    Full Text Available A spindle-cell sarcoma (fig. 5 apparently originating from the dura (fig. 4 was found at the autopsy of a male, mulato, 17 years of age. The bones of the skull (occipital and both parietals were penetrated and destroyed (fig. 1 and 2. The nervous tissue was not penetrated, the only change in the brain being a depressed area where the tumor was included. Metastatic nodules were found in the liver (fig. 3,hepatic lymphnodes (fig. 14, spleen (fig. 12 and suprarenal bodies (fig. 15. The structure, however, in all those different locations was that of a typical endothelioma (figs. 8, 11 and 13. The cells are of large and moderate size, of polyhedral form, with vesicular nuclei, diminutive nucleoli and clear cytoplasm. (Figs. 6 and 8. They are arranged about a central lumen which represents a rudimentary vessel (figs. 9 and 13. Other areas are composed of cells without concentric arrangement (figs. 4 and 10. In small areas, the colums of liver cells are marginated in one side by typical sinusoids, while in the other side tumor cells arranged about a narrow lumen are seen suggesting a pathological (neoplastic sinusoid (figs. 7 and 9. The case is considered as a multiple diffuse endothelioma. The origin of the tumor is referred to the reticulo-endothelial apparatus of the liver, the spleen, the suprarenal bodies and the lymph nodes, the structure being rather uniform in those organs. In the dura, the endothelioma reproduces the structure and presents the general character of a fibroblastic sarcoma; in some places, however, the structure of endothelioma could be found (fig.6. It corresponds to the reticulo-endotheliomatosis maligna according to Puhr's grouping of progressive changes in the reticulo-endothelial apparatus which is a follows: 1. HYPERPLASTIC - 1. Mnnocytic leukemia. 2. a Aleukemic reticulosis (Goldschmid and Isaac. b Idiopathic sarcoma of skin (Kaposi. c Cutaneous sarcoid (Spiegler. 3. Secretory reticulosis. a Gaucher's disease. b

  11. INTRODUCTION A National park is an area set aside by a national government for the preservation of the natural environment. The World Conservation Union defines a National park as a natural area designated to protect the ecological integrity of one or more ecosystems for present and future generations. In Pakistan, the earlier ecological studies were generally observational. The earlier studies, generally appeared in 1950’s, were confined to visual description of the vegetation, and no attempts were made to recognize community types and to correlate them with the relevant environmental factors. On the contrary, advanced multivariate techniques of ordination and cluster analysis had been routinely used in Europe and other parts of the world. There are numerous ordination methods accessible in plant bionetwork, some of which have been extensively used, e.g. Principal Component Analysis (PCA and Detrended Correspondence Analysis (DCA (Hill & Gauch, 1980, whereas some others only sporadically used (Zhang, 2004. A series of studies using different ordination techniques were carried out in Pakistan by Ahmad et al., 2009; Ahmad, 2009; Jabeen & Ahmad, 2009; Pirzada et al., 2009; Ahmad et al., 2010a, b; Ahmad, 2011. In Canonical Correspondence Analysis (CCA the floristic statistics and the environmental variables can be assimilated within the ordination (Kashian et al., 2003. Within the Ayubia National Park, the study area was the moist temperate forest in Rawalpindi, NE-Pakistan (Fig. 1, showing a high diversity of susceptible plant and animal species. The geographical location of the park is 330° 52' N and 730° 90' E (Farooque, 2002. The aim of this research was to quantify the vegetation in Ayubia National Park using ordination techniques and to determine the soilvegetation relationship to provide basic awareness for preservation of nationally significant native flora. A list of plant species present in the study area is provided in Table 1. Apart from their

    Directory of Open Access Journals (Sweden)

    Qurat Ul Ann

    2011-09-01

    Full Text Available The relationship between species diversity and overall community assemblage was identified in two differentzones in Ayubia National Park (Rawalpindi, NE-Pakistan which is recognized as protected area. CanonicalCorrespondence Analysis (CCA was used to find correlation of environmental variables with speciesabundance/richness. Results showed that in Zone 1 species were rather scattered due to the less availability oforganic matter and soil moisture as they occupy the less dense forest cover. Whereas Zone 2 showed theopposite trends. Finally the overall zones showed that maximum number of quadrats included Zone 2 speciesdue to a great forest cover with excess amount of organic matter and soil moisture. The study highlighted theimportance of dynamic nature and composition of vegetation and stressed the need of conservation of nativeflora for future generations.

  12. A syndrome of acute zinc deficiency during total parenteral alimentation in man.

    Science.gov (United States)

    Kay, R G; Tasman-Jones, C; Pybus, J; Whiting, R; Black, H

    1976-01-01

    Changes in the plasma and urine levels of the trace metal zinc have been followed in a series of 37 adult patients totally supported by intravenous alimentation. Copper has also been determined in more recent cases. In such a seriously ill group, although urinary zinc loss may be very high at the height of catabolism, severe plasma depletion does not occur unless there is a subsequent phase of sustained anabolism and weight gain. In four patients plasma zinc fell to very low levels during this phase and three of this group developed a syndrome characterized by diarrhea, mental depression, para-nasal, oral and peri-oral dermatitis, and alopecia. The response to oral or intravenous zinc therapy is striking, except for hair regrowth which is delayed but eventually complete. The syndrome we have recognized in adult man has not been previously described. It resembles however the parakeratosis of zinc deficient swine and it is also very similar to Acrodermatitis enteropathica, a genetically determined disorder of infants very recently linked to zinc deficiency. Zinc is clearly essential to human metabolism and it should be included in all parenteral alimentation regimes particularly during the period of rapid, sustained, weight gain. Images Fig. 1. Fig. 2. Fig. 3. Fig. 6. Fig. 7. Fig. 9. Fig. 10. PMID:817677

  13. Installation of CMS EB (ECAL Barrel) Supermodules 5 and 13 inside HB+ (HCAL Barrel) on 26/27 April 2006

    CERN Multimedia

    Ken Bell, RAL

    2006-01-01

    The first two barrel "supermodules" of the CMS Electromagnetic Calorimeter (ECAL) have been inserted into the barrel hadron calorimeter (HCAL) in the CMS experimental hall (called SX5) in Cessy in preparation for the forthcoming magnet test and cosmic challenge (MTCC). Each of the two supermodules contains 1700 lead tungstate crystals in glass-fibre alveolar support structures, with associated avalanche photodiodes (APDs, for scintillation light detection), electronics and cooling system. See also the document CMS-PHO-OREACH-2006-019. The first two pictures show the two supermodules in their final position. Fig. 3: the "enfourneur" in position on the HB Cradle. Fig. 4: supermodule n. 5 and extension rails being lifted to the enforneur. Figs. 5-6: supermodule approaching the enforneur. Fig. 7: rotating the Enfourneur to the correct phi direction Figs. 8-9: aligning the extension rails with the rails inside HB and view from inside HB, once the rails are aligned. Figs. 10-12: insertion of supermodule n. 5. Fig. ...

  14. Variations in the ultrastructure of human nasal cilia including abnormalities found in retinitis pigmentosa.

    Science.gov (United States)

    Fox, B; Bull, T B; Arden, G B

    1980-01-01

    The electron microscopic structure of cilia from the inferior turbinate of the nose was studied in 12 adults, four with chronic sinusitis, one with allergic rhinitis, two with bronchiectasis, three with deviated nasal septum, and two normals. The changes are compared with those found in nasal cilia in 14 patients with retinitis pigmentosa. There were compound cilia in the seven cases with chronic sinusitis, allergic rhinitis, and bronchiectasis but, apart from this, the structure of the cilia was similar in all 12 cases. There were variations in the microtubular pattern in about 4% of cilia, dynein arms were not seen in 4%, and in the rest an average of 5-6 dynein arms were seen in each cilium. The orientation of the cilia was 0 to 90 degrees. In the retinitis pigmentosa patients there was a highly significant increase in cilial abnormalities. The establishment on a quantitative basis of the variations in normal structure of nasal cilila facilitated the recognition of an association between cilial abnormalities and retinitis pigmentosa and should help in the identification of associations that may exist between cilial abnormalities and other diseases. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 7 Fig. 8 PMID:7400333

  15. Cytoarchitectonic and quantitative Golgi study of the hedgehog supraoptic nucleus.

    Science.gov (United States)

    Caminero, A A; Machín, C; Sanchez-Toscano, F

    1992-01-01

    A cytoarchitectural study was made of the supraoptic nucleus (SON) of the hedgehog with special attention to the quantitative comparison of its main neuronal types. The main purposes were (1) to relate the characteristics of this nucleus in the hedgehog (a primitive mammalian insectivorous brain) with those in the SONs of more evolutionarily advanced species; (2) to identify quantitatively the dendritic fields of the main neuronal types in the hedgehog SON and to study their synaptic connectivity. From a descriptive standpoint, 3 neuronal types were found with respect to the number of dendritic stems arising from the neuronal soma: bipolar neurons (48%), multipolar neurons (45.5%) and monopolar neurons (6.5%). Within the multipolar type 2 subtypes could be distinguished, taking into account the number of dendritic spines: (a) with few spines (93%) and (b) very spiny (7%). These results indicate that the hedgehog SON is similar to that in other species except for the very spiny neurons, the significance of which is discussed. In order to characterise the main types more satisfactorily (bipolar and multipolars with few spines) we undertook a quantitative Golgi study of their dendritic fields. Although the patterns of the dendritic field are similar in both neuronal types, the differences in the location of their connectivity can reflect functional changes and alterations in relation to the synaptic afferences. Images Fig. 2 Fig. 3 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 PMID:1452481

  16. Blood conservation in cardiac surgery. Preliminary results with an institutional commitment.

    Science.gov (United States)

    Tyson, G S; Sladen, R N; Spainhour, V; Savitt, M A; Ferguson, T B; Wolfe, W G

    1989-01-01

    To evaluate the effect of blood conservation in cardiac surgery, use of blood products was analyzed in patients undergoing CABG before and after implementation of blood conservation techniques. Age, sex, coronary anatomy, ejection fraction, cardiopulmonary bypass time, and the preoperative hematocrit, platelet count, and clotting studies were similar in both groups. Methods of blood conservation included autologous transfusion of blood withdrawn before bypass, autotransfusion of shed mediastinal blood, strict protocols for transfusion, and acceptance of normovolemic anemia. With blood conservation, 25.5% of patients received no transfusions and 54.9% received blood only. Significant reductions (p less than 0.001) were achieved in the transfusion of blood from 6.8 +/- 2.4 to 2.3 +/- 2.6 units per patient and of plasma from 2.5 +/- 2.2 to 0.6 +/- 2.0 units per patient. Reductions in the use of platelets and cryoprecipitate were substantial, although not significant. Total donor exposure was reduced significantly from 13.1 +/- 7.3 to 4.3 +/- 6.7 donors per patient. The postoperative hematocrit was significantly lower and remained so at discharge. However, 30 days later there was no difference. This reduction in transfusion requirements decreased costs and donor exposure. Images Fig. 1. Fig. 2. Fig. 3. Fig. 4. Fig. 5. Fig. 6. Fig. 7. PMID:2730184

  17. Miocardite na forma aguda da doença de Chagas

    Directory of Open Access Journals (Sweden)

    Eitel Duarte

    1948-12-01

    Full Text Available The autopsy of a case of CHAGAS'S disease or American tryponosomiasis (a girl, 5 years old, dead in the 22nd day of illness is reported. The anatomic diagnosis was a follows: Acute diffuse chagasic nyocarditis. Chagasic encephalitis. Chagasic lymphadenitis of the right posterior auricular node. Tuberculosis of the bronchial and pulmonary nodes. Chronic passive hyperemia and atelectasia of the lungs. Chronic passive congestion and hemorrhages of the spleen. Serous hepatitis. Parotiditis. Edema of the right eyelids. Bilateral hydrothorax. Hydropericardium. Hydroperitoneum. The morphology of Schizotrypanum cruzi in the myocardium is considered. Besides agglomerates with typical small oval or round intracellular bodies, pre-flagellate and flagellate organisms, others are found in which the great amount of parasites and marked pressure exerted by them against each other render very difficult their identification; sometimes the similitude of such agglamerates to Toxoplasma is striking (Fig. 1 and 1 A. In such a case, the structure of the blepharoplast (Fig. 1 and IA, usually preserved, is profitable and allows the identification of the pre-flagellate and flagellate forms of Schizotrypanum cruzi. Most of the small sensitive nerves in the epicardium shows mononuclear infiltration of the perineurium (perineuritis, Figs. 12-14. Microscopically there is extensive Zenker's degeneration (Figs. 6-8 and parasitism of the heart muscle fibers, marked cellular infiltration of the interstitial connective tissue, which are found in the ordinary musculature of every chamber of the heart (Figs. 10-11 as well as in Tawara's node (Fig. 9, main bundle (Fig. 2 and right (Fig. 4 and left (Fig. 5 septal divisions of the bundle of His, and perineuritis. Those anatomic changes are associated to an abnormal electrocardiogram presenting some similitude to that of an anemic infarct of the anterior wall of the heart and which will be discussed elsewhere (unpublished paper by

  18. Remotely sensed phenology for mapping biomes and vegetation functional types

    CSIR Research Space (South Africa)

    Wessels, Konrad J

    2009-07-01

    Full Text Available clearly captured in Fig. 3. The majority of the pixels in the Savanna have a start of growing season in late October, midposition in February and end in June (Fig. 3). In contrast, the winter rainfall Succulent Karoo have a start of growing season... initially split the biomes based on vegetation production and then by the seasonality of growth IV - 1035 (Fig. 4). The three arid biomes (Desert, Succulent and Nama Figure 3. Frequency histograms of the mean START, midposition (MID) and END date...

  19. Research and Development of Ram/Scramjets and Turboramjets in Russia (La Recherche et le Developpement des Statoreacteurs, des Statoreacteurs a Combustion Supersonique et des Turbostatoreacteurs en Russie)

    Science.gov (United States)

    1993-12-01

    SCRJ - scramjet; SCRJ-R - scram-rocket engine; SFC - specific fuel consumption; SPRR - solid propellant ramrocket; SR - solid rocket; SSTO - Single...for hypersonic vehicles and aerospace planes in particular for SSTO . In the Fig. 1.20 are shown some results of study of two SSTO vehicle concepts...UI ATR ♦ RJ ♦ LA MVUMO MO^IUION VtMCU Fig.-1.20. Mast «fflcltncy of SSTO [11], M««-iif • •N>ir M>0-4|>«-M-JII-iii m-a-**-#-m-v Fig. 1.21

  20. Coarse fraction components in a red-clay sedimemt core, Central Indian Ocean Basin: Their occurrence and significance

    Digital Repository Service at National Institute of Oceanography (India)

    Iyer, S.D.; Fernandes, G.Q.; Mahender, K.

    -spherical shapes while some grains are irregular or blocky. Iron-rich fragments are nearly triangular or blocky and are 224 to 735 µm long (Fig. 8 A,B). Pumices of different shapes are 183 to 850 µm in size (Fig. 8 C-F) and sometimes have FeMn oxides.... 7 C,D). The former are 227 to 411 µm long and are either platy or bubble or Y-shaped morphology while the translucent shards are 46 to 190 µm long and are blocky or flat and stubby (Fig. 7 E,F). Coloured glass is also present of spherical to sub...

  1. First records of three Paraprionospio species (Polychaeta: Spionidae) from Indian waters

    Digital Repository Service at National Institute of Oceanography (India)

    Yokoyama, H.; Sukumaran, S.

    for the Indian specimens vs. ≤ 1.0 mm width for Japanese specimens). A difference in the shape of branchial lamellae in the most proximal region between Japanese P. cordifolia (a single plate) (Yokoyama, 2007) and the Indian specimens (2 plates) may be also due... of shaft notch gradually weakened showing lamellae boomerang-like shape (Fig. 2c,d). A slender filament at base of third pair of branchiae. Notopodial postsetal lamellae lanceolate on setigers 1-2 (Fig. 2e), becoming low and round on setiger 3 (Fig. 2f...

  2. An overview of shipwreck explorations in Indian waters

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.

    . Propeller shaft is attached to transfer the power from the engine to the propeller. It then runs through the hull and into a bearing just ahead of the propeller. One winch (Fig. c) was found near the propeller shaft. In addition to these finds a rough...: BLACKETT on one side (Fig. 13b) and the dates 1791 and 1792 on the reverse, (ii) Long oval shaped with a D below a crown symbol and a smaller crown symbol on the reverse along with other symbols (Fig. 13c), (iii) Square-ended, flat bottomed ingots without...

  3. La sedimentación salina actual en las lagunas de La Mancha: una síntesis.

    OpenAIRE

    Peña Zarzuelo, Antonio de la; Marfil, R.

    1986-01-01

    [ES] La Mancha es una región natural de más de 30.000 Km2, caracterizada por una topografía extraordinariamente plana y un clima de tipo semiárido (Cuadro 1, Fig. 2), en la que existen numerosas lagunas salinas (Fig. 1), la mayoría de las cuales, por su régimen anual, pueden ser consideradas como «playa-lakes» (Fig. 3). Desde el punto de vista hidroquimico sus salmueras están integradas por: a) aniones: SO4 y Cl, con CO3 y CO 3H subordinados, y b) cationes: Mg 2+ y ...

  4. A Real Options Approach to Quantity and Cost Optimization for Lifetime and Bridge Buys of Parts

    Science.gov (United States)

    2015-12-01

    As it is shown in Fig. 8, by increasing the buy size, the total cost of the system with a fixed EOS of 40 years and a fixed WACC of 3%, decreases...1000 uncertain demand event paths are considered in both analyses. For a 3% WACC , as illustrated in Fig. 9-a, the DES method gives an optimum buy size...consistency, other WACC values were tests as well. For example, for a 12% WACC , as illustrated in Fig. 9-b, the DES method gives an optimum buy size range

  5. Optical Acquisition, Image and Data Compression

    Science.gov (United States)

    1988-07-30

    It is from problems where the syntactic method is a suitable this pattern vector that one starts the analysis and approach are fingerprint ...reference axes. FiG. 3. (a) Texture of French canvas ; (b) HT of a block of Fig. 3a: (c) HT of a block of Fig. 3a with preprocessing for line thinning...the p-0 (HT) plane as it will appear in the following illustrations. Figure 3a shows the texture image of French canvas (Brodatz’s plate No. 20

  6. Assessment of regional ventilation by continuous inhalation of radioactive krypton-81m.

    Science.gov (United States)

    Fazio, F; Jones, T

    1975-01-01

    A simple technique is described for producing high-quality functional images of regional ventilation during physiological tidal breathing of the inert gas 81mKr. These images are quickly obtained on a gamma-camera without the need of computerized systems for data acquisition and display and are directly comparable with those of perfusion obtained with 99mTc-labelled macroaggregates. The short time required for the procedure, its simplicity, and the extremely low absorbed-radiation dose enable serial images of ventilation to be obtained in multiple views. Images FIG. 2 FIG. 3 FIG. 4 PMID:1182453

  7. Minoxidil specifically decreases the expression of lysine hydroxylase in cultured human skin fibroblasts.

    Science.gov (United States)

    Hautala, T; Heikkinen, J; Kivirikko, K I; Myllylä, R

    1992-01-01

    The levels of lysine hydroxylase protein and the levels of the mRNAs for lysine hydroxylase and the alpha- and beta-subunits of proline 4-hydroxylase were measured in cultured human skin fibroblasts treated with 1 mM-minoxidil. The data demonstrate that minoxidil decreases the amount of lysine hydroxylase protein, this being due to a decrease in the level of lysine hydroxylase mRNA. The effect of minoxidil appears to be highly specific, as no changes were observed in the amounts of mRNAs for the alpha- and beta-subunits of proline 4-hydroxylase. Images Fig. 1. Fig. 2. Fig. 3. PMID:1314568

  8. A Review of Australian Investigations on Aeronautical Fatigue during the Period April 1979 to March 1981.

    Science.gov (United States)

    1981-03-01

    RD73 9. COST CODE: b. Sponsoring Agency: 27003 SUPPLY 50/2 10. IMPRINT: 11. COMPUTER PROGRAM(S) Aeronautical Research (Title(s) and language(s...laminates. 9/24 An advanced iso -parametric element is also being Jeveloped specifically for the analysis of disbonds and internal flaws in composite...FAILURE - STATION 119 iso I f FIG. 9.3 NOMAD STRLFCI URAl I AlT 10(L TESI FIG. 9.4 FAILED NOMAD STRUT UPPER END FITTING FIG. 9.5 FRACTURE FACES OF FAILED

  9. Bladder cancer diagnosis with fluorescence-image-guided optical coherence tomography

    Science.gov (United States)

    Wang, Z. G.; Durand, D. B.; Adler, H.; Pan, Y. T.

    2006-02-01

    A fluorescence-image-guided OCT (FIG-OCT) system is described, and its ability to enhance the sensitivity and specificity is examined in an animal bladder cancer model. Total 97 specimens were examined by fluorescence imaging, OCT and histological microscopy. The sensitivity and specificity of FIG-OCT is 100% and 93% respectively, compared to 79% and 53% for fluorescence imaging, while the OCT examination time has been dramatically decreased by 3~4 times. In combination of endoscopic OCT, FIG-OCT is a promising technique for effective early bladder cancer diagnosis.

  10. Jogailos monetos su liūtu (leopardu) ir dvigubu kryžiumi skyde

    OpenAIRE

    Remecas, Eduardas

    2012-01-01

    The author of the paper discusses the type of Jogaila's coins of the Grand Duchy of Lithuania bearing a lion (leopard) and a double cross on the shield. Upon announcing this type of coins for the first time, an opinion was voiced that it was actually a bent fish rather than a lion (Fig. 1). This opinion was not unanimously accepted by numismatists. Later two more opinions appeared that a lion (Fig. 2) or a dragon (Fig. 3) was represented on the coins. The most recent finds of this type of coi...

  11. Ordinary chondritic micrometeorites from the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    ShyamPrasad, M.; Rudraswami, N.G.; Babu, E.V.S.S.K.; VijayaKumar, T.

    spherule has half of the olivines reversely zoned and contain small blebs of almost pure Fe (Fig. 3E, F,G) and the other half of the olivines are normally zoned (i.e., with a Mg-rich core and a Fe-rich rim). This is reverse of the zoned olivines commonly... half of the olivines which are dusty in appearance and the rest of the olivines show normal zoning (Fig .3 F, G). The dusty olivines in this porphyritic spherule contain several large blebs of almost pure Fe (Fig. 3G). Another relict grain...

  12. Introduction to Microemulsions

    Directory of Open Access Journals (Sweden)

    Gotić, M.

    2013-11-01

    Full Text Available Hoar and Schulman were the first (in 1943 to describe the transparent water-in-oil dispersion. They noted that a certain combination of water, oil, surfactant and alcohol cosurfactant would produce a clear homogeneous "solution", which Schulman in 1959 termed microemulsion. Schulman’s model of the inverse submicroscopic micelle is shown in Fig. 1. The IUPAC definitiondescribes microemulsion as a dispersion made of water, oil, and surfactant(s, which is an isotropic and thermodynamically stable system with dispersed domain diameter varying approximately from 1 to 100 nm, usually 10 to 50 nm. Water-in-oil microemulsions are important for the synthesis of various inorganic materials. In contrast to inverse micelle, water-in-oil micro-emulsion aggregates have mobile or free water in the core of the aggregate (Fig. 2. Reactions take place in a small volume of water inside a microdroplet, which results in improved properties of the products in terms of purity and particle size distribution. Microdroplet size can be controlled by suitable choice and mixing ratio of surfactant and cosurfactant (Fig. 3 and by the chemical composition of the oil and water phases. Microemulsions may have complex phase behaviour, commonly displayed in a phase diagram (Fig. 5 and Fig. 12. Surfactants are amphiphile molecules with hydrophilic head and lypophilic tail, thus bringing them affinity both to water and oil. Their main characteristics are adsorption at the interface and self-organization into supramolecular structures. By forming the interface layer, surfactants decrease surface tension and stabilize the microemulsion. According to the character of the hydrophilic head, surfactants are divided into anionic, cationic, nonionic, and amphoteric. Chemical structures of typical representatives are given in Fig. 6. Microemulsion aggregates may have various shapes, e.g. spherical, ellipsoidal, cylindrical, worm-like or bilayer (Fig. 7. Bicontinuous phase also occurs in

  13. 生活史研究によるパーソナリティ研究の試み(1)

    OpenAIRE

    本田, 時雄

    1980-01-01

    The man lives in the four dimensions of time and space. It is supposed that the man has four sides; 1) physiological and biological, 2) psychological, 3) sociological and 4) spiritual and existential (Fig.I・1). Such a man is living in his environments of home, school, community, occupation and culture which change with the time (Fig.I・2).In Fig. 3 is showed the relationship between the changes of the time and the history of the man (it may be named "life history"). The life history of a man c...

  14. Uncovering the Role of BMP Signaling in Melanocyte Development and Melanoma Tumorigenesis

    Science.gov (United States)

    2016-09-01

    specifiers’, genes that are initially expressed broadly in the neural crest and help to maintain neural crest identity (Fig. 2G ) (6). As development...melanoma cells, GDF6 and the BMP pathway negatively regulated SOX9 expression (Fig. 3G ; Fig. S13A-C). Epistasis analyses showed that SOX9 knockdown rescued...criteria, if the tumor volume reached >1,000 mm3; if tumor size or location affected the mobility or general health of animal, the animal was euthanized

  15. Lidar data for the community of Golovin, Alaska

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This publication presents lidar data collected over the community of Golovin, on the southern coast of the Seward Peninsula in western Alaska (fig. 1). The original...

  16. Hydrogen by water electrolysis

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    Hydrogen production by water electrolysis (aqueous solution of potassium hydroxide) is shortly presented with theoretical aspects (thermodynamics and kinetics), and components of the electrolytic cell (structural materials, cathodes, anodes, diaphragms), and examples of industrial processes. (A.B.). 4 figs

  17. Translation of selected papers published in Nuclear Constants 4, 1986

    International Nuclear Information System (INIS)

    1989-08-01

    The document includes the English translation of 7 papers published in the Russian journal Nuclear Constants 4, 1986 and dealing with neutron data evaluations for actinide nuclei and iron. Refs, figs and tab

  18. Neutron radiation capture; Radiatsionnyj zakhvat nejtronov

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1987-12-31

    For all stable and experimentally studied radionuclides evaluated data are presented on cross sections of thermal neutrons, on resonance integrals and medium neutron cross sections with energy of 30 KeV. Refs, figs and tabs.

  19. Production of amorphous metal layers using ion implantation and investigation of the related modification of some surface properties

    International Nuclear Information System (INIS)

    Hoang Dac Luc; Vu Hoang Lam.

    1993-01-01

    Amorphous layers were produced by implanting B + ions into Al at 50 keV. The modification of the electrochemical corrosion resistance and the mechanical strength of implanted specimen was investigated. (author). 2 refs, 1 tab, 2 figs

  20. Agricultural feedstock and waste treatment and engineering

    Energy Technology Data Exchange (ETDEWEB)

    Fiechter, A

    1985-01-01

    The present volume covers the production of ethanol from Jerusalem artichoke, cheese whey and the bioconversion of humicellulose, as well as modelling of bioreactors, optimization and process control. Four chapters are separately treated. (EF). With 65 figs., 53 tabs.

  1. Lepton probes in nuclear physics

    Energy Technology Data Exchange (ETDEWEB)

    Arvieux, J. [Laboratoire National Saturne, Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France)

    1994-12-31

    Facilities are overviewed which use the lepton probe to learn about nuclear physics. The lepton accelerating methods out some existing facilities are considered. The ELFE project is discussed in detail. (K.A.). 43 refs., 15 figs., 4 tabs.

  2. Wilderness medicine in southern Africa

    African Journals Online (AJOL)

    injuries, and trauma care, whereas jungle expeditions require an understanding ... series will address expedition medicine, psychological and human factors, and ... Dead. Fig. 1. Cumulative wilderness rescue statistics from 1900 to early 2017,.

  3. F/H Area Effluent Treatment Facility. Phase II. CAC basic data

    International Nuclear Information System (INIS)

    Collins, W.W.; O'Leary, C.D.

    1984-01-01

    Project objectives and requirements are listed for both Phase I and II. Schedule is listed with startup targeted for 1989. Storage facilities will be provided for both chemical and radioactive effluents. 8 figs., 19 tabs

  4. Intermittency in multiparticle production analyzed by means of stochastic theories

    International Nuclear Information System (INIS)

    Bartl, A.; Suzuki, N.

    1990-01-01

    Intermittency in multiparticle production is described by means of probability distributions derived from pure birth stochastic equations. The UA1, TASSO, NA22 and cosmic ray data are analyzed. 24 refs., 1 fig. (Authors)

  5. The impact of a change in referral pathway on a paediatric short-stay ...

    African Journals Online (AJOL)

    healthcare systems in certain regions of SA. ... Care Unit owing to incorrect use of referral pathways or during ... Due to budget constraints, limited resources .... Hospital. Home. Primary care clinic. Fig. 2. Origin of referral for each SD for 2011.

  6. Annual report 1996 concerning the nuclear safety and radiological protection in the Swiss nuclear installations

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-05-01

    The report presents detailed information about the nuclear safety and radiological protection in the Swiss nuclear power plants, the central interim storage at Wuerenlingen, the Paul Scherrer Institute (PSI) and other nuclear installations in Switzerland. figs., tabs., refs.

  7. Energy matrix in the Parana State. Year 2000

    International Nuclear Information System (INIS)

    1994-01-01

    The energy sector in the Parana State, Brazil, is analyzed. The supply, demand, investment, environmental, social and economic aspects are described, and the necessary action for satisfying the energy demand in the year 2000 are presented. 69 tabs., 11 figs

  8. A REVIEW OF THE SIXTH NSUKKA PRINTMAKING WORKSHOP ...

    African Journals Online (AJOL)

    The GeorgeofJudges

    The contemporary construction of art history is much affected by how artists, ... Another notable workshop was led by Ulli Beier from Germany, and in 1964, .... as illustrated in his earlier cited book (fig. .... Cambridge: Harvard University Press.

  9. High Energy Transport Code HETC

    International Nuclear Information System (INIS)

    Gabriel, T.A.

    1985-09-01

    The physics contained in the High Energy Transport Code (HETC), in particular the collision models, are discussed. An application using HETC as part of the CALOR code system is also given. 19 refs., 5 figs., 3 tabs

  10. Estimation of the radiobiological and kinetic factors of radiosensitivity and radiocurability of metastases of squamous cell carcinoma of the larynx to neck lymph nodes

    International Nuclear Information System (INIS)

    Maciejewski, B.

    1985-01-01

    The usefulness of theoretical model of tumour growth and experimental methods of kinetic and radiobiological factors for analysis of clinical data to improve the effectiveness of dose fractionation are checked. 176 refs., 27 figs., 19 tabs. (author)

  11. Multiple sclerosis research

    International Nuclear Information System (INIS)

    Battaglia, M.A.

    1990-01-01

    This volume proceedings contains four contributions which are in INIS scope, dealing with MRI and SPECT in the diagnosis of multiple sclerosis and assessment of disease activity. (H.W.). refs.; figs.; tabs

  12. Determination of critical density of charge

    International Nuclear Information System (INIS)

    Vila, F.

    1992-11-01

    In this work is given a full theoretically treatment of the problem how to determine the critical density of charge on nonconductive rectangular charged surfaces placed near a small spherical conductive and earthed surface. (author). 11 refs, 2 figs

  13. 31P NMR study of phosphate metabolites in intact developing seeds of wheat, soybean and mustard

    International Nuclear Information System (INIS)

    Gambhir, P.N.; Pande, P.C.; Ratcliffe, R.G.

    1994-01-01

    The study of 31 P NMR spectra of intact developing seeds of wheat, soybean and mustard and its possible use for assessing the relative degree of hypoxia under in vivo conditions are reported. 7 refs., 2 figs

  14. Drilling Lake Tutira for evidence of climate change

    International Nuclear Information System (INIS)

    Carter, L.; Northcote, L.; Page, M.; Brackley, H.; Trustrum, N.A.; Gomez, B.; Palmer, A.

    2004-01-01

    Thanks to a multi-organisation collaborative project, Lake Tutira in Hawkes Bay is starting to give up some exciting information about climate conditions during its 7400-year history. (author). 2 refs., 4 figs

  15. Plasma phenomena around comets: interaction with the solar wind

    International Nuclear Information System (INIS)

    Sagdeev, R.Z.; Shapiro, V.D.; Shevchenko, V.I.; Szegoe, K.

    1987-08-01

    The most important plasma physical experimental data measured during the cometary missions are summarized. These data do not include tail phenomena. Theoretical considerations are also presented concerning the upstream and bow shock regions. (author) 47 refs.; 15 figs

  16. Radiation sources EB and UV curing machines

    International Nuclear Information System (INIS)

    Takashi Sasaki

    1993-01-01

    This paper describes electron beam processors and related technologies for curing applications to facilitate those industrial personals who are trying to understand and evaluate the applicability and benefits of radiation curing to their products. 4 tabs., 10 figs

  17. A problem encapsulated Б role of CT

    African Journals Online (AJOL)

    2010-03-15

    Mar 15, 2010 ... Diagnosis is usually established at laparotomy in patients with recurrent attacks of ... structure in the midline in pelvis encasing small bowel loops (Fig. 1). .... Diagnosis and treatment of abdominal cocoon: a report of. 24 cases.

  18. Highlights of nuclear chemistry 1995

    International Nuclear Information System (INIS)

    1996-07-01

    In this report 9 topics of the work of the Nuclear Chemistry Group in 1995 are highlighted. A list of publications and an overview of the international cooperation is given. (orig.). 19 refs., 19 figs., 2 tabs., 2 app

  19. Highlights of nuclear chemistry 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-01

    In this report 9 topics of the work of the Nuclear Chemistry Group in 1995 are highlighted. A list of publications and an overview of the international cooperation is given. (orig.). 19 refs., 19 figs., 2 tabs., 2 app.

  20. Earth-covered storage of LPG - Development, construction and operating experiences

    International Nuclear Information System (INIS)

    Schuldt, P.; Grote, G.

    1990-01-01

    The paper describes the planning, approval procedures, design, fabrication, site-assembling and the testing of liquefied petroleum gas storage tanks. The practical experience after three years of operation is reported. 8 figs

  1. Nuclear fuel clad clothed with burnable poison and obtainment process

    International Nuclear Information System (INIS)

    Diez, P.; Netter, P.

    1994-01-01

    This clad has preferentially on its inner surface a boron compound such boron carbide or boron nitrogen deposited by Chemical Vapor Deposition or by Physical Vapor Deposition without any temperature elevation injurious to its mechanical properties. 3 figs

  2. Structure of the neutron-rich lithium isotopes in heavy-ion reactions

    International Nuclear Information System (INIS)

    Bespalova, O.V.; Galakhmatova, B.S.; Romanovskij, E.A.; Shitikova, K.V.; Burov, V.V.; Rzyanin, M.V.; Miller, H.G.; Yen, G.D.

    1993-01-01

    The structure properties, for factors, angular distributions and interaction cross sections of Li neutron-rich isotopes have been analyzed in the unified way. A good qualitative agreement with the experiment data was obtained. 20 refs.; 11 figs.; 1 tab

  3. Monitoring electronics during the experiments with the OSIRIS (HMI Berlin)

    International Nuclear Information System (INIS)

    Grebosz, J.

    1992-01-01

    This report presents the software to perform the constant monitoring of the electronics dedicated to control the multidetector system. It supervises the correct status of the gamma spectroscopy measurements. (author). 3 figs

  4. Evaluation of Land Suitability for Selected Tree Species in the ...

    African Journals Online (AJOL)

    Kassa T

    The study watershed is located at Korir village, in Tigray (Fig 1). The total size ..... contributed to 78% of the local market economy for firewood, 100% each for construction poles and .... Socio-economics and Policy Research Working Paper 54.

  5. High energy particle acceleration by relativistic plasma waves

    International Nuclear Information System (INIS)

    Amiranoff, F.; Jacquet, F.; Mora, P.; Matthieussent, G.

    1991-01-01

    Accelerating schemes using plasmas, lasers or electron beams are proposed and compared to electron bunches in dielectric media or laser propagation through a slow wave structure made of liquid droplets. (L.C.J.A.). 33 refs, 20 figs

  6. Supercollider physics

    International Nuclear Information System (INIS)

    Quigg, C.

    1985-03-01

    The physics that can be explored with multi-TeV supercolliders is reviewed, including parton distributions, hadron jet production, the standard electroweak theory and minimal extensions to it, technicolor, supersymmetry, and compositeness. 19 refs., 11 figs

  7. Critique of practical methods for computer evaluation of the hadron spectrum

    International Nuclear Information System (INIS)

    Mackenzie, P.B.

    1989-12-01

    I review Monte Carlo algorithms for lattice QCD including the dynamical effects of quarks, emphasizing scaling behavior of the algorithms with lattice spacing, volume, and quark mass. 59 refs., 6 figs., 2 tabs

  8. General SSAC functions

    International Nuclear Information System (INIS)

    Hill, J.

    1989-01-01

    The State System of Accounting for and Control of Nuclear Material (SSAS) is described and the elements involved defined. The SSAC's national and international objectives and its internal and external interactions are discussed. 1 fig

  9. The theory of heavy flavour production

    Energy Technology Data Exchange (ETDEWEB)

    Ellis, R.K.

    1989-08-09

    The theory of heavy quark production in hadronic reactions is reviewed. Rates for the production of charm, bottom and top quarks at energies of current interest are presented. 34 refs., 19 figs., 2 tabs.

  10. Analysis of anglers' catch data from the Swartkops estuary

    African Journals Online (AJOL)

    contribution of the three most abundant species is given. (Fig. 1). A comparison is .... Elizabeth Weather Office (1937 -1978) and wind distance (miles) at. Swartkops .... off St Croix Island with special reference to the biology of Cheimerius mifar ...

  11. The Fermilab recycler ring technical design report. Revision 1.2

    International Nuclear Information System (INIS)

    Jackson, Gerry

    1996-01-01

    Using a multi-channel analysis of W L W L scattering signals, I study the LHC's ability to distinguish among various models of strongly interacting electroweak symmetry breaking sectors. 9 refs., 1 fig., 3 tabs

  12. Role and chemistry of catalyst in hydrogen based heavy water plants (Paper No. 6.2)

    International Nuclear Information System (INIS)

    Pradhan, D.G.

    1992-01-01

    The chemistry of homogeneous catalyst particularly of KNH 2 in ammonia, based on which a number of plants are operating, is discussed. considering its importance and complexity. (author). 10 refs., 5 figs

  13. Role of computed tomography in oesophageal duplications. Report of two cases

    International Nuclear Information System (INIS)

    Jouini, S.; Menif, E.; Azaiez, N.; Ben Hajel, H.; Cheikh, I.; Ben Ammar, A.; Sellami, M.; Ben Jaafar, M.

    1995-01-01

    The authors present two cases of esophageal duplication: tubular in one case and cystic in the other. This rare anomaly was identified in both cases by CT scan. A review of literature is proposed. (authors). 22 refs., 10 figs

  14. Medical applications of NMR imaging and NMR spectroscopy with stable isotopes. Summary

    Energy Technology Data Exchange (ETDEWEB)

    Matwiyoff, N.A.

    1983-01-01

    The current status of NMR imaging and NMR spectroscopy are summarized. For the most part examples from the March 1983 Puerto Rico symposium are used to illustrate the utility of NMR in medicine. 18 refs., 5 figs.

  15. Seabird, fish, marine mammal and oceanography coordinated investigations (SMMOCI) in the Pribilof Islands, Alaska, July 2005

    Data.gov (United States)

    Department of the Interior — We conducted a survey of seabirds, fishes, marine mammals and oceanographic conditions near the Pribilof Islands, Alaska (Fig. 1) from the M/V Tiˆglaˆx during 20-26...

  16. MAMMARY TUBERCULOSIS PRESENTING AS CARCINOMA

    African Journals Online (AJOL)

    Fig. I . Case 1. Typical tubercle follicle surrounded by tissue ... glands and fibrosis of the surrounding adipose tissue. .... to tuberculous infection, memions heart, skeletal muscle, testis .... oesophagus, blood vessels or tracheobronchial tract-.

  17. Review of technetium behavior in relation to nuclear waste disposal

    International Nuclear Information System (INIS)

    Paquette, J.; Reid, J.A.K.; Rosinger, E.L.J.

    1992-05-01

    This report contains available information which determine possible methods of the transfer of technetium element from waste disposal facilities to the biosphere. It also includes possible effects upon human beings and environment. 65 refs., 4 tabs., 3 figs

  18. Air pollution in Aleppo city, gases,suspended particulates

    International Nuclear Information System (INIS)

    Othman, I.; Sabra, Sh.; Al-Kharfan, K.

    1994-06-01

    Total suspended particulates measured by using High Volume Air Sampler. The Co and O 3 were measured during weekday and weekend. The concentration of all pollutants at city center are higher than other measured areas. (author). 10 figs., 10 tabs

  19. New statistical function for the angular distribution of evaporation residues produced by heavy ions

    International Nuclear Information System (INIS)

    Rigol, J.

    1994-01-01

    A new statistical function has been found for modelling the angular distribution of evaporation residues produced by heavy ions. Experimental results are compared with the calculated ones. 11 refs.; 4 figs. (author)

  20. Multi-window dialogue system of data processing for experimental setup VASSILISSA in PAW environment

    International Nuclear Information System (INIS)

    Andreev, A.N.; Vakatov, D.V.; Veselski, M.; Eremin, A.V.; Ivanov, V.V.; Khasanov, A.M.

    1992-01-01

    Multi-window dialogue system for processing data acquired from experimental setup VASSILISSA is presented. The system provides friendly user's interface for experimental data conversion, selection and preparing for graphic analysis with PAW. 7 refs.; 5 figs.; 1 tab

  1. 9th Australian conference on nuclear techniques of analysis. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    The proceedings contains extended abstracts of 58 presentations. Topics discussed include: nondestructive testing methods, their performance and utilization, ion implantation, physical radiation effects, surface and cluster science. refs., figs.

  2. The role of fear and threat in communicating risk scenarios and the need for actions. Effect of fear on information processing

    Energy Technology Data Exchange (ETDEWEB)

    Meijnders, A.L.; Midden, C.J.H. [Eindhoven University of Technology, Faculty of Philosophy and Social Sciences, Department of Psychology and Linguistics, Eindhoven (Netherlands); Wilke, H.A.M. [Leiden University, Faculty of Social Sciences, Department of Social and Organizational Psychology, Leiden (Netherlands)

    1995-12-31

    The results of a first experiment regarding the title subject, in which we examined whether fear of environmental risks increases the tendency to carefully process information on environmentally sound behaviour, are discussed. 2 figs., 10 refs.

  3. JUST Vol. 28 No. 2 Aug 2008

    African Journals Online (AJOL)

    ben

    2008-08-02

    Aug 2, 2008 ... operating in fading environments (Hueda and Rod- rigruez, 2004), and ... networks supporting mobile computing (Lee et al.,. 1999). ... The transition diagram of the system analyzed in this report is given in Fig. 1, having N+1 ...

  4. fraud detection in mobile communications networks using user

    African Journals Online (AJOL)

    DEPT OF AGRICULTURAL ENGINEERING

    testing the methods with data from real mobile communications networks. Keywords: Call .... System. Monitoring. Database. Database. Fig. 3: Mobile communication detection tools ..... receiver operating characteristic curve (ROC). ROC is a ...

  5. Cytogenetic, cellular, and developmental responses in antarctic sea urchins (Sterechinus neumayeri) following laboratory ultraviolet-B and ambient solar radiation exposures

    International Nuclear Information System (INIS)

    Anderson, S.; Hoffman, J.; Wild, G.; Bosch, I.; Karentz, D.

    1993-01-01

    Increasing ultraviolet-B radiation as a consequence of springtime ozone depletion, could harm antarctic ecosystems. This study uses several techniques for studying genotoxic effects to evaluate UV-B effects in sea urchins from Antarctica. 6 refs., 2 figs

  6. A case of posttraumatic splenic translocation into the thorax; Przypadek pourazowego przemieszczenia sledziony do klatki piersiowej

    Energy Technology Data Exchange (ETDEWEB)

    Sosnowski, P.; Sikorski, L.; Ziemianski, A. [Akademia Medyczna, Poznan (Poland)

    1993-12-31

    A case of the left diaphragmatic hernia due to blunt thoracic and abdominal trauma is presented. Characteristic radiological signs of splenic translocation into the thorax contributed to quick diagnosis and immediate surgical intervention. (author). 5 refs, 2 figs.

  7. Fully deuterated microorganisms: Tools in magnetic resonance and neutron scattering

    International Nuclear Information System (INIS)

    Crespi, H.L.

    1988-01-01

    Current work at Argonne emphasizes the use of fully deuterated algae and cyanobacteria as tools in the study of photosynthesis and as a source of complex substrates for the culture of engineered overproducing bacteria. 17 refs., 1 fig., 1 tab

  8. Heavy neutrinos and new bosons at the SSC

    International Nuclear Information System (INIS)

    Kayser, B.; Deshpande, N.; Gunion, J.F.

    1984-01-01

    Methods for seeking and studying heavy neutrinos and new W bosons at the SSC are considered. Such particles are predicted by left-right symmetric models. Their properties and experimental signatures are analyzed. 25 refs., 5 figs

  9. GLOBAL JOURNAL OF SOCIAL SCIENCES VOL 8, NO

    African Journals Online (AJOL)

    Ada

    design approach was employed in the investigation and vehicular trip generation count at designated activity areas ... interaction is a function of the economy of the city .... Fig.1: The loop around Ibom Connection(Master Plan of Uyo, 1998). 3.

  10. Probing gas-surface interactions with a molecular beam

    International Nuclear Information System (INIS)

    Spruit, M.E.M.

    1988-01-01

    The dynamics of direct scattering, trapping and sticking in molecular beam scattering is probed. The O 2 /Ag interaction was chosen, using the close-packed (111) plane of Ag as target surface. 170 refs.; 22 figs.; 3 tabs

  11. Network for the increase of the industrial energy efficiency; Mreza industrijske energetske efikasnosti (MIEE)

    Energy Technology Data Exchange (ETDEWEB)

    Krstulovic, V [Energetski institut Hrvoje Pozar, Zagreb (Croatia)

    1997-12-31

    Introduction of the idea of a network for the increase of the industrial energy efficiency, international activities in that area, some experiences, targets and plan of the building of such network in Croatia. (author). 3 figs.

  12. Nuclear physics program plan

    International Nuclear Information System (INIS)

    1985-11-01

    The nuclear physics program objectives, resources, applications and implications of scientific opportunities are presented. The scope of projected research is discussed in conjunction with accelerator facilities and manpower. 25 figs., 2 tabs

  13. Cracking resistance study of steel for gas pipelines; Badania odpornosci stali przeznaczonej na rurociagi gazowe

    Energy Technology Data Exchange (ETDEWEB)

    Wasiak, J.; Bilous, W.; Hajewska, E.; Szteke, W.; Wagner, T. [Institute of Atomic Energy, Otwock-Swierk (Poland)

    1996-12-31

    The results of cracking resistance of steel tubes for gas pipelines have been performed. The temperature dependence of mechanical properties of X56 steel used as tube material have been shown. 2 refs, 6 figs, 4 tabs.

  14. Role of computed tomography in oesophageal duplications. Report of two cases; Duplications oesophagiennes: place de la tomodensitometrie

    Energy Technology Data Exchange (ETDEWEB)

    Jouini, S.; Menif, E.; Azaiez, N.; Ben Hajel, H.; Cheikh, I.; Ben Ammar, A.; Sellami, M.; Ben Jaafar, M. [Hopital La Rabta, Tunis (Tunisia)

    1995-12-31

    The authors present two cases of esophageal duplication: tubular in one case and cystic in the other. This rare anomaly was identified in both cases by CT scan. A review of literature is proposed. (authors). 22 refs., 10 figs.

  15. Some remarks on integrable Hamiltonian systems with two degrees of freedom

    International Nuclear Information System (INIS)

    Nguyen Tien Dung.

    1993-02-01

    In this note, based on examples, we consider some aspects of integrable systems with two degrees of freedom: local and global theory, orbit space, integrable surgery, generalized Delzant spaces, relations with ''pure'' symplectic geometry, etc. (author). 23 refs, 18 figs

  16. Rail projects gather steam

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-01-15

    The global recession hit rail companies hard, as demand for bulk commodities such as coal was affected. But green shoots of recovery are now appearing, with many rail companies announcing new haulage contracts. 3 figs.

  17. TropJrnal Vol 27 No1 4Intnet publicatn

    African Journals Online (AJOL)

    Administrator

    To provide skilled attendance during ... To strengthen the capacity of individuals, families, and communities to ... The Road Map was successful in building. Fig. ... Table 1: Number of Some Categories of Health Workers in Nigeria 2006.

  18. Role of current algebra in B→pp-barπ(π)

    International Nuclear Information System (INIS)

    Paver, N.; Riazuddin.

    1987-11-01

    We estimate in a current algebra framework the hadronic matrix elements relevant to the weak B→pp-barπ(π) transitions measured recently. The results so obtained are in agreement with the observed values. (author). 11 refs, 1 fig

  19. Bilateral renal calculi

    Science.gov (United States)

    Sreenevasan, G

    1974-01-01

    Bilateral renal calculi were present in 114 (10.7%) of 1,070 cases of proved urinary calculus admitted to the Urological Department of the General Hospital, Kuala Lumpur, during the period November 1968—May 1973. The management of bilateral renal calculi is discussed with reference to the first 100 cases in this series. The introduction of renography has greatly facilitated the decision as to which kidney should be operated on first. The management of patients with and without uraemia is discussed and the use of the modified V and V—Y incisions for the removal of staghorn calculi is described. Complications and results are briefly reviewed. ImagesFig. 1Fig. 4Fig. 6Fig. 7 PMID:4845653

  20. On-the-job training and practical emergency exercises

    International Nuclear Information System (INIS)

    Reuhl, R.

    1996-01-01

    It is described in detail how OJT during initial and retraining of licensed shift personnel is performed. Furthermore it is explained how an emergency exercise, which is OJT of highest value, is prepared, conducted and evaluated. 9 figs

  1. Changes in 900 MW PWR alarm processing policy

    Energy Technology Data Exchange (ETDEWEB)

    Pont, M [Electricite de France, Generation and Transmission, Nuclear Power Plant Operations, Paris (France)

    1997-09-01

    Following a brief description of the current 900 MW PWR alarm processing system, this document presents the feasibility study carried out within the scope of the Instrumentation and Control Refurbishment project (R2C). (author). 4 figs, tabs.

  2. 9th Australian conference on nuclear techniques of analysis. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-12-31

    The proceedings contains extended abstracts of 58 presentations. Topics discussed include: nondestructive testing methods, their performance and utilization, ion implantation, physical radiation effects, surface and cluster science. refs., figs.

  3. Radiation environment in the tunnel of a high-energy proton accelerator at energies near 1 TeV

    International Nuclear Information System (INIS)

    McCaslin, J.B.; Sun, R.K.S.; Swanson, W.P.

    1987-12-01

    Neutron energy spectra, fluence distributions and rates in the FNAL Tevatron tunnel are summarized. This work has application to radiation damage to electronics and research equipment at high energy accelerators, as well as to radiological protection. 7 refs., 4 figs

  4. Natural gas in a developing country: the tunisian test

    International Nuclear Information System (INIS)

    Rabah, S.

    1993-01-01

    This paper describes the development of natural gas in Tunisia and its importance in the tunisian economy. Existing natural gas pipelines and other future distribution systems are also studied. 2 figs

  5. Exploring Freshwater Science

    Indian Academy of Sciences (India)

    and long term studies on mapping freshwater biodiversity1. 1. R J Ranjit Daniels ... The hierarchical nature of stream organization offers opportunity to ecologists to ask .... threats, freshwater systems are losing their aesthetic value (Fig- ure 4).

  6. Environmental challenges to operationalisation of South African ...

    African Journals Online (AJOL)

    driniev

    can result in statistically significant increases in rainfall. The diagram below (Fig. ... activity qualifies for an Environmental Impact Assessment (EIA). Section 24 stipulates that, ... purpose of this workshop was to identify potential impacts of.

  7. Novel Deletion of SLC34A2 in Chinese Patients of PAM Shares ...

    Indian Academy of Sciences (India)

    Administrator

    very slowly, with progressive functional respiratory deficiency, asthenia, and tiredness. ... to hospital with progressive dyspnea in the past three years without any other ... including complete exon 5 and part of intron4 and intron5 (Fig 2B).

  8. New safety management method at Cominak

    International Nuclear Information System (INIS)

    Kallam, A.

    1993-01-01

    Operations manager Mr. Kallam presents the new safety management system, its implementation and results in this underground uranium mine in northern Niger, where the rate of accidents increased dangerously during the eighties. 3 figs., 3 photos

  9. (Dahomey) Basin

    African Journals Online (AJOL)

    Timothy Ademakinwa

    porosity versus depth curve of Bond and Kominz. (1984) (Fig. 7). .... accommodation space and water loads as a result of local or global ...... be deposited in marine outer shelf environment characterised by ..... exploration geology. American ...

  10. Monitor of SC beam profiles

    CERN Document Server

    CERN PhotoLab

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  11. Sustainable development and choices of electricity generating technologies

    International Nuclear Information System (INIS)

    Akiyama, Y.

    1994-01-01

    In Asia, developing nations continue their rapid economic and demographic expansion. In the future, those nations will have to choose between energy availability, ecological considerations and economic development . (TEC). 2 tabs., 6 figs

  12. Research Article Special Issue

    African Journals Online (AJOL)

    2018-01-15

    Jan 15, 2018 ... Faculty of Electrical Engineering, Universiti Teknologi MARA, 23000 Dungun, Terengganu,. Malaysia. 2. Faculty of .... to breadboard. Fig.5. Drone prototype ... Information Processing in Sensor Networks, 2017, pp. 327-328.

  13. The producers competition trimmed the laundries; Tillverkarnas taevling trimmade tvaettstugorna - om effekterna av Kansliets insatser inom omraadet energieffektiv tvaett och tork i fastighetstvaettstugor

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    Interviews have been made among 163 buyers and 28 suppliers of equipment for laundry-rooms in apartment houses. The aim was to study the opinion regarding new energy-efficient clothes washers and clothes dryers. 5 figs

  14. Break-through technologies. Power and/or heat generation; Genombrottstekniker. Kraft- vaermeproduktion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This report gives a compilation of technologies for the future in producing electric power and heat. The focus is on the areas Cogeneration, Fuel cells, Wind power, Solar cells, Artificial photosynthesis, and Hydrogen. Refs, 9 figs, 5 tabs

  15. New windows - attitude evaluation concerning energy efficient windows; Nya foenster uppaat vaeggarna - en utvaerdering av attityder till energieffektiva foenster

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This attitude investigation was made as structured telephone interviews of 200 persons during January 1995. The 200 persons were selected among those who had been involved in the window area of 300 building projects. 4 figs

  16. FMR measurements in fire ants: evidence of magnetic material

    Energy Technology Data Exchange (ETDEWEB)

    Esquivel, Darci M.S.; Acosta-Avalos, Daniel; El-Jaick, Lea J.; Cunha, Alexandra D.M.; Malheiros, Maria G.; Wajnberg, Eliane [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil); Linhares, Marilia P. [Centro de Ciencias do Estado, do Rio de Janeiro, Rio de Janeiro, RJ (Brazil)

    1998-01-01

    Based on the behavioral and the localization of iron-containing tissue fire ants were examined by EPR for magnetic material. Results suggest the presence of magnetite particles. (author) 12 refs., 1 fig.

  17. A suggested approach toward measuring sorption and applying sorption data to repository performance assessment

    International Nuclear Information System (INIS)

    Rundberg, R.S.

    1991-01-01

    The sorption of radioisotopes in relation to geologic disposal of radioactive wastes is discussed. Properties of the radioactive materials, rocks, and minerals, and the chemistry involved are described. 51 refs., 12 figs. CBS

  18. [Radiation induced changes in the cuticular hydrocarbons of the granary weevil and their relationship to dessication and adult mortality]. Half-yearly report, February 15-August 14, 1986

    International Nuclear Information System (INIS)

    1986-01-01

    Granary weevil (Sitophilus granarius) were irradiated with cesium-137 derived gamma radiation at various age groups. Hydrocarbon analysis of epicuticles were studied chromatographically and by mass spectroscopy. 3 figs., 4 tabs. (DT)

  19. Shock absorber in Ignalina NPP

    International Nuclear Information System (INIS)

    Bulavas, A.; Muralis, J.

    1996-09-01

    Theoretical calculation and experimental analysis of models of shock absorber in Ignalina NPP is presented. The results obtained from the investigation with model of shock absorber coincide with the theoretical calculation. (author). 2 figs., 3 refs

  20. Changes in 900 MW PWR alarm processing policy

    International Nuclear Information System (INIS)

    Pont, M.

    1997-01-01

    Following a brief description of the current 900 MW PWR alarm processing system, this document presents the feasibility study carried out within the scope of the Instrumentation and Control Refurbishment project (R2C). (author). 4 figs, tabs

  1. Superdeformation in the Hg-Tl-Pb region

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Yates, S.W.; Wang, T.F.; Kuhnert, A.; Brinkman, M.J.; Cizewski, J.A.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Azaiez, F.; Korten, W.; Draper, J.E.

    1990-10-01

    Superdeformation in the Hg-Tl-Pb region is discussed, with concentration on the experimental results. At least twenty-five superdeformed bands are known in this region, providing much new data to test theoretical calculations. 22 refs., 5 figs

  2. Methods for the characterization of impregnating pitches

    Energy Technology Data Exchange (ETDEWEB)

    Compin, S.; Ben Aim, R.; Couderc, P.; Saint-Romain, J.L.

    1987-11-01

    This paper discusses modification of the impregnation performance of various pitches. The filtration ability, which expresses the impregnation performance, was studied using gel permeation chromatography and scanning electron microscopy. 16 refs., 5 figs., 2 tabs.

  3. [Templates, site specifically modified with carcinogens]. Final report

    International Nuclear Information System (INIS)

    1985-01-01

    Progress is reported on the fidelity of DNA polymerases replicating oligonucleotides containing a bulky adduct. Studies are also presented on the structure of and DNA-cloning of the lac operator of Escherichia coli. 25 refs., 4 figs. (DT)

  4. Safe operating envelope

    Energy Technology Data Exchange (ETDEWEB)

    Oliva, N [Ontario Hydro, Toronto, ON (Canada)

    1997-12-01

    Safe Operating Envelope is described representing: The outer bound of plant conditions within which day-to-day plant operation must be maintained in order to comply with regulatory requirements, associated safety design criteria and corporate nuclear safety goals. Figs.

  5. An amplitude and phase control system for the TFTR rf heating sources

    International Nuclear Information System (INIS)

    Cutsogeorge, G.

    1989-04-01

    Feedback loops that control the amplitude and phase of the rf heating sources on TFTR are described. The method for providing arc protection is also discussed. Block diagrams and Bode plots are included. 6 figs

  6. Report on the year 1985

    International Nuclear Information System (INIS)

    1986-01-01

    This anneal report accounts for the market situation, marketing, structure of cooperation (URENCO), centrifuge production and development, financial aspects and personnel affairs, during the year 1985, of Ultra-Centrifuge Nederland n.v. (UCN). (H.W.). figs.; tabs

  7. Fast numerical solution of KKR-CPA equations: Testing new algorithms

    Energy Technology Data Exchange (ETDEWEB)

    Bruno, E.; Florio, G.M.; Ginatempo, B.; Giuliano, E.S. (Universita di Messina (Italy))

    1994-04-01

    Some numerical methods for the solution of KKR-CPA equations are discussed and tested. New, efficient, computational algorithms are proposed, allowing a remarkable reduction of computing time and a good reliability in evaluating spectral quantities. 16 refs., 7 figs.

  8. Energy balance of the Rio de Janeiro State - 1980/1994

    International Nuclear Information System (INIS)

    1995-01-01

    This document informs the energetic balance for Rio de Janeiro State -1980/1994, containing the energy fluxes from primary and secondary energy sources in the main sectors of Rio de Janeiro economy. 50 figs., 139 tabs

  9. The orange roughy Hoplostethus atlanticus is an un- usual fish ...

    African Journals Online (AJOL)

    denise

    inferred mainly from biological studies, but genetic studies have also found .... Chile. Fig. 2: Catch history of orange roughy around the world. The catches shown ..... roughy is the lack of validation past the first four years ...... English abstract).

  10. First branchial complex anomalies: report of 3 cases

    International Nuclear Information System (INIS)

    Goten, A. van der; Hermans, R.; Hover, P. van; Crevits, I.; Baert, A.L.

    1997-01-01

    Three cases of first branchial cleft anomalies are presented. The embryology and pathology of first branchial complex anomalies, their imaging characteristics and differential diagnosis are discussed. (orig.). With 3 figs

  11. First branchial complex anomalies: report of 3 cases

    Energy Technology Data Exchange (ETDEWEB)

    Goten, A. van der [Department of Radiology, University Hospitals, Catholic University of Leuven, Leuven (Belgium); Hermans, R. [Department of Radiology, University Hospitals, Catholic University of Leuven, Leuven (Belgium); Hover, P. van [Department of Radiology, University Hospitals, Catholic University of Leuven, Leuven (Belgium); Crevits, I. [Department of Radiology, University Hospitals, Catholic University of Leuven, Leuven (Belgium); Baert, A.L. [Department of Radiology, University Hospitals, Catholic University of Leuven, Leuven (Belgium)

    1997-02-01

    Three cases of first branchial cleft anomalies are presented. The embryology and pathology of first branchial complex anomalies, their imaging characteristics and differential diagnosis are discussed. (orig.). With 3 figs.

  12. The fractioning factor and the number of theorical plates in isotopic enrichment columns determined simultaneously

    International Nuclear Information System (INIS)

    Ducatti, Carlos

    1997-01-01

    Using an analytical approach and an analytical graphical method, it was determined simultaneously the fractioning factor and the number of theoretical plates in isotopic enrichment columns during the conditions of dinamical isotopic equilibrium. (author). 5 refs., 2 figs., 2 tabs

  13. Performances and reliabilities comparisons by multidimensional statistic studies

    International Nuclear Information System (INIS)

    Coudray, R.

    1993-01-01

    After an overview of the methods utilizables in this type of analyse, we insist on the method used in the experience return for the French PWR 900 MWe chemical and volume control system pump. 7 figs., 3 tabs., 8 refs

  14. On the problem of efficacy of operative and conservative treatment in degeneration of disks of the lumbar part of the vertebral column

    International Nuclear Information System (INIS)

    Klyushkin, I.V.; Mikhajlov, M.K.

    1996-01-01

    It is shown that magnetoresonance tomography gives significant diagnostic data of the state of disk structures and circumflex anatomic formations. The patients to be operated are bound to be examined using standard diagnostic algorithm. Refs. 3, figs. 2

  15. Approximation of antiproton spectra in pp- and pA collisions

    International Nuclear Information System (INIS)

    Demidova, E.V.; Sibirtsev, A.A.

    1989-01-01

    Phenomenological expressions, describing the inclusive cross sections of antiproton production in proton-proton and proton-nucleus collisions in 10-100 GeV energy range were obtained. 12 refs.; 10 figs

  16. Sun and architecture - design guideline. Sonne und Architektur - Leitfaden fuer die Projektierung; A - Potential der passiven Sonnenenergienutzung

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    The following topics are dealt with: types of utilisation, position and climate, building design. The appendix deals with comfort, meteorological data and the casting of shadows on the front wall. figs., tabs.

  17. Construction of a graphic interface for a nuclear reactor modelling and simulation

    International Nuclear Information System (INIS)

    Cadrdenas C, Carlos Roberto; Riquelme R, Raul Antonio.

    1995-01-01

    A graphic interface is presented for real time transient analysis under reactivity insertion, reactor operators training, and the RECH-1 reactor licensing, using the Paret (Program for Analysis of Reactor Transients) computer code. 17 refs., 29 figs

  18. Theory and analysis of nonlinear dynamics and stability in storage rings: A working group summary

    International Nuclear Information System (INIS)

    Chattopadhyay, S.; Audy, P.; Courant, E.D.

    1988-07-01

    A summary and commentary of the available theoretical and analytical tools and recent advances in the nonlinear dynamics, stability and aperture issues in storage rings are presented. 11 refs., 4 figs

  19. Phase transitions and quantum entropy

    International Nuclear Information System (INIS)

    Arrachea, L.; Canosa, N.; Plastino, A.; Portesi, M.; Rossignoli, R.

    1990-01-01

    An examination is made of the possibility to predict phase transitions of the fundamental state of finite quantum system, knowing the quantum entropy of these states, defined on the basis of the information theory. (Author). 7 refs., 3 figs

  20. Radiation protection measuring device SSM-1

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    Product information from the producer on a universal measuring instrument for alpha, beta and gamma radiation designed for stationary and field use by military, police and fire brigades. 4 figs. (qui)

  1. Redox mechanisms and superconductivity in layered copper oxides

    International Nuclear Information System (INIS)

    Raveau, B.; Michel, C.; Hervieu, M.; Provost, J.

    1992-01-01

    Redox reactions in high T c superconductors cuprates are complex and play an important role in superconductivity: oxygen non-stoichiometry is influencing the critical temperature, and rock salt layers interact with copper layers. 25 refs., 7 figs

  2. Analysis of intensive aerosol optical properties measured at the Jungfraujoch station

    Energy Technology Data Exchange (ETDEWEB)

    Li, F.; Nyeki, S.; Baltensperger, U.; Weingartner, E.; Lugauer, M. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    Characterisation of atmospheric aerosol optical properties at the Jungfraujoch has been conducted to deliver basic data for comparison with those from NOAA baseline atmospheric monitoring stations. (author) 2 figs., 2 refs.

  3. Trace analysis of organic ions in ice samples by capillary electrophoresis

    Energy Technology Data Exchange (ETDEWEB)

    Huber, T. [Bern Univ. (Switzerland); Schwikowski, M.; Gaeggeler, H.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    Capillary electrophoresis was tested as a new analytical method for ice samples. Comparisons to ion chromatography were made concerning accuracy, detection limits, reproducibility, necessary sample volume and time consumption. (author) 1 fig., 3 refs.

  4. Nuclear reaction analysis (NRA) for trace element detection

    Energy Technology Data Exchange (ETDEWEB)

    Doebeli, M. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Noll, K. [Bern Univ. (Switzerland)

    1997-09-01

    Ion beam induced nuclear reactions can be used to analyse trace element concentrations in materials. The method is especially suited for the detection of light contaminants in heavy matrices. (author) 3 figs., 2 refs.

  5. {sup 10}Be/{sup 230}Th ratios as proxy for particle flux in the equatorial Pacific ocean

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, R.F.; Fleisher, M.Q. [LDEO of Columbia Univ. (United States); Kubik, P.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Suter, M. [Eidgenoessische Technische Hochschule, Zurich (Switzerland)

    1997-09-01

    Particulate {sup 10}Be/{sup 230}Th ratios collected by sediment traps in the central equatorial Pacific Ocean exhibit a positive correlation with particle flux, but little or no correlation with particle composition. (author) 1 fig., 4 refs.

  6. NJP VOLUME 41 NO 3

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2014-04-06

    Apr 6, 2014 ... The umbilical cord is an important bacterial colonization site, which may .... Fig 1: Age at dropping of the umbilical stump among 196 babies. Care of ... shea butter application, mentholatum application, olive oil and dusting ...

  7. Dedication to Professor Hazel Prichard BSc, PhD, MBA (1954-2017)

    Science.gov (United States)

    Hall, Ian; Maier, Wolfgang; Barnes, Stephen J.

    2017-11-01

    The final section of this special issue of GCA on highly siderophile elements is dedicated to Professor Hazel Prichard (see Fig. 1) who sadly passed away in Cardiff on 1st January, 2017, after a brave battle with cancer.

  8. SAJAA JA Marfan' (Converte.fh9

    African Journals Online (AJOL)

    Studio G5

    MFS is a multisystem disorder with a prevalence of 1/3000-. 1/5000 ... (Fig 2) and high-arched palate with secondary dental overcrowding .... Anaesthetic considerations. Patients may present for elective orthopaedic, cardiovascular or.

  9. Medical applications of NMR imaging and NMR spectroscopy with stable isotopes. Summary

    International Nuclear Information System (INIS)

    Matwiyoff, N.A.

    1983-01-01

    The current status of NMR imaging and NMR spectroscopy are summarized. For the most part examples from the March 1983 Puerto Rico symposium are used to illustrate the utility of NMR in medicine. 18 refs., 5 figs

  10. Progress report: Physical Sciences - TASCC Division, 1992 July 01 -December 31

    Energy Technology Data Exchange (ETDEWEB)

    Hardy, J C [ed.

    1993-05-01

    This report summarizes operations and research activities in the Nuclear Physics Branch and the TASCC Accelerators and Development Branch at Chalk River Laboratories during the last half of 1992. 27 figs., 10 tabs.

  11. Notes on projective structures and Kleinian groups

    International Nuclear Information System (INIS)

    Matsuzaki, K.; Velling, J.A.

    1992-11-01

    From the three classes of projective structures defined on an arbitrary hyperbolic Riemann surface, namely bounded discrete projective structures, bounded Kleinian projective structures and bounded covering projective structures, the last one is discussed in this paper. 21 refs, 2 figs

  12. Summary of the Linear Collider Working Group

    International Nuclear Information System (INIS)

    Ruth, R.D.

    1989-01-01

    The focus of the Linear Collider Working Group was on a next generation linear collider. Topics discussed are: parameters; damping rings; bunch compression and pre-acceleration; linac; final focus; and multibunch effects. 8 refs., 3 figs., 7 tabs

  13. Flow of ideal fluid through a central region of a nuclear reactor wire-spaced fuel subassembly

    International Nuclear Information System (INIS)

    Schmid, J.

    1991-04-01

    The results are given of calculations of the flow of an ideal fluid through the central region of a nuclear reactor wire-spaced fuel subassembly. The computer code used is briefly described. (author). 10 figs., 4 refs

  14. Cosmic relics from the big bang

    International Nuclear Information System (INIS)

    Hall, L.J.

    1988-12-01

    A brief introduction to the big bang picture of the early universe is given. Dark matter is discussed; particularly its implications for elementary particle physics. A classification scheme for dark matter relics is given. 21 refs., 11 figs., 1 tab

  15. Common antigenic determinants of haemoglobin as basis of immunological cross-reactivity between chironomid species (Diptera, Chironomidae): studies with human and animal sera.

    Science.gov (United States)

    Baur, X; Dewair, M; Haegele, K; Prelicz, H; Scholl, A; Tichy, H

    1983-01-01

    Chironomids, of which approximately 10,000 species exist, are reported to cause severe immediate type allergic diseases in man. In the present study, immunological cross-reactivity between 14 chironomid species from different continents was proven by RAST inhibition, double immunodiffusion and a new allergoprint technique, based upon PAGE separation of insect crude extracts. Using isolated chironomid haemoglobins and sera of sensitized persons, as well as rabbit antibodies against larval crude extract or against the haemoglobin fraction of Chironomus thummi, it could be proven that cross-reactivity derives at least predominantly from haemoglobin components with common antigenic determinants in the different species. Images Fig. 2 Fig. 7 Fig. 8 Fig. 9 PMID:6197219

  16. PNGS-A unit 4 composite graphite valve packing program

    International Nuclear Information System (INIS)

    Meaney, F.

    1992-01-01

    During the outage of Pickering 4 for retubing and rehabilitation, a composite graphite packing program was completed on 100 conventional valves and 50 nuclear valves. This paper describes component refurbishment, related maintenance, and manpower requirements. 2 figs

  17. Charm production in two-photon collisions

    International Nuclear Information System (INIS)

    Linde, F.L.

    1988-01-01

    The analysis focuses on the production of charmonium resonances η c , χ 0 and χ 2 in two-photon interactions. The measurement of the inclusive production of charged D* mesons is described. 97 refs.; 54 figs.; 15 tabs

  18. women's access to emerging urban land in the sissala east district

    African Journals Online (AJOL)

    User

    The evidence shows that though women do access and hold urban land rights through purchase, they ..... More married women own land than unmarried women. ... satisfied with her” (UNCHS-Habitat, 2001). ... nerative jobs as shown in Fig.

  19. Antepartum sonographically directed computerized tomography in evaluation of a fetal intracranial tumor

    International Nuclear Information System (INIS)

    Thomas, R.L.; Hess, L.W.; Johnson, T.R.B.; Johns Hopkins Univ., Baltimore, MD

    1988-01-01

    The case presented involves prenatal diagnosis of a fetal intracranial tumor. The case demonstrates some of the technical and ethical dilemmas involved in prenatal diagnoses and subsequent parental counselling. 15 refs.; 4 figs.; 1 table

  20. Electroweak physics and electron scattering

    International Nuclear Information System (INIS)

    Henley, E.M.; Hwang, W.Y.P.

    1988-01-01

    The electroweak theory is developed and applied to electron scattering from nucleons and light nuclei. It is shown that these scatterings can be used to test the standard theory and probe structure effects. 33 refs., 5 figs

  1. Personnel neutron dosimetry

    International Nuclear Information System (INIS)

    Hankins, D.

    1982-04-01

    This edited transcript of a presentation on personnel neutron discusses the accuracy of present dosimetry practices, requirements, calibration, dosemeter types, quality factors, operational problems, and dosimetry for a criticality accident. 32 figs

  2. A review of formulas for predicting irradiation embrittlement of reactors vessel materials

    International Nuclear Information System (INIS)

    Petrequin, P.

    1995-01-01

    Formulas developed in different countries for predicting irradiation embrittlement of reactors vessel materials are presented. Results of predictions were compared with different data sets, from surveillance programmes or studies in test reactors, with different residual elements contents. Figs

  3. RESEARCH NOTE Aniridia due to a novel microdeletion affecting ...

    Indian Academy of Sciences (India)

    Andreas Syrimis

    development of the central nervous system. ... hypoplasia, which was confirmed by optical coherence tomography (OCT) of the macula (Fig. 1B- ... DCD1, IMMP1L, DNAJC24 and ELP4 was also reported to have autism spectrum disorder and.

  4. Radiolysis of Fricke solution: initial experiments with the pelletron facility

    International Nuclear Information System (INIS)

    Sharma, S.B.; Rao, B.S.M.

    1994-01-01

    Experimental details of heavy ion irradiation of aqueous solutions using the Nuclear Science Centre (NSC) pelletron facility and the initial results from the radiolysis of Fricke solution using oxygen-16 ions are reported. (author). 4 refs., 1 fig

  5. Superconducting LINAC booster for the pelletron accelerator at Bombay

    International Nuclear Information System (INIS)

    Pillay, R.G.; Kurup, M.B.; Jain, A.K.; Biswas, D.; Kori, S.A.; Srinivasan, B.

    1989-01-01

    A superconducting heavy ion linear accelerator being constructed as a booster for the 14 UD pelletron installed recently at Bombay. The work involved in this project and the progress made so far are reviewed. (author). 15 refs., 8 figs

  6. Surface and interface electronic structure: Third year progress report, December 1, 1988--November 30, 1989

    International Nuclear Information System (INIS)

    Kevan, S.D.

    1989-01-01

    This paper discusses the following topics: linewidths of surface states and resonances; surface bonds and fermi surface of Pd(001); state-resonance transition of Ta(011); and electronic structure of W(010)-2H. 5 figs

  7. Elastic constants of the hard disc system in the self-consistent free volume approximation

    International Nuclear Information System (INIS)

    Wojciechowski, K.W.

    1990-09-01

    Elastic moduli of the two dimensional hard disc crystal are determined exactly within the Kirkwood self-consistent free volume approximation and compared with the Monte Carlo simulation results. (author). 22 refs, 1 fig., 1 tab

  8. Epibatidine-derivatives: ligands for the neuronal nicotinic acetylcholine receptor

    International Nuclear Information System (INIS)

    Westera, G.; Patt, J.T.; Jankowski, K.; Bertrand, D.; Spang, J.; Schubiger, P.A.

    1997-01-01

    Epibatidine, isolated from the Ecuadorian frog Epipedobates tricolar, has been synthesized. 11 C-N-methyl derivate is investigated as useful nicotinergic receptor ligand by electrophysiological methods and in vivo mice experiments. (author) 2 figs., 7 refs

  9. In vivo detection of metabolic abnormalities of MS plaques by means of 1H MR spectroscopic imaging

    International Nuclear Information System (INIS)

    's-Gravenmade, E.J.; Vencken, L.M.; Minderhoud, J.M.; Hollander, J.A. den; Luyten, P.R.; Marien, A.J.H.; Oosterwaal, L.J.M.P.

    1991-01-01

    The aim of this study was to identify focal metabolic changes associated with MS lesions, and to establish a possible relationship between the extent of those changes and the activity of the disease. (author). 12 refs.; 4 figs

  10. Experimental SGU background and in sodium water leak noise data provided by the Electricite de France R and D organization for IAEA benchmark tapes

    International Nuclear Information System (INIS)

    Jouneau, C.

    1997-01-01

    The paper describes the data which have been provided to Mr. Shinohara (JAERI) and which have served to generate the Fourth Stage Analysis Benchmark Test Tapes distributed in August 1993. (author). 2 refs, 3 figs

  11. Petroleum hydrocarbon contaminated sites: a review of investigation and remediation regulations and processes

    Energy Technology Data Exchange (ETDEWEB)

    Epelbaum, Michel; Claudio, Jair R. [Bureau Veritas do Brasil Sociedade Classificadora e Certificadora Ltda., Sao Paulo, SP (Brazil)

    1993-12-31

    This paper discusses alternatives on remediation of petroleum hydrocarbon contaminated sites which include groundwater remediation techniques and soil remediation techniques. Finally, the work points out some trends of sites remediation in Brazil and abroad. 6 refs., 1 fig., 7 tabs.

  12. Training for the qualification and competence of nuclear power plant personnel. Working material

    International Nuclear Information System (INIS)

    1993-01-01

    This document contains summaries of the presentations prepared for the IAEA Review Meeting ''Training for the Qualification and Competence of Nuclear Power Plant Personnel''. The individual contributors have been indexed separately for the database. Refs, figs and tabs

  13. Risk management and energy systems

    International Nuclear Information System (INIS)

    Carlevaro, F.; Romerio, F.

    1992-01-01

    In five sessions the following topics were dealt with: risk problems, risk analysis and evaluation tools, risks in industrial societies, risks of energy production, technological risks, ethics and political-social consensus. figs., tabs., refs

  14. Estimates on the minimal period for periodic solutions of nonlinear second order Hamiltonian systems

    International Nuclear Information System (INIS)

    Yiming Long.

    1994-11-01

    In this paper, we prove a sharper estimate on the minimal period for periodic solutions of autonomous second order Hamiltonian systems under precisely Rabinowitz' superquadratic condition. (author). 20 refs, 1 fig

  15. Emulsions inside Gargamelle

    CERN Multimedia

    1978-01-01

    A feasibility test was made with a 2.5 litre emulsion stack installed within the chamber. The stack was contained in a thermally insulated aluminium alloy pressure vessel (photo). See Annual Report 1978 p. 79 Fig. 5.

  16. Atmospheric stability modelling for nuclear emergency response systems using fuzzy set theory

    International Nuclear Information System (INIS)

    Walle, B. van de; Ruan, D.; Govaerts, P.

    1993-01-01

    A new approach to Pasquill stability classification is developed using fuzzy set theory, taking into account the natural continuity of the atmospheric stability and providing means to analyse the obtained stability classes. (2 figs.)

  17. Ecological catastrophe and economical damages. The problems of assessment from Amoco-Cadiz

    International Nuclear Information System (INIS)

    Bonnieux, F.; Rainelli, P.

    1991-01-01

    This book strikes the balance of the accident of the tanker ship Amoco-Cadiz (environmental effects and economic impact) and sets the problem of damages assessment, liabilities, victims compensation. 99 refs., 41 figs., 43 tabs

  18. The influence of geophysical processes on the Earth's rotation

    International Nuclear Information System (INIS)

    Nastula, J.

    1985-01-01

    The problem of the influence of geophysical processes on the Earth's rotation is presented. The role of these processes in the variations of the length of day is described in this part. 27 refs., 19 figs. (author)

  19. models of hourly dry bulb temperature and relative humidity of key

    African Journals Online (AJOL)

    user

    3: Worst cases of MFE for Dry bulb temperature and Relative humidity. Fig. 4: Best cases of ... the Second Joint International Conference of. University of Ilorin, Ilorin, Nigeria and University ... Erbs, D. G., “Models and Applications for Weather.

  20. Congenital pseudarthrosis ofthe tibia - treatInent with free va ...

    African Journals Online (AJOL)

    fonn nonnal callus produces the false joint that gives the condition its name (Fig. 1). ... cases in which the peroneal artety is the dominant vessel. Departments .... ofthe fibula: experimental study and clinical applications. BrJ Plast. Surg 1988 ...